| Basic Information | |
|---|---|
| Family ID | F047197 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 40 residues |
| Representative Sequence | EVLADERTRDVKASLSRDHELIYPPIQEFWDAAVTGTS |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.67 % |
| % of genes near scaffold ends (potentially truncated) | 92.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.33 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.91% β-sheet: 0.00% Coil/Unstructured: 59.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF01872 | RibD_C | 7.33 |
| PF01810 | LysE | 5.33 |
| PF12680 | SnoaL_2 | 4.67 |
| PF07992 | Pyr_redox_2 | 4.67 |
| PF00296 | Bac_luciferase | 4.00 |
| PF03625 | DUF302 | 4.00 |
| PF12697 | Abhydrolase_6 | 2.67 |
| PF07690 | MFS_1 | 2.67 |
| PF01252 | Peptidase_A8 | 2.67 |
| PF17032 | zinc_ribbon_15 | 2.67 |
| PF00583 | Acetyltransf_1 | 2.67 |
| PF06736 | TMEM175 | 2.00 |
| PF08281 | Sigma70_r4_2 | 2.00 |
| PF04542 | Sigma70_r2 | 2.00 |
| PF02894 | GFO_IDH_MocA_C | 1.33 |
| PF12681 | Glyoxalase_2 | 1.33 |
| PF02594 | DUF167 | 1.33 |
| PF13565 | HTH_32 | 1.33 |
| PF12399 | BCA_ABC_TP_C | 1.33 |
| PF01569 | PAP2 | 1.33 |
| PF00496 | SBP_bac_5 | 1.33 |
| PF12833 | HTH_18 | 1.33 |
| PF00561 | Abhydrolase_1 | 0.67 |
| PF00165 | HTH_AraC | 0.67 |
| PF04116 | FA_hydroxylase | 0.67 |
| PF01553 | Acyltransferase | 0.67 |
| PF04672 | Methyltransf_19 | 0.67 |
| PF13460 | NAD_binding_10 | 0.67 |
| PF02979 | NHase_alpha | 0.67 |
| PF13419 | HAD_2 | 0.67 |
| PF04978 | DUF664 | 0.67 |
| PF12146 | Hydrolase_4 | 0.67 |
| PF01609 | DDE_Tnp_1 | 0.67 |
| PF13302 | Acetyltransf_3 | 0.67 |
| PF07885 | Ion_trans_2 | 0.67 |
| PF00903 | Glyoxalase | 0.67 |
| PF03483 | B3_4 | 0.67 |
| PF13426 | PAS_9 | 0.67 |
| PF13561 | adh_short_C2 | 0.67 |
| PF03091 | CutA1 | 0.67 |
| PF09678 | Caa3_CtaG | 0.67 |
| PF00072 | Response_reg | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 7.33 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 7.33 |
| COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 5.33 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 4.00 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 4.00 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.00 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.00 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.00 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.00 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 2.00 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 1.33 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 1.33 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.67 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.67 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.67 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.67 |
| COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.67 % |
| Unclassified | root | N/A | 19.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001403|JGI20205J14842_1018431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 772 | Open in IMG/M |
| 3300001418|JGI20188J14859_1017688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 778 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10076153 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10305065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300004080|Ga0062385_10091722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1446 | Open in IMG/M |
| 3300004633|Ga0066395_10758560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 580 | Open in IMG/M |
| 3300005332|Ga0066388_101428252 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300005436|Ga0070713_100199493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1806 | Open in IMG/M |
| 3300005436|Ga0070713_100344285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1382 | Open in IMG/M |
| 3300005440|Ga0070705_100691753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 800 | Open in IMG/M |
| 3300005445|Ga0070708_100515771 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300005546|Ga0070696_101801774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300005564|Ga0070664_100873373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 842 | Open in IMG/M |
| 3300005577|Ga0068857_100772160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 916 | Open in IMG/M |
| 3300005591|Ga0070761_10425243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 813 | Open in IMG/M |
| 3300005614|Ga0068856_101254795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
| 3300005952|Ga0080026_10015636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1808 | Open in IMG/M |
| 3300005983|Ga0081540_1072379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1588 | Open in IMG/M |
| 3300005993|Ga0080027_10340656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300006028|Ga0070717_10287378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1459 | Open in IMG/M |
| 3300006176|Ga0070765_100540854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1096 | Open in IMG/M |
| 3300006576|Ga0074047_11806488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300006755|Ga0079222_10570315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 854 | Open in IMG/M |
| 3300006804|Ga0079221_10783253 | Not Available | 680 | Open in IMG/M |
| 3300006847|Ga0075431_101091371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 763 | Open in IMG/M |
| 3300006914|Ga0075436_100045524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3026 | Open in IMG/M |
| 3300007982|Ga0102924_1001653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 25395 | Open in IMG/M |
| 3300009148|Ga0105243_10962818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 853 | Open in IMG/M |
| 3300009176|Ga0105242_12755603 | Not Available | 542 | Open in IMG/M |
| 3300009551|Ga0105238_11485256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 706 | Open in IMG/M |
| 3300010048|Ga0126373_12596234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. BMG5.30 | 565 | Open in IMG/M |
| 3300010154|Ga0127503_10420701 | Not Available | 915 | Open in IMG/M |
| 3300010329|Ga0134111_10404702 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 585 | Open in IMG/M |
| 3300010343|Ga0074044_11147773 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010360|Ga0126372_11640017 | Not Available | 683 | Open in IMG/M |
| 3300010362|Ga0126377_12426577 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300010366|Ga0126379_11134386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 888 | Open in IMG/M |
| 3300010366|Ga0126379_12545234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300010376|Ga0126381_104975210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300010398|Ga0126383_10626173 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300010398|Ga0126383_12421619 | Not Available | 610 | Open in IMG/M |
| 3300012209|Ga0137379_11755937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300012210|Ga0137378_10086021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2871 | Open in IMG/M |
| 3300012350|Ga0137372_10510862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 893 | Open in IMG/M |
| 3300012903|Ga0157289_10320739 | Not Available | 555 | Open in IMG/M |
| 3300012929|Ga0137404_10791705 | Not Available | 861 | Open in IMG/M |
| 3300012971|Ga0126369_10475547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1303 | Open in IMG/M |
| 3300012984|Ga0164309_10823094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 749 | Open in IMG/M |
| 3300013104|Ga0157370_10818929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 847 | Open in IMG/M |
| 3300013307|Ga0157372_13175132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300014169|Ga0181531_10264416 | Not Available | 1050 | Open in IMG/M |
| 3300014969|Ga0157376_12446584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300016270|Ga0182036_10562284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
| 3300016294|Ga0182041_10556602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11 | 1002 | Open in IMG/M |
| 3300016341|Ga0182035_11748689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
| 3300016357|Ga0182032_12034450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300016422|Ga0182039_11053373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300016445|Ga0182038_11559352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300017657|Ga0134074_1406282 | Not Available | 506 | Open in IMG/M |
| 3300017924|Ga0187820_1265975 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300017928|Ga0187806_1154789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 758 | Open in IMG/M |
| 3300017959|Ga0187779_10150273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1435 | Open in IMG/M |
| 3300017974|Ga0187777_10623076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300017999|Ga0187767_10009716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1858 | Open in IMG/M |
| 3300018044|Ga0187890_10679433 | Not Available | 581 | Open in IMG/M |
| 3300018058|Ga0187766_10013128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4737 | Open in IMG/M |
| 3300018061|Ga0184619_10458566 | Not Available | 568 | Open in IMG/M |
| 3300020581|Ga0210399_11092278 | Not Available | 639 | Open in IMG/M |
| 3300021180|Ga0210396_10304463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1411 | Open in IMG/M |
| 3300021181|Ga0210388_11414315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300021405|Ga0210387_10272067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1486 | Open in IMG/M |
| 3300021406|Ga0210386_11610686 | Not Available | 538 | Open in IMG/M |
| 3300021420|Ga0210394_11532712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
| 3300021559|Ga0210409_10926873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
| 3300021560|Ga0126371_12164722 | Not Available | 671 | Open in IMG/M |
| 3300022557|Ga0212123_10005099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 23749 | Open in IMG/M |
| 3300022714|Ga0242671_1065536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Aquihabitans → unclassified Aquihabitans → Aquihabitans sp. G128 | 633 | Open in IMG/M |
| 3300024232|Ga0247664_1144455 | Not Available | 558 | Open in IMG/M |
| 3300024254|Ga0247661_1051076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
| 3300025457|Ga0208850_1025533 | Not Available | 1035 | Open in IMG/M |
| 3300025625|Ga0208219_1014205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2478 | Open in IMG/M |
| 3300025634|Ga0208589_1108792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300025885|Ga0207653_10442917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300025906|Ga0207699_10366473 | Not Available | 1020 | Open in IMG/M |
| 3300025916|Ga0207663_10097406 | All Organisms → cellular organisms → Bacteria | 1967 | Open in IMG/M |
| 3300025928|Ga0207700_10213274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1633 | Open in IMG/M |
| 3300025949|Ga0207667_11782624 | Not Available | 580 | Open in IMG/M |
| 3300025981|Ga0207640_10239455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1401 | Open in IMG/M |
| 3300027768|Ga0209772_10093865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 918 | Open in IMG/M |
| 3300027895|Ga0209624_11050436 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300028773|Ga0302234_10322187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300028775|Ga0302231_10117429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1110 | Open in IMG/M |
| 3300028789|Ga0302232_10614717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. WAC 01424 | 534 | Open in IMG/M |
| 3300028881|Ga0307277_10043811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1811 | Open in IMG/M |
| 3300028906|Ga0308309_11311035 | Not Available | 622 | Open in IMG/M |
| 3300029944|Ga0311352_10806505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 733 | Open in IMG/M |
| 3300029951|Ga0311371_12408773 | Not Available | 540 | Open in IMG/M |
| 3300030056|Ga0302181_10425210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300030520|Ga0311372_10869323 | Not Available | 1217 | Open in IMG/M |
| 3300030625|Ga0210259_11967962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 560 | Open in IMG/M |
| 3300030730|Ga0307482_1096995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 801 | Open in IMG/M |
| 3300030879|Ga0265765_1012141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → unclassified Nitriliruptorales → Nitriliruptorales bacterium | 974 | Open in IMG/M |
| 3300031090|Ga0265760_10329292 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031090|Ga0265760_10338313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 537 | Open in IMG/M |
| 3300031543|Ga0318516_10212513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1118 | Open in IMG/M |
| 3300031543|Ga0318516_10309064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11 | 913 | Open in IMG/M |
| 3300031564|Ga0318573_10019737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3019 | Open in IMG/M |
| 3300031679|Ga0318561_10730684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 544 | Open in IMG/M |
| 3300031708|Ga0310686_116151109 | Not Available | 539 | Open in IMG/M |
| 3300031719|Ga0306917_10414627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
| 3300031723|Ga0318493_10796981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300031744|Ga0306918_10350887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11 | 1144 | Open in IMG/M |
| 3300031770|Ga0318521_10585735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
| 3300031781|Ga0318547_10534100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
| 3300031795|Ga0318557_10349575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
| 3300031819|Ga0318568_10734920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11 | 613 | Open in IMG/M |
| 3300031819|Ga0318568_10879922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
| 3300031823|Ga0307478_11021159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
| 3300031846|Ga0318512_10216049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11 | 940 | Open in IMG/M |
| 3300031846|Ga0318512_10372103 | Not Available | 716 | Open in IMG/M |
| 3300031859|Ga0318527_10138678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1016 | Open in IMG/M |
| 3300031879|Ga0306919_10081346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11 | 2234 | Open in IMG/M |
| 3300031896|Ga0318551_10734085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300031897|Ga0318520_10907868 | Not Available | 555 | Open in IMG/M |
| 3300031910|Ga0306923_12137449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300031910|Ga0306923_12402517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
| 3300031954|Ga0306926_11254114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 868 | Open in IMG/M |
| 3300031954|Ga0306926_11282669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
| 3300031962|Ga0307479_10528245 | Not Available | 1163 | Open in IMG/M |
| 3300031981|Ga0318531_10035682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus → Actinoallomurus bryophytorum | 2061 | Open in IMG/M |
| 3300032001|Ga0306922_11433097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 693 | Open in IMG/M |
| 3300032044|Ga0318558_10608827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300032052|Ga0318506_10569119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300032054|Ga0318570_10194703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
| 3300032067|Ga0318524_10161006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1138 | Open in IMG/M |
| 3300032076|Ga0306924_11806928 | Not Available | 637 | Open in IMG/M |
| 3300032089|Ga0318525_10333442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 779 | Open in IMG/M |
| 3300032205|Ga0307472_101964396 | Not Available | 585 | Open in IMG/M |
| 3300032261|Ga0306920_103394008 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300032770|Ga0335085_10409749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1571 | Open in IMG/M |
| 3300032805|Ga0335078_10027378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 8456 | Open in IMG/M |
| 3300032805|Ga0335078_10078692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4805 | Open in IMG/M |
| 3300032805|Ga0335078_10221538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2606 | Open in IMG/M |
| 3300032805|Ga0335078_11056447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 955 | Open in IMG/M |
| 3300032828|Ga0335080_10840190 | Not Available | 946 | Open in IMG/M |
| 3300032829|Ga0335070_10870057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 836 | Open in IMG/M |
| 3300032892|Ga0335081_11868306 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300032893|Ga0335069_10086004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4005 | Open in IMG/M |
| 3300032955|Ga0335076_11304301 | Not Available | 611 | Open in IMG/M |
| 3300033158|Ga0335077_10908541 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.67% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.67% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.33% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.67% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.67% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.67% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.67% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.67% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001403 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 | Environmental | Open in IMG/M |
| 3300001418 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030625 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20205J14842_10184312 | 3300001403 | Arctic Peat Soil | VLADERTRFVKASLPRDHELIYPPVQEFWDAALKGSP* |
| JGI20188J14859_10176881 | 3300001418 | Arctic Peat Soil | DERTRFVKASLPRDQELIYPPVQEFWDAALKGSP* |
| JGIcombinedJ51221_100761531 | 3300003505 | Forest Soil | VEVLADERTRSVKASLPRDHELIYPPIQELWDSAFKGAGQDRP* |
| JGIcombinedJ51221_103050652 | 3300003505 | Forest Soil | VEVLADERTRSVKASLPRDHELIYPPIQELWDSAFKGVSQDRP* |
| Ga0062385_100917223 | 3300004080 | Bog Forest Soil | VEAGQVEVLADERTRTVKASLSRDHELIYPPVQEFWDEAIKGTAP* |
| Ga0066395_107585602 | 3300004633 | Tropical Forest Soil | GQVEVLADERSRFVKQSLPRDHELIYPLIEEFWDAAVGGTG* |
| Ga0066388_1014282521 | 3300005332 | Tropical Forest Soil | QFEVLADERSRFVKASLSHDHELIYPPIQEFWDAAVKGAG* |
| Ga0070713_1001994934 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EAGQIEVLADERSRFVKASLSRDHELIYPPVQEFWDGAISG* |
| Ga0070713_1003442851 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VEAGQVEVLADERTRAVKAELSRDHELIYPPIQEFWDAAVKDTP* |
| Ga0070705_1006917531 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | DAVEAGQIEVLADQRTRDVKASLSRDHELIYPPIQEFWDAAVTGTS* |
| Ga0070708_1005157711 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VEAGQVEVLADERSRIIKASLARDHELIYPQVQEFWDALTRGAR* |
| Ga0070696_1018017742 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | QVEVLADERTRTIKAQLSHDHELIYPPVQEFWDSAVAGTS* |
| Ga0070664_1008733731 | 3300005564 | Corn Rhizosphere | MVRLPGRVKAKLSRDHGIYPPIQEFWDAAVSGTS* |
| Ga0068857_1007721601 | 3300005577 | Corn Rhizosphere | LADERTRTIKAELSRDQELIYPAVQEFWDSAIQGRS* |
| Ga0070761_104252432 | 3300005591 | Soil | VLADERTRTVKASLSRDHELIYPAVQERWDEALEKSP* |
| Ga0068856_1012547952 | 3300005614 | Corn Rhizosphere | ADERTRTVKAELSRDHELIYPPIQEFWDAAVKDTP* |
| Ga0080026_100156365 | 3300005952 | Permafrost Soil | VEAGQVEVLADDRTRQVKAALSRDHELIYPAVQDRWDAARWDAAR* |
| Ga0081540_10723793 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VLADERTRTVKASLLRDHDLIYPPVQEFWDAAVAGTS* |
| Ga0080027_103406561 | 3300005993 | Prmafrost Soil | GQIEVLADERSRTVKASLSRDHELIYPPVQAFWDALLKGAP* |
| Ga0070717_102873783 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EVLADERSRFVKASLSRDHELIYPPVQEFWDGAISG* |
| Ga0070765_1005408541 | 3300006176 | Soil | VLADERTRSVKASLPRDHELIYPPIQELWDSAFKSPGEDRS* |
| Ga0074047_118064881 | 3300006576 | Soil | QIEVLADERTRTVKAELSRDHELIYPPIQEFWDAAVAGTS* |
| Ga0079222_105703152 | 3300006755 | Agricultural Soil | MVRLPGRVKAKLSRDHELIYPPIQEFWDAAVSGTS* |
| Ga0079221_107832531 | 3300006804 | Agricultural Soil | DERSRDVKAKLSRDHELIYPPIQEFWDAAVTGTGA* |
| Ga0075431_1010913711 | 3300006847 | Populus Rhizosphere | IEVLADERSRFIKASLSHDHELIYPPVQEFWDAAVKGTG* |
| Ga0075436_1000455244 | 3300006914 | Populus Rhizosphere | ADERSRFVKQSLPRDHELIYAIEEFWDAAMAGTGGGTG* |
| Ga0102924_10016535 | 3300007982 | Iron-Sulfur Acid Spring | VLADERTRFVKASLPRDQELIYPPVQEFWDSAIKGTS* |
| Ga0105243_109628181 | 3300009148 | Miscanthus Rhizosphere | VLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS* |
| Ga0105242_127556031 | 3300009176 | Miscanthus Rhizosphere | EAGQVEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS* |
| Ga0105238_114852562 | 3300009551 | Corn Rhizosphere | ADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS* |
| Ga0126373_125962341 | 3300010048 | Tropical Forest Soil | DAVEAGQIEVLVGERTRTVKASLSRDHELIYPPIQEFWDAAIQGSQ* |
| Ga0127503_104207013 | 3300010154 | Soil | VLADERSRFVKASLSRDHELIYPPIQEFWDAAVSGTT* |
| Ga0134111_104047021 | 3300010329 | Grasslands Soil | EAGRIEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS* |
| Ga0074044_111477731 | 3300010343 | Bog Forest Soil | EAGQVEVLADERTRTVKASLSRDHELIYPPVQEFWDEAVNGTS* |
| Ga0126372_116400172 | 3300010360 | Tropical Forest Soil | FDAVENGDIEVLADERSRFIKASLSRDHELIYPPIEEFWTAAVTGTS* |
| Ga0126377_124265771 | 3300010362 | Tropical Forest Soil | DERTRTVKASLPRDHELIYPPVQEFWDAAVAGTG* |
| Ga0126379_111343861 | 3300010366 | Tropical Forest Soil | IEVLADERSRTVKAELPRDHELIYPPVQEFWDAAVTGGS* |
| Ga0126379_125452341 | 3300010366 | Tropical Forest Soil | DERSRTVKQSLPRDHELIYPPIQEFWDAAVTGTG* |
| Ga0126381_1049752102 | 3300010376 | Tropical Forest Soil | EVLADERTRTIKAQLSRDQDLIYPPLQKFWDDALEGGS* |
| Ga0126383_106261733 | 3300010398 | Tropical Forest Soil | DERTRTVKAQLSRDHELIYPPVQEFWDAAVAGTS* |
| Ga0126383_124216192 | 3300010398 | Tropical Forest Soil | MTEVLADERTRDVKASLSRDHELIYPPVQEFWDAAVTGSS* |
| Ga0137379_117559372 | 3300012209 | Vadose Zone Soil | VLADERSRFVKASLSRDHELICPPVQAFWDGALQGSR* |
| Ga0137378_100860213 | 3300012210 | Vadose Zone Soil | MLLADERTRFIKASLPRDHELIYPPIREFWTAAVTGKG* |
| Ga0137372_105108622 | 3300012350 | Vadose Zone Soil | GLIEVLADERTRTIKASLSRDHELIYPPVQEFWDAAVKGTG* |
| Ga0157289_103207392 | 3300012903 | Soil | VEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS* |
| Ga0137404_107917051 | 3300012929 | Vadose Zone Soil | VEAGQVEVLADERTRTVKAQLSRDHELIYPPVQEFWDAAVGGTS* |
| Ga0126369_104755473 | 3300012971 | Tropical Forest Soil | AGQIEVLADERTRTVKAELSRDQELIYPPVQEFWDAAVKGTG* |
| Ga0164309_108230941 | 3300012984 | Soil | VLADERSRDVKAKLSRDHELIYLPIQEFWDAAVSGTS* |
| Ga0157370_108189291 | 3300013104 | Corn Rhizosphere | EAGQVEVLADERSRDVKAKLSRDHELIYPPIQEFWDTAVSGTS* |
| Ga0157372_131751321 | 3300013307 | Corn Rhizosphere | IEVLADERSRFVKASLSRDHELIYPPVQEFWDGATGPG* |
| Ga0181531_102644161 | 3300014169 | Bog | VEAGQAEVLVGERTRSIKASLSRDQELIYPSVQELWDSALKGGS* |
| Ga0157376_124465842 | 3300014969 | Miscanthus Rhizosphere | EVLADERSRFVKASLSRDQELIYPPVQEFWDGAISG* |
| Ga0182036_105622842 | 3300016270 | Soil | GQVEVLADERTRTVKAELSRDQELIYPAVQKFWDDALKGGG |
| Ga0182041_105566022 | 3300016294 | Soil | AVEADQVEVLADERTRTVKASLSRDHELIYPPIQEFWDAAVQGTH |
| Ga0182035_117486891 | 3300016341 | Soil | AVERTRFVKASLPRDHELIYPPIQEFWDAAVQSTG |
| Ga0182032_120344502 | 3300016357 | Soil | VLADDRSRFVKASLSRDHELIYPDVQAFWDAAIKATG |
| Ga0182039_110533731 | 3300016422 | Soil | LTDERSRTVKASLPHDHELIYPPIQEFWDAAVGGTG |
| Ga0182038_115593521 | 3300016445 | Soil | QVEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVTGTS |
| Ga0134074_14062821 | 3300017657 | Grasslands Soil | DLEAGQVEVLADERSRDIKAKLSRDHELIYPPIQEFWDAAVSGTS |
| Ga0187820_12659753 | 3300017924 | Freshwater Sediment | QAFDAVEAGQVEVLADEQTRTVKAELSRDQELIYPPLQEFWDDAVRGTP |
| Ga0187806_11547891 | 3300017928 | Freshwater Sediment | ADEQTRTVKAELSRDQDLIYPPLQEFWDDAVRGTPGTPGR |
| Ga0187779_101502733 | 3300017959 | Tropical Peatland | SVVRQALDAVEAGQVEVLADEQTRTVKAEVSRDQELIYPPLQKFWDDAPKGGS |
| Ga0187777_106230763 | 3300017974 | Tropical Peatland | GQVEVLADERSRDVKAKLSRDQELIYPPIQEFWDAAVSGTEA |
| Ga0187767_100097161 | 3300017999 | Tropical Peatland | EAGRIEVLADERSRTVKAELSRDHELIYPPVQEFWDAAVKGAS |
| Ga0187890_106794331 | 3300018044 | Peatland | RRSQEADTAVEVGQIEVLADERTRTVKAELSRDHELIYPPVQEFWDAAVRGAP |
| Ga0187766_100131287 | 3300018058 | Tropical Peatland | GQVEVLADERTRTIKAQLSHDQELIYPPLQKFWDDAPKGGS |
| Ga0184619_104585662 | 3300018061 | Groundwater Sediment | VEADRIEVLADERSRFIKASLSHDHELIYPPVQEFWDAAVKGTG |
| Ga0210399_110922781 | 3300020581 | Soil | SVAQQAFDAVEAGQIEVLADQRSRAVKANLSRDHELIYPPIQEFWDAAVSRTS |
| Ga0210396_103044634 | 3300021180 | Soil | LADERTRTVKAELSRDQELIYPAVQEFWDSALKGPS |
| Ga0210388_114143153 | 3300021181 | Soil | LAAVEAGQVEVLCDERTRTVKAELSRDQELIYPAVQEFWDSALKGTS |
| Ga0210387_102720671 | 3300021405 | Soil | EVLCDERTRTVKAELSRDQELIYPPVQKFWDDAIKGSS |
| Ga0210386_116106862 | 3300021406 | Soil | EVLADERSRFVKASLPRDQELIYPPVQKFWDSALKAHR |
| Ga0210394_115327122 | 3300021420 | Soil | TRSVKASLPRDHELIYPPIQELWDSAFKGPGQDRP |
| Ga0210409_109268731 | 3300021559 | Soil | IEVLADERTRFIKASLPRDHELIYPPVQVFWDAAVTES |
| Ga0126371_121647221 | 3300021560 | Tropical Forest Soil | RAEVLADERSRFVKDSLSRDHELIYPAVQEFWDALLKGS |
| Ga0212123_100050995 | 3300022557 | Iron-Sulfur Acid Spring | VLADERTRFVKASLPRDQELIYPPVQEFWDSAIKGTS |
| Ga0242671_10655361 | 3300022714 | Soil | QIEVLADERTRTVKASLSRDHELIYPPIQEFWDEAIKGTTP |
| Ga0247664_11444551 | 3300024232 | Soil | FDAVEVGQVEVLADERSRDIKAKLSRDHELIYPPIQEFWDAAVSGTPRD |
| Ga0247661_10510762 | 3300024254 | Soil | QIEVLADERSRFVKASLSRDHELIYPPVQEFWDGATGSG |
| Ga0208850_10255332 | 3300025457 | Arctic Peat Soil | VLADERTRFIKASLPRDQELIYPPVQEFWDAALKGAP |
| Ga0208219_10142054 | 3300025625 | Arctic Peat Soil | EVLADERTRFVKASLPRDQELIYPPVQEFWDAALKGSP |
| Ga0208589_11087921 | 3300025634 | Arctic Peat Soil | EAGQIEVLADERSRFVKESLSRDHELIYPPIQAFWDAAVKGTR |
| Ga0207653_104429172 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | EVLADERTRDVKASLSRDHELIYPPIQEFWDAAVTGTS |
| Ga0207699_103664731 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ADQVEVLADERTRTIKAELSRDQELIYPAVQEFWDSAIQGRS |
| Ga0207663_100974064 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LADERTRTIKAQLSHDHELIYPPVQEFWDSAVAGTS |
| Ga0207700_102132741 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EAGQIEVLADERSRFVKASLSRDHELIYPPVQEFWDGAISG |
| Ga0207667_117826241 | 3300025949 | Corn Rhizosphere | LVDERSRFIKASLSHDHELIYPPVQEFWDAAVKGTG |
| Ga0207640_102394553 | 3300025981 | Corn Rhizosphere | VEAGQVEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTPRD |
| Ga0209772_100938651 | 3300027768 | Bog Forest Soil | VLADERTRTVKASLSRDHELIYPSIQEFWDEAIKGTMP |
| Ga0209624_110504361 | 3300027895 | Forest Soil | ESVAQQTFDAVEAGEIEVLTDKRSKSIKASLSRDHELIYPPLQREFFGAPVDGSA |
| Ga0302234_103221872 | 3300028773 | Palsa | EVLVDELTRSVKSTLHRDHELIYPAVQRRYDAATQ |
| Ga0302231_101174291 | 3300028775 | Palsa | VGQIEMLADERTRTVKAELSRDHELIYPPVQEFWDAAVRGAP |
| Ga0302232_106147172 | 3300028789 | Palsa | RQAFDAVEAGQAEVLVGERTRSIKASLSRDQELIYPSVQELWDSALKGGS |
| Ga0307277_100438113 | 3300028881 | Soil | GRIEVLADERSRFIKASLSHDHELIYPPVQEFWDAAVKGTG |
| Ga0308309_113110351 | 3300028906 | Soil | EVLADERSRFVKASLSRDHELIYPPIEEFWDAAVKSTD |
| Ga0311352_108065052 | 3300029944 | Palsa | DAVEVGQIEMLADERTRTVKAELSRDHELIYPPVQEFWDAAVRGAP |
| Ga0311371_124087731 | 3300029951 | Palsa | EEVLVDELTRSVKSTLHRDHELIYPAVQRRYDAATQ |
| Ga0302181_104252101 | 3300030056 | Palsa | AVEAGQAEVLVGERTRSIKASLSRDQELIYPSVQELWDSAPKGGS |
| Ga0311372_108693231 | 3300030520 | Palsa | FDAVEVGQIEMLADERTRTVKAELSRDHELIYPPVQEFWDAAVRGAP |
| Ga0210259_119679622 | 3300030625 | Soil | VLADERSRFAKASLSRDHELIYLTIQAFRDAALRGAS |
| Ga0307482_10969952 | 3300030730 | Hardwood Forest Soil | VEVLADERTRTVKASLSRDHELIYPPVQAFWDEAVKGTS |
| Ga0265765_10121411 | 3300030879 | Soil | DERTRSVKASLPRDHELIYPPIQELWDSAFEGPGRGRP |
| Ga0265760_103292922 | 3300031090 | Soil | ADERTRSVKASLPRDHELIYPPIQELWDSAFKGPGRGRP |
| Ga0265760_103383131 | 3300031090 | Soil | QVEVLADERTRTVKASLSRDHELIYPPIQEFWDEAVKGTS |
| Ga0318516_102125131 | 3300031543 | Soil | EVLADDRSRFVKASLSRDHELIYPDVQAFWDAAIKATG |
| Ga0318516_103090641 | 3300031543 | Soil | ADERTRTVKASLSHDHELIYPPIQEFWDAAVQGIH |
| Ga0318573_100197374 | 3300031564 | Soil | EAGQVEVLADERTRTIKAQLSRDQDLIYPPLQKFWDDALKGGS |
| Ga0318561_107306842 | 3300031679 | Soil | IEVLADERTRTVKASLSRDQELIYPPVQEFWDSITQAH |
| Ga0310686_1161511091 | 3300031708 | Soil | GQVEVLADERTRTVKANLSRDQELIYPGIQEFCDAALAARPG |
| Ga0306917_104146271 | 3300031719 | Soil | FDAVQSGQVEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS |
| Ga0318493_107969811 | 3300031723 | Soil | AGQIEVLVDERTRTVKASLSRDHELIYPPVQEFWDAAVQGSR |
| Ga0306918_103508871 | 3300031744 | Soil | EVLADERTRTVKASLSRDHELIYPPIQEFWDAAVQGTH |
| Ga0318521_105857352 | 3300031770 | Soil | SGQVEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS |
| Ga0318547_105341002 | 3300031781 | Soil | IEVLADERTRNVKASLSRDHELIYPPIQEFWDAAVAGAS |
| Ga0318557_103495752 | 3300031795 | Soil | VEVLTDERSRTVKASLPHDHELIYPPIQEFWDAAVGGTG |
| Ga0318568_107349202 | 3300031819 | Soil | VAKMAFDAVEAGQIEVLVGERTRTIKASLSRDHELIYPPIQEFWDAAIQGGQ |
| Ga0318568_108799221 | 3300031819 | Soil | ADERTRTVKASLSRDHELIYPPIQEFWDEAVKGTA |
| Ga0307478_110211591 | 3300031823 | Hardwood Forest Soil | ESGQVEVLADQRSRYVKASLPRDHEVIYPPLQESYDSALTGGS |
| Ga0318512_102160491 | 3300031846 | Soil | EVLADERTRTVKASLSRDHELIYPPIQEFWDAAVQRSH |
| Ga0318512_103721031 | 3300031846 | Soil | AVEVGQVEVLADERTRTVKAELSRDQELIYPAVQKFWDDALKGGG |
| Ga0318527_101386783 | 3300031859 | Soil | EAGQIEVLADERTRTVKASLSRDHELIYPPIQEFWDEAVKGTA |
| Ga0306919_100813461 | 3300031879 | Soil | GQVEVLADERSRFVKQSLPRDHELIYPPIEEFWDAAVGGTG |
| Ga0318551_107340851 | 3300031896 | Soil | QVEVLADERTRTIKAQLSRDQELIYPPLQKFWDDAVKGGS |
| Ga0318520_109078682 | 3300031897 | Soil | TRIVKSELSRDHELIYPPIEAFWDAAVSGARSAPVT |
| Ga0306923_121374491 | 3300031910 | Soil | EVGQVEVLADERTRFVKASLSRDYELIYPTVQEFWDTALKGSG |
| Ga0306923_124025172 | 3300031910 | Soil | DAVEAGQIEVLADERSRFVKGSLSRDHELIYPAIQQFWDDALAGSQ |
| Ga0306926_112541142 | 3300031954 | Soil | EAGQVEVLADERTRTVKAQLSRDHELIYPPVQEFWDAAVAGTG |
| Ga0306926_112826692 | 3300031954 | Soil | AGQVEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVTGTS |
| Ga0307479_105282452 | 3300031962 | Hardwood Forest Soil | AGQIEVLADERTRTVKAELSRDHELIYPPVQEFWDAAVRGTP |
| Ga0318531_100356821 | 3300031981 | Soil | VLADERTRTIKAQLSRDQDLIYPPLQKFWDDALKGGS |
| Ga0306922_114330971 | 3300032001 | Soil | QIEVLADERTRNVKASLSRDHELIYPPIQEFWDAAVAGAS |
| Ga0318558_106088271 | 3300032044 | Soil | VFDAVEAGQIEVLVDERTRTVKASLSRDHELIYPPVQEFWDAAVQGSR |
| Ga0318506_105691192 | 3300032052 | Soil | EVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS |
| Ga0318570_101947032 | 3300032054 | Soil | LADERTRTVKASLSRDHELIYPPIQEFWDEAVKGTA |
| Ga0318524_101610061 | 3300032067 | Soil | EVLADERSRFVKASLSRDHELIYPDVQAFWDAAIKATG |
| Ga0306924_118069281 | 3300032076 | Soil | EVGQVEVLADERTRFVKASLSRDHELIYPTVQEFWDTALKGSG |
| Ga0318525_103334421 | 3300032089 | Soil | VEVLADERTRTIKASLPHDHELIYPQVQEFWDALTRGSG |
| Ga0307472_1019643961 | 3300032205 | Hardwood Forest Soil | VLADERSRAVKAKLSRDHELIYPPIQEFWDAAVGGSG |
| Ga0306920_1033940081 | 3300032261 | Soil | EAGQVEVLADERTRTIKAQLSHDQELIYPPLQKFWDDAPKGGS |
| Ga0335085_104097491 | 3300032770 | Soil | EAGQIEVLADERTRTVKASLSRDQELIYPPVQEFWDAAVTGNR |
| Ga0335078_1002737810 | 3300032805 | Soil | VAQQVFDAVEAGQAEVLCDERTRTIKAELSRDQELIYPAVQKFWDDAIKGSS |
| Ga0335078_100786928 | 3300032805 | Soil | VEVLADERTRTIKAELSRDQELIYPAVQEFWDSAIQGGS |
| Ga0335078_102215381 | 3300032805 | Soil | ADERTRTVKASLSRDQELIYPPVQEFWDAAVTGTP |
| Ga0335078_110564473 | 3300032805 | Soil | LADERTRTVKAQLPRDHELIYPPVQEFWDSAVSGTS |
| Ga0335080_108401902 | 3300032828 | Soil | LADERTRKVKAELSRDHELIYPPIQEFWDAAVKGTS |
| Ga0335070_108700573 | 3300032829 | Soil | EARQIEVLADERTRTVKAELSRDHELIYPPVQEFWDAAVRGAP |
| Ga0335081_118683061 | 3300032892 | Soil | RVEVLADERTRKVKAELSRDHELIYPPIQEFWDAAVKGTS |
| Ga0335069_100860041 | 3300032893 | Soil | EAGQVEVLADERSRDVKAKLSRDQELIYPPIQEFWDAAVSGTEA |
| Ga0335076_113043012 | 3300032955 | Soil | EAGQTEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTPQ |
| Ga0335077_109085413 | 3300033158 | Soil | ADERTRTVKAELSRDHELIYPPVQEFWDAAVGGTP |
| ⦗Top⦘ |