NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047188

Metagenome / Metatranscriptome Family F047188

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047188
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 42 residues
Representative Sequence HTGNLFPGIASAFARHGFQVVARRKPDRPVMRKRLGAST
Number of Associated Samples 123
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.67 %
% of genes near scaffold ends (potentially truncated) 97.33 %
% of genes from short scaffolds (< 2000 bps) 94.67 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(41.333 % of family members)
Environment Ontology (ENVO) Unclassified
(42.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(44.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.96%    β-sheet: 16.42%    Coil/Unstructured: 74.63%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF01717Meth_synt_2 7.33
PF01411tRNA-synt_2c 6.67
PF07992Pyr_redox_2 6.00
PF00254FKBP_C 5.33
PF00924MS_channel 3.33
PF04185Phosphoesterase 2.67
PF03459TOBE 2.00
PF14716HHH_8 2.00
PF02782FGGY_C 1.33
PF12833HTH_18 1.33
PF13193AMP-binding_C 1.33
PF13380CoA_binding_2 1.33
PF00005ABC_tran 1.33
PF00378ECH_1 1.33
PF01738DLH 1.33
PF03551PadR 1.33
PF00196GerE 1.33
PF00561Abhydrolase_1 0.67
PF030614HBT 0.67
PF01370Epimerase 0.67
PF14711Nitr_red_bet_C 0.67
PF01266DAO 0.67
PF08044DUF1707 0.67
PF12840HTH_20 0.67
PF04237YjbR 0.67
PF00890FAD_binding_2 0.67
PF01494FAD_binding_3 0.67
PF13302Acetyltransf_3 0.67
PF04226Transgly_assoc 0.67
PF01243Putative_PNPOx 0.67
PF00903Glyoxalase 0.67
PF00440TetR_N 0.67
PF03483B3_4 0.67
PF14833NAD_binding_11 0.67
PF13561adh_short_C2 0.67
PF12831FAD_oxidored 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 7.33
COG0013Alanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 6.67
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 3.33
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 3.33
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 2.67
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.33
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.33
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.33
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.33
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.67
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.67
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.67
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.67
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.00 %
UnclassifiedrootN/A14.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_101882199All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300004281|Ga0066397_10036325All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300004479|Ga0062595_102453699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300005367|Ga0070667_101792358All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300005434|Ga0070709_10748617All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300005435|Ga0070714_101648050All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300005436|Ga0070713_101058490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia783Open in IMG/M
3300005441|Ga0070700_101819808All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005445|Ga0070708_100301882All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300005471|Ga0070698_101109055All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300005530|Ga0070679_102166138All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005535|Ga0070684_100078198All Organisms → cellular organisms → Bacteria2922Open in IMG/M
3300005577|Ga0068857_101184453All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300005712|Ga0070764_10191448All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300005764|Ga0066903_105343508All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300006041|Ga0075023_100549219All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300006176|Ga0070765_101381349All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300006755|Ga0079222_10086998All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300006755|Ga0079222_12084903All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300009011|Ga0105251_10016685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3960Open in IMG/M
3300009090|Ga0099827_10558036Not Available986Open in IMG/M
3300009090|Ga0099827_10615668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria937Open in IMG/M
3300009100|Ga0075418_13044396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300009521|Ga0116222_1463767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Thermobifida → Thermobifida halotolerans553Open in IMG/M
3300010043|Ga0126380_10132720All Organisms → cellular organisms → Bacteria → Proteobacteria1561Open in IMG/M
3300010043|Ga0126380_12271947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → unclassified Streptosporangium → Streptosporangium sp. 'caverna'503Open in IMG/M
3300010048|Ga0126373_11104205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria859Open in IMG/M
3300010048|Ga0126373_11419261Not Available760Open in IMG/M
3300010337|Ga0134062_10610238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. HBU206391563Open in IMG/M
3300010359|Ga0126376_12982580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300010361|Ga0126378_11395495All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300010362|Ga0126377_13147341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300010366|Ga0126379_10703389Not Available1104Open in IMG/M
3300010366|Ga0126379_12403346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300010366|Ga0126379_12683979All Organisms → cellular organisms → Bacteria → Terrabacteria group595Open in IMG/M
3300010371|Ga0134125_12843784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300010376|Ga0126381_103670498Not Available601Open in IMG/M
3300010398|Ga0126383_12277281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300010399|Ga0134127_10157794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2068Open in IMG/M
3300010876|Ga0126361_10426094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300012206|Ga0137380_11441257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300012207|Ga0137381_10240456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1573Open in IMG/M
3300012208|Ga0137376_10504131All Organisms → cellular organisms → Bacteria → Terrabacteria group1050Open in IMG/M
3300012351|Ga0137386_10001926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces13205Open in IMG/M
3300012356|Ga0137371_10185529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1630Open in IMG/M
3300012359|Ga0137385_11431199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300012961|Ga0164302_10172503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1299Open in IMG/M
3300012985|Ga0164308_11665021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300013307|Ga0157372_13261757All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300016294|Ga0182041_11069691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria732Open in IMG/M
3300016341|Ga0182035_10737052Not Available861Open in IMG/M
3300016341|Ga0182035_11616290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300016371|Ga0182034_10847456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium784Open in IMG/M
3300017654|Ga0134069_1313583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300017792|Ga0163161_10796845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia794Open in IMG/M
3300017821|Ga0187812_1261395Not Available551Open in IMG/M
3300017959|Ga0187779_10051547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2401Open in IMG/M
3300018060|Ga0187765_10396706All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300020580|Ga0210403_11308776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii553Open in IMG/M
3300020581|Ga0210399_10642862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia875Open in IMG/M
3300020583|Ga0210401_10468391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1122Open in IMG/M
3300021402|Ga0210385_10833376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia708Open in IMG/M
3300021406|Ga0210386_11657414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300021407|Ga0210383_10944773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia733Open in IMG/M
3300021474|Ga0210390_10151749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1951Open in IMG/M
3300021475|Ga0210392_10999985All Organisms → cellular organisms → Bacteria → Terrabacteria group626Open in IMG/M
3300021560|Ga0126371_11476943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria809Open in IMG/M
3300025919|Ga0207657_10711868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia779Open in IMG/M
3300025921|Ga0207652_11191853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia663Open in IMG/M
3300025922|Ga0207646_11274281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300026078|Ga0207702_11591716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium647Open in IMG/M
3300026467|Ga0257154_1016781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1044Open in IMG/M
3300027889|Ga0209380_10331457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii894Open in IMG/M
3300027895|Ga0209624_10354311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii978Open in IMG/M
3300028047|Ga0209526_10663259Not Available661Open in IMG/M
3300028799|Ga0307284_10047819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1494Open in IMG/M
3300028879|Ga0302229_10366119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300031446|Ga0170820_17807385Not Available521Open in IMG/M
3300031543|Ga0318516_10282629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii959Open in IMG/M
3300031543|Ga0318516_10686049Not Available582Open in IMG/M
3300031546|Ga0318538_10835803Not Available500Open in IMG/M
3300031549|Ga0318571_10081553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1028Open in IMG/M
3300031561|Ga0318528_10727169Not Available531Open in IMG/M
3300031564|Ga0318573_10415585Not Available723Open in IMG/M
3300031572|Ga0318515_10069623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1805Open in IMG/M
3300031572|Ga0318515_10372658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia765Open in IMG/M
3300031640|Ga0318555_10102831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1506Open in IMG/M
3300031640|Ga0318555_10158991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1211Open in IMG/M
3300031640|Ga0318555_10181320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1132Open in IMG/M
3300031668|Ga0318542_10128965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1243Open in IMG/M
3300031679|Ga0318561_10770054Not Available529Open in IMG/M
3300031680|Ga0318574_10304447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii926Open in IMG/M
3300031680|Ga0318574_10351261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia859Open in IMG/M
3300031682|Ga0318560_10409185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia734Open in IMG/M
3300031713|Ga0318496_10059504All Organisms → cellular organisms → Bacteria1994Open in IMG/M
3300031713|Ga0318496_10184661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1144Open in IMG/M
3300031715|Ga0307476_10926009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces643Open in IMG/M
3300031723|Ga0318493_10131487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1282Open in IMG/M
3300031723|Ga0318493_10857292Not Available513Open in IMG/M
3300031724|Ga0318500_10638845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → Microbispora bryophytorum541Open in IMG/M
3300031747|Ga0318502_10569192Not Available681Open in IMG/M
3300031747|Ga0318502_11009842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales507Open in IMG/M
3300031748|Ga0318492_10277117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia870Open in IMG/M
3300031751|Ga0318494_10381691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia817Open in IMG/M
3300031754|Ga0307475_10434000Not Available1056Open in IMG/M
3300031781|Ga0318547_10172085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1283Open in IMG/M
3300031781|Ga0318547_10458983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia785Open in IMG/M
3300031793|Ga0318548_10387423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales685Open in IMG/M
3300031794|Ga0318503_10056854All Organisms → cellular organisms → Bacteria → Terrabacteria group1200Open in IMG/M
3300031794|Ga0318503_10257046Not Available567Open in IMG/M
3300031798|Ga0318523_10612838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300031819|Ga0318568_10732802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium614Open in IMG/M
3300031832|Ga0318499_10064142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1388Open in IMG/M
3300031832|Ga0318499_10124101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1004Open in IMG/M
3300031846|Ga0318512_10117970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana1261Open in IMG/M
3300031859|Ga0318527_10405372Not Available581Open in IMG/M
3300031860|Ga0318495_10065156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1621Open in IMG/M
3300031890|Ga0306925_10388146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1497Open in IMG/M
3300031890|Ga0306925_12172724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii517Open in IMG/M
3300031896|Ga0318551_10630460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300031897|Ga0318520_10173258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1262Open in IMG/M
3300031910|Ga0306923_12342870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300031941|Ga0310912_10410644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1054Open in IMG/M
3300031981|Ga0318531_10367497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300032001|Ga0306922_10363076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1553Open in IMG/M
3300032001|Ga0306922_10427699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1417Open in IMG/M
3300032010|Ga0318569_10080849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1448Open in IMG/M
3300032025|Ga0318507_10156516All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300032041|Ga0318549_10173052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia966Open in IMG/M
3300032041|Ga0318549_10272066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia763Open in IMG/M
3300032052|Ga0318506_10096675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1258Open in IMG/M
3300032052|Ga0318506_10203348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia874Open in IMG/M
3300032052|Ga0318506_10451418Not Available570Open in IMG/M
3300032055|Ga0318575_10486619All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300032063|Ga0318504_10281659All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300032064|Ga0318510_10147381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia927Open in IMG/M
3300032076|Ga0306924_12225738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300032174|Ga0307470_10701379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia771Open in IMG/M
3300032261|Ga0306920_104111353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300032770|Ga0335085_10370315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1672Open in IMG/M
3300032770|Ga0335085_11044417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae880Open in IMG/M
3300032828|Ga0335080_11319583Not Available720Open in IMG/M
3300032828|Ga0335080_12295271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300032892|Ga0335081_10010833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia14736Open in IMG/M
3300032895|Ga0335074_10102217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3770Open in IMG/M
3300032895|Ga0335074_10251589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2078Open in IMG/M
3300033134|Ga0335073_11137822Not Available790Open in IMG/M
3300033290|Ga0318519_10586450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia676Open in IMG/M
3300033290|Ga0318519_11017090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300033805|Ga0314864_0152144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii589Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil41.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.33%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.33%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.33%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.67%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.67%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.67%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.67%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.67%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026467Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-AEnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10188219923300002245Forest SoilYPVDTAVPAHTRNLFPGVVSAFAQHGFQVVARRKPDRPVMRLLMP*
Ga0066397_1003632513300004281Tropical Forest SoilTAVPGHTRNLFLGVASVFAEHGFQVVARRQPDRPVMRKAFAAST*
Ga0062595_10245369913300004479SoilPVDTAVRGHSGNLFPGVAAAFARQGFEVVARRKPDRPVMRKVLGGARVST*
Ga0070667_10179235823300005367Switchgrass RhizosphereSHTGNLFPGIAAAFDRHGFEVVARRKPDRPVMRKLLGDVRDFST*
Ga0070709_1074861723300005434Corn, Switchgrass And Miscanthus RhizosphereLFPGIAAAFARHGFEVVARRKPDRPVMRKLLGDVRDSST*
Ga0070714_10164805013300005435Agricultural SoilVPSHTGNLFPGIAAAFARHGFEVVARRKPDRPVMRKLLGTPGQG*
Ga0070713_10105849013300005436Corn, Switchgrass And Miscanthus RhizospherePALESYPVDTTVPSHTGNLFPGIAAAFARHGFEVVARRKLDRPVMRKLLGDVRDFST*
Ga0070700_10181980813300005441Corn, Switchgrass And Miscanthus RhizosphereGNLFPGIAAAFDRHGFEVVARRKPDRPVMRKLLGDVRDFST*
Ga0070708_10030188223300005445Corn, Switchgrass And Miscanthus RhizosphereDTTVPGHTRNLFLGVASAFAQHGFQVVARRQPDRPVMRKVLDTST*
Ga0070698_10110905523300005471Corn, Switchgrass And Miscanthus RhizosphereVPSHTGNLFPGIAAVFARHGFEVVARRKPDRPVMRKLLGPA*
Ga0070679_10216613813300005530Corn RhizosphereVPSHTGNLFPGIAAAFARHGFEVVARRKPDRPVMRKLLGDVRDFST*
Ga0070684_10007819833300005535Corn RhizospherePSHTGNLFPGIAAAFDRHGFEVVARRKPDRPVMRKLLGDVRDFST*
Ga0068857_10118445313300005577Corn RhizosphereHTGNLFPGIAAAFARHGFEEVARRKPDRPVMRKLLGDVRDFST*
Ga0070764_1019144833300005712SoilMTGHTGNLFPGVASIFAAHGFEVIARRKPDRPVMRRSTGGRELR*
Ga0066903_10534350813300005764Tropical Forest SoilPVDIAVPGHTRNLFPGIASTFARHGFGVVARHKPDRPVMRRPLTAPA*
Ga0075023_10054921923300006041WatershedsFLGVASVFAAHGFHEVARPHPARPVMRKPLNTAT*
Ga0070765_10138134923300006176SoilLFPGVAAAFARHGFGVVARRTPDRPVMRLSPLAR*
Ga0079222_1008699823300006755Agricultural SoilVPSHTGNLFPGIAAAFARHGFEVVARRKPDRPVMRKLLGDVRHFST*
Ga0079222_1208490323300006755Agricultural SoilDTAVPGHTRNLFPGVAATFAGHGFQVVARHKPDRPVMRRRTGT*
Ga0105251_1001668513300009011Switchgrass RhizosphereTVPSHTGNLFPGIAAAFARHGFEVVARRKPDRPVMRKLLGDVRDFST*
Ga0099827_1055803613300009090Vadose Zone SoilYPVDTAVPGHTRNLFPGIASTFAQHGFHVVARRQPDRPVMRKILGRDGRAAS*
Ga0099827_1061566833300009090Vadose Zone SoilYPVDTAVPGHTRNLFPGTVPAFARHGFRVVARRKPDRPVMRRSLSTQT*
Ga0075418_1304439613300009100Populus RhizosphereRNLFLGVASVFAQRGFQVVARRRPDRPVMRKSLAPPT*
Ga0116222_146376713300009521Peatlands SoilNLFPGVASEFARHGFGVVARRKPDRPVMRKGLTASA*
Ga0126380_1013272013300010043Tropical Forest SoilYPVDTAVPGHTRNLFLGVASVFAEHGFQVVARRQPDRPVMRKAFASST*
Ga0126380_1227194713300010043Tropical Forest SoilHTGNLFPGIASAFARHGFQVVARRKPDRPVMRKRLGAST*
Ga0126373_1110420533300010048Tropical Forest SoilVPGHTRNLFLGIASAFARHGFHVVARRQPDRPIMRKALSTST*
Ga0126373_1141926123300010048Tropical Forest SoilAVPGHTRNLFLGVASAFDEHGFQVVARRQPDRPVMRKVLAAST*
Ga0134062_1061023823300010337Grasslands SoilPGIAAAFARRGFEEVARRKPDRPVMRKLLGDVRTGPPGPI*
Ga0126376_1298258013300010359Tropical Forest SoilDTTVPGHTRNLFLGVASVFAQHGFQVVARRQPDRPVMRKVLNTST*
Ga0126378_1139549513300010361Tropical Forest SoilAVPGHTGNLFPGIASTFARHGFGVVARHKPDRPVMRRPLTASG*
Ga0126377_1314734113300010362Tropical Forest SoilTRNLFPGVASVFAGRGFEVVARRKPDRPIMRKPLL*
Ga0126379_1070338913300010366Tropical Forest SoilTAVPGHTRNLFLGVASVFAGHGFQVVARRQPDRPVMRKVLAAST*
Ga0126379_1240334613300010366Tropical Forest SoilVPGHTTNLFPGVASAFARHGFRVVARRKPDRPVMRHDLSR*
Ga0126379_1268397913300010366Tropical Forest SoilNLFPGVAAAFARHGFEVVARRKPDRPVMRRALGPAEIST*
Ga0134125_1284378413300010371Terrestrial SoilRNLFLGVASVFAQHGFQVVARRQPDRPVMRRVLNTST*
Ga0126381_10367049823300010376Tropical Forest SoilGHSRNAFTGTAATFARHGFRVVARGKPDRPIMRRVF*
Ga0126383_1227728113300010398Tropical Forest SoilAHTGNLFPGVASVFARHGFRVVARRKLDRPVMRKDLSASA*
Ga0134127_1015779433300010399Terrestrial SoilFPGIAAAFARHGFEEVARRKPDRPVMRKLLGDVRDFST*
Ga0126361_1042609423300010876Boreal Forest SoilVALVAATPGHTTNLFPGVASAFARHGFQVVARRKPDRPVMRLSGLDR*
Ga0137380_1144125723300012206Vadose Zone SoilFPGIASTFAQHGFHVVARRQPDRPVMRKILGRDGRAAS*
Ga0137381_1024045633300012207Vadose Zone SoilVPGHTRNLFPGTVPAFARHGFRVVARRKPDRPVMRRSLSTQT*
Ga0137376_1050413113300012208Vadose Zone SoilNLFPGIAAAFARHGFEEVARRKPDRPVMRKLLGDVRDFST*
Ga0137386_1000192613300012351Vadose Zone SoilPGHTRNLFPGIASTFAQHGFHVVARRQPDRPVMRKILGRDGRAAS*
Ga0137371_1018552923300012356Vadose Zone SoilLFLGVAAVFAQHGFQVVARRQPDRPVMRKVLGTST*
Ga0137385_1143119913300012359Vadose Zone SoilTAVSGHTGNLFPGIASVFAVHGFRVVARRKPDRPVMRRILAAHLVSWPAE*
Ga0164302_1017250323300012961SoilYPVDTTVPSHTGNLFPGIAAAFARHGFEVVARRKPDRPVTRKLLGDVRDFST*
Ga0164308_1166502113300012985SoilIAAAFARHGFEVVARRKPDRPVMRKLLGDVRDFST*
Ga0157372_1326175713300013307Corn RhizosphereRNRFPGTARAFERAGFRVVARRAPDRPIMRYSFT*
Ga0182041_1106969113300016294SoilHTRNLFLGVASVFAQHGFQVVARHQPDRPMMRKVLATTP
Ga0182035_1073705213300016341SoilTAVPGHTRNLFLGVASAFAQHGFQAVARHQPDRPMMRKVLATTA
Ga0182035_1161629023300016341SoilGNLFPGIAAVFARHGFQVVARRKPDRPVMRKAVRPA
Ga0182034_1084745623300016371SoilNLFLGVASVFAQHGFEVVARRQPDRPIMRKALGAAT
Ga0134069_131358323300017654Grasslands SoilGHTRNLFLGVAAVFAQHGFQVVARRQPDRPVMRKVLGTST
Ga0163161_1079684523300017792Switchgrass RhizosphereVPSHTGNLFPGIAAAFARHGFEVVARRKPDRPVMRKLLGDVRDFST
Ga0187812_126139533300017821Freshwater SedimentTNLFPGAAPAFAPHGFQVLARRKPDRPVMRRGLSGPAR
Ga0187779_1005154713300017959Tropical PeatlandVPGHTRNLFPGTASAFARHGFQVVARRKPDRPVMRKGLTAPA
Ga0187765_1039670613300018060Tropical PeatlandVPGHTGNLFPGIAAAFAQHGFRVVARRRPDRPVMRKILGDTA
Ga0210403_1130877623300020580SoilVPGHTTNLFPGVASAFARHGFQVAARRKPDRPVMRRDLRAMT
Ga0210399_1064286213300020581SoilVPSRTGNLFPGIAAAFARHGFRVVARRKPDRPVMRKILGPA
Ga0210401_1046839113300020583SoilNLFPGVAAAFARHGFGVVARRKPDRPVMRLSPLAW
Ga0210385_1083337613300021402SoilTGNLFPGVASIFAAHGFEVIARRKPDRPVMRRSTGGRELR
Ga0210386_1165741423300021406SoilPVDTAVPGHTTNLFPGVAAAFARHGFGVVARRKPDRPVMRLSLLAR
Ga0210383_1094477313300021407SoilTAVPGHTTNLFPGVAAAFARHGFGVVARRKPDRPVMRLSLLAR
Ga0210390_1015174933300021474SoilGHTTNLFPGVAAAFARHGFQVVARRKPDRPVLRLSLDD
Ga0210392_1099998523300021475SoilRQLFPGSAAAFARHGFEVAARRKPDRPVMRKFLGDVRDFST
Ga0126371_1147694323300021560Tropical Forest SoilAVPAATGNLFPGVASVFAGHGFQVVARRKPDRPVMRKALGASPQL
Ga0207657_1071186813300025919Corn RhizosphereTGNLFPGVASAFARRGFQVVARRRPDRPVMRKILGASA
Ga0207652_1119185313300025921Corn RhizosphereSHTGNLFPGIAAAFARHGFEVVARRKPDRPVMRKLLGDVRDFST
Ga0207646_1127428123300025922Corn, Switchgrass And Miscanthus RhizosphereDTAVPGHTRNLFLGVASAFAEHGFQVVARRQPDRPVMRKALAASPDRASTSAHAE
Ga0207702_1159171623300026078Corn RhizosphereDTSVPSHTGNVFPGIASVFARHGFQVVARRKPDRPVMRKLLGPA
Ga0257154_101678113300026467SoilVDTAVPGHTTNLFPGVAAAFARRGFQVVARRKPDRPVMRLSPLTP
Ga0209380_1033145733300027889SoilAVPGHTTNLFPGVAAAFARHGFGVVARRKPDRPVMRLSPLAW
Ga0209624_1035431113300027895Forest SoilHTTNLFPGVATTLARHGFAVVARRKPDRPVMRRRLDEPSAQ
Ga0209526_1066325923300028047Forest SoilSRTRNLFPGVALAFARHGFQVIVRHKPDRPLMRRDLSWPA
Ga0307284_1004781913300028799SoilPVDTTVPSHTGNLFPGIAAAFARHGFEVVARRKPDRPVMRKLLGDVRDSST
Ga0302229_1036611913300028879PalsaPGHTRNAFTGTAAAFARHGFEVVARRKADRPIMRLSLT
Ga0170820_1780738513300031446Forest SoilNLFVGIASAFAEHGFEVVARRNPDRPIMRKSLALPGG
Ga0318516_1028262913300031543SoilGHTTNLFPGVASAFARHGFGVVARRKPDRPVMRRDLRAAVQR
Ga0318516_1068604913300031543SoilVDIAVPGHTRNLFPGIASTFARHGFGVVARHKPDRPVMRRPLTAPA
Ga0318538_1083580323300031546SoilVDTAAPAATGNLFPGVASVFAGRGFQVVARRKPDRPVMRKALSASPQL
Ga0318571_1008155313300031549SoilDTAVPGHTRNLFLGVASAFDEHGFQVVARRQPDRPVMRKVLAAST
Ga0318528_1072716913300031561SoilPVDTSVPAHTGNLFPGTVAAFARHGFGVVARRKPDRPVMRKALRASPQV
Ga0318573_1041558523300031564SoilAVPGHTGNLFPGVASTFARHGFAEVARHKPDRPVMRKIL
Ga0318515_1006962313300031572SoilLFLGVASVFAQHGFEVVARRQPDRPIMRKALGAAT
Ga0318515_1037265823300031572SoilNLFLGVASVFAQHGFQAVARHQPDRPMMRKVLATTP
Ga0318555_1010283113300031640SoilVPAHTTNLFPGIAAVFARHGFEVVARRKPDRPVMRRDLSG
Ga0318555_1015899123300031640SoilAMPAHTGNLFPGVASAFARHGFQEVARRKPDRPVMRRSLSASG
Ga0318555_1018132023300031640SoilPVDTAVPGHTRNLFLGVASVFAEHGFQVVARRQPDRPVMRKVLTASR
Ga0318542_1012896523300031668SoilSHTGNLFPGIAAAFARHGFQVVARRKPDRPVMRKVLGLA
Ga0318561_1077005413300031679SoilPVDIAVPGHTRNLFGGIASTFARHGFGVVARHKPDRPVMRRPLTAPA
Ga0318574_1030444713300031680SoilTTNTFPGVASAFTRHGFQEVARRKPDRPVMRRDLSG
Ga0318574_1035126113300031680SoilHTRNLFLGVASVFARHGFQVVARRQPDRPVMRKVFAASG
Ga0318560_1040918513300031682SoilTTVPSHTGNLFPGIAAAFARHGFQVVARRKPDRPVMRKVLGLA
Ga0318496_1005950413300031713SoilPGHTGNVFPGVASTFSRHGFAEVARHKPDRPVMRRSL
Ga0318496_1018466123300031713SoilRNLFLGVASVFAEHGFQVVARRQPDRPVMRKVLTASR
Ga0307476_1092600913300031715Hardwood Forest SoilVPGHTTNLFPGVAAVFARHGFGVVARRKPDRPVMRLSPLAR
Ga0318493_1013148733300031723SoilTVPSHTGNLFPGVAAAFARHGFRVVARRKPDRPVMRKVPGPA
Ga0318493_1085729213300031723SoilTAAPAATRNLFPGVASVFAAHGFRVVARRKPDRPVMRKALRASPQL
Ga0318500_1063884523300031724SoilAHTTNLFPGIAAVFARHGFEVVARRKPDRPVMRRDLSG
Ga0318502_1056919223300031747SoilAAPAATRNLFPGVASVFAAHGFRVVARRKPDRPVMRKALRASPQL
Ga0318502_1100984223300031747SoilNLFPGVASAFARHGFGVVARRKPDRPVMRRDLRAAVQR
Ga0318492_1027711733300031748SoilVPGHTGNLFPGVASTFARHGFTEVARHKPDRPVMRRSLRLGQGAAW
Ga0318494_1038169113300031751SoilSHTGNLFPGIAAVFARHGFQVVARRKPDRPVMRKAVRPA
Ga0307475_1043400023300031754Hardwood Forest SoilFPGVAAAFARHGFSVVARRKPDRPVMRLSGLGPASGFGSM
Ga0318547_1017208523300031781SoilRSRPTPVDTAVPGHTRNLFLGVASVFAQHGFEVVARPYPARPVMRKVLNTST
Ga0318547_1045898323300031781SoilVPGHTRNLFLGVASVFAQHGFQVVARHQPDRPMMRKVLATTP
Ga0318548_1038742313300031793SoilAVPAHTANLFPGVASAFARHGFRVVARRKPDRPVMRRDLSG
Ga0318503_1005685413300031794SoilVSSHTGNLFPGIAAAFARHGFQVMARRKPDRPVMRKVLEPA
Ga0318503_1025704613300031794SoilLFPGTASTFARHGFGVVARHKPDRPVMRRPLTAPA
Ga0318523_1061283823300031798SoilRNLFLGVAAVFAQHGFEVVARRYPARPVMRKALSTST
Ga0318568_1073280223300031819SoilDTTVPGHTRNLFLGVASVFAQHGFQVVARHQPDRPMMRKVLATTP
Ga0318499_1006414213300031832SoilGNLFPGTASAFARHGFRVVARRKPDRPVMRKGLDAPG
Ga0318499_1012410113300031832SoilGHTRNLFLGVASVFAEHGFEVVARRQPDRPIMRRFLGTAG
Ga0318512_1011797013300031846SoilTTNLFPGVAAVFARHGFEVVARRKPDRPVMRRGLQGRRSTRA
Ga0318527_1040537223300031859SoilVDTAAPAATRNLFPGVASVFAAHGFRVLARRKPDRPVMRKALRASPQL
Ga0318495_1006515633300031860SoilYPVDTAVPGHTRNLFLGVASVFAEHGFQVVARRQPDRPVMRKVLTASS
Ga0306925_1038814633300031890SoilVDTAVPGHTRNLFLGVASVFAEHGFQVVARRQPDRPVMRKVLTASR
Ga0306925_1217272413300031890SoilPAHTTNLFSGVAAVFARHGFGVVARRKPDRPVMRRGLGLV
Ga0318551_1063046013300031896SoilVPSHTGNLFPGIATAFARHGFQVVARRKPDRPVMRKVLGLA
Ga0318520_1017325823300031897SoilGNLFPGVASVFAGRGFQVVARRKPDRPVMRKALSASPQL
Ga0306923_1234287023300031910SoilVDTAVPAHTRNLFPGVASIFARHGFGVVARRRPDRPVMRRVLTA
Ga0310912_1041064413300031941SoilNLFPGVASAFTRHGFRVVARRKPDRPVMRKGLTSSA
Ga0318531_1036749723300031981SoilVYSVDTAVPGHTRNLFLGVASVFAEHGFQVVARRQPDRPVMRKVLTASS
Ga0306922_1036307613300032001SoilAVPAHTRNLFPGTASAFARHGFLVVARRKPDRPVMRKSPGAPG
Ga0306922_1042769923300032001SoilYPVDTAAPAATGNLFPGVASVFAGRGFQVVARRKPDRPVMRTALSASPQL
Ga0318569_1008084923300032010SoilHTGNLFPGIAAVFARHGFQVVARRKPDRPVMRKAFKPA
Ga0318507_1015651613300032025SoilGNLFPGVASAFARHGFQEVARRKPDRPVMRRSLSASG
Ga0318549_1017305213300032041SoilVDTAVPGHTRNLFLGVASVFAEHGFQVVARRQPDRPVMRKVLAASR
Ga0318549_1027206613300032041SoilVDTTVPSHTGNLFPGVAAAFARHGFRVVARRKPDRPVMRKVLGLA
Ga0318506_1009667523300032052SoilHTRNLFLGVASVFAQHGFEVVARPYPARPVMRKVLNTST
Ga0318506_1020334813300032052SoilSPLDTAVPGHTRNLFLGVASVFAEHGFQVVARRQPDRPVMRKVLTASS
Ga0318506_1045141813300032052SoilPGHTGNLFPGVASTFARHGFAEVARHKPDRPVMRKIL
Ga0318575_1048661923300032055SoilVPGHTGNLFPGVASAFARHGFRVVARRKPDRPMMRKELTPSA
Ga0318504_1028165933300032063SoilNLFGGIASTFARHGFGVVARHKPDRPVMRRPLTAPA
Ga0318510_1014738123300032064SoilDLEAVPSHTGNLFPGIAAAFARHGFQVVARRKPDRPVMRKVLGLA
Ga0306924_1222573823300032076SoilRNLFPGVASIFARHGFGVVARRRPDRPVMRRVLTA
Ga0307470_1070137913300032174Hardwood Forest SoilFPGIAAAFARHGFEVVARRKPDRPVMRKLLGDVRDFST
Ga0306920_10411135313300032261SoilYPVDTTVPGHTRNLFLGVAAVFAQHGFEVVARRYPARPVMRKALSTST
Ga0335085_1037031533300032770SoilSHTGNLFPGIAAAFARHGFQVVARRKPDRPVMRRMLGPA
Ga0335085_1104441733300032770SoilSGNLFVGTASAFARHGFEVVARHKPDRPIMRRRLPA
Ga0335080_1131958313300032828SoilTVPSHTGNLFPGIAAAFARHGFQVVARRKPDRPVMRTVLGLA
Ga0335080_1229527123300032828SoilDTTVPSHTGNLFPGIAAAFDRHGFEVVARRKPDRPVMRKLLGDVRDFST
Ga0335081_1001083323300032892SoilVPSHTGNLFPGIAAAFARHGFQVVARRKPDRPVMRTVLGLA
Ga0335074_1010221713300032895SoilVPGHTTNLFPGVASAFARHGFGVVARRKPDRPIMRRSLTRPT
Ga0335074_1025158913300032895SoilVAAHTTNLFPGVASAFARHGFAVVARRKPDRPVMRRYRLA
Ga0335073_1113782223300033134SoilAVAAHTTNLFPGVASAFARHGFAVVARRKPDRPVMRRYRLA
Ga0318519_1058645023300033290SoilHTGNLFPGIAAVFARHGFQVVARRKPDRPVMRKAVRPA
Ga0318519_1101709013300033290SoilTVPGHTRNLFLGVAAVFAQHGFEVVARRYPARPVMRKALSTST
Ga0314864_0152144_474_5873300033805PeatlandHTANLFPGVASAFARHGFQVVARRKPDRPVMRRGLPD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.