Metagenome / Metatranscriptome Family F047167

Basic Information
Family ID	F047167
Family Type	Metagenome / Metatranscriptome
Number of Sequences	150
Average Sequence Length	40 residues
Representative Sequence	MARGRKTSLTIRLTPAERQTLLAWQRATTISAGRARR
Number of Associated Samples	107
Number of Associated Scaffolds	150

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	97.28 %
% of genes near scaffold ends (potentially truncated)	96.67 %
% of genes from short scaffolds (< 2000 bps)	94.67 %
Associated GOLD sequencing projects	100
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Most Common Taxonomy
Group	Unclassified (50.667 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (24.000 % of family members)
Environment Ontology (ENVO)	Unclassified (27.333 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (56.667 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 150 Family Scaffolds
PF00076	RRM_1	4.67
PF01209	Ubie_methyltran	4.00
PF01609	DDE_Tnp_1	2.00
PF04972	BON	2.00
PF10771	DUF2582	2.00
PF00072	Response_reg	2.00
PF01548	DEDD_Tnp_IS110	1.33
PF03400	DDE_Tnp_IS1	1.33
PF00216	Bac_DNA_binding	1.33
PF13613	HTH_Tnp_4	0.67
PF13546	DDE_5	0.67
PF13650	Asp_protease_2	0.67
PF13560	HTH_31	0.67
PF02452	PemK_toxin	0.67
PF13358	DDE_3	0.67
PF01610	DDE_Tnp_ISL3	0.67
PF00753	Lactamase_B	0.67
PF02518	HATPase_c	0.67
PF13676	TIR_2	0.67
PF01807	zf-CHC2	0.67
PF13551	HTH_29	0.67
PF11075	DUF2780	0.67
PF00589	Phage_integrase	0.67
PF01471	PG_binding_1	0.67
PF13518	HTH_28	0.67
PF06794	UPF0270	0.67
PF13580	SIS_2	0.67
PF05443	ROS_MUCR	0.67
PF04392	ABC_sub_bind	0.67
PF00196	GerE	0.67

COG ID	Name	Functional Category	% Frequency in 150 Family Scaffolds
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	4.00
COG2227	2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase	Coenzyme transport and metabolism [H]	4.00
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	2.00
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	2.00
COG5421	Transposase	Mobilome: prophages, transposons [X]	2.00
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	2.00
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	2.00
COG3293	Transposase	Mobilome: prophages, transposons [X]	2.00
COG0776	Bacterial nucleoid DNA-binding protein IHF-alpha	Replication, recombination and repair [L]	1.33
COG3547	Transposase	Mobilome: prophages, transposons [X]	1.33
COG1662	Transposase and inactivated derivatives, IS1 family	Mobilome: prophages, transposons [X]	1.33
COG3089	Uncharacterized conserved protein YheU, UPF0270 family	Function unknown [S]	0.67
COG3464	Transposase	Mobilome: prophages, transposons [X]	0.67
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.67
COG4957	Predicted transcriptional regulator	Transcription [K]	0.67
COG2337	mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module	Defense mechanisms [V]	0.67
COG0358	DNA primase (bacterial type)	Replication, recombination and repair [L]	0.67

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.67 %
All Organisms	root	All Organisms	49.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.67 %
cellular organisms	root	All Organisms → cellular organisms	49.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.67 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	48.67 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.67 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	12.00 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	6.00 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	5.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.33 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	3.33 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.33 %
unclassified Archaea	no rank	All Organisms → cellular organisms → Archaea → unclassified Archaea	0.67 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.67 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	12.00 %
Candidatus Tectomicrobia	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia	6.00 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	4.67 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	3.33 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.33 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.67 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.67 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.67 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.67 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.67 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.67 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	12.00 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	6.00 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	4.67 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	2.67 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	0.67 %
Candidatus Acidoferrales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales	0.67 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.67 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	0.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.67 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.67 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.67 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	12.00 %
unclassified Cyanobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria	1.33 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	1.33 %
Candidatus Acidoferrum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum	0.67 %
Synechococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales	0.67 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.67 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.67 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.67 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	0.67 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.67 %
Oscillatoriophycideae	subclass	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae	0.67 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	0.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.67 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.67 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.67 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	12.00 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.33 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.67 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.67 %
Synechococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae	0.67 %
Hapalosiphonaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae	0.67 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.67 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.67 %
Gordoniaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae	0.67 %
Oscillatoriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales	0.67 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.67 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.67 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	0.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.67 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.67 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.67 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	12.00 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.33 %
Fischerella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella	0.67 %
Pseudomonas juntendi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas juntendi	0.67 %
Cyanothecaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Cyanothecaceae	0.67 %
Gordonia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia	0.67 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.67 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.67 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.67 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.67 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.67 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.67 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	0.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.67 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.67 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.67 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	12.00 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.33 %
Cyanothece	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Cyanothecaceae → Cyanothece	0.67 %
Gordonia amicalis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia amicalis	0.67 %
unclassified Fischerella	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella → unclassified Fischerella	0.67 %
Pseudomonas juntendi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas juntendi	0.67 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.67 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.67 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.67 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.67 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.67 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.67 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	0.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.67 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.67 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.67 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	12.00 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.33 %
unclassified Cyanothece	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Cyanothecaceae → Cyanothece → unclassified Cyanothece	0.67 %
Fischerella sp. PCC 9605	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella → unclassified Fischerella → Fischerella sp. PCC 9605	0.67 %
Gordonia amicalis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia amicalis	0.67 %
Pseudomonas juntendi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas juntendi	0.67 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.67 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.67 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.67 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.67 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.67 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.67 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	0.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.67 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.67 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.67 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	12.00 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.33 %
Cyanothece sp. SIO1E1	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Cyanothecaceae → Cyanothece → unclassified Cyanothece → Cyanothece sp. SIO1E1	0.67 %
Fischerella sp. PCC 9605	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella → unclassified Fischerella → Fischerella sp. PCC 9605	0.67 %
Gordonia amicalis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia amicalis	0.67 %
Pseudomonas juntendi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas juntendi	0.67 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.67 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.67 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.67 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.67 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.67 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.67 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	0.67 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.67 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.67 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.67 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000559\|F14TC_102015894	Not Available	996	Open in IMG/M
3300000858\|JGI10213J12805_10477013	Not Available	626	Open in IMG/M
3300000858\|JGI10213J12805_10947363	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	557	Open in IMG/M
3300000955\|JGI1027J12803_102714466	All Organisms → cellular organisms → Bacteria	825	Open in IMG/M
3300005332\|Ga0066388_102261059	Not Available	983	Open in IMG/M
3300005332\|Ga0066388_102978302	All Organisms → cellular organisms → Bacteria	865	Open in IMG/M
3300005332\|Ga0066388_104624418	Not Available	700	Open in IMG/M
3300005467\|Ga0070706_101929262	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	536	Open in IMG/M
3300005558\|Ga0066698_10706975	Not Available	664	Open in IMG/M
3300005559\|Ga0066700_10985817	Not Available	555	Open in IMG/M
3300005576\|Ga0066708_10681797	All Organisms → cellular organisms → Bacteria	652	Open in IMG/M
3300005586\|Ga0066691_10341743	Not Available	886	Open in IMG/M
3300005617\|Ga0068859_102114939	Not Available	621	Open in IMG/M
3300005719\|Ga0068861_100516372	All Organisms → cellular organisms → Bacteria	1083	Open in IMG/M
3300005764\|Ga0066903_104223716	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	768	Open in IMG/M
3300005764\|Ga0066903_108829054	Not Available	512	Open in IMG/M
3300006194\|Ga0075427_10025907	All Organisms → cellular organisms → Bacteria	948	Open in IMG/M
3300006196\|Ga0075422_10165455	All Organisms → cellular organisms → Bacteria	891	Open in IMG/M
3300006794\|Ga0066658_10780451	All Organisms → cellular organisms → Bacteria	536	Open in IMG/M
3300006796\|Ga0066665_11505561	Not Available	525	Open in IMG/M
3300006797\|Ga0066659_10397482	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1083	Open in IMG/M
3300006844\|Ga0075428_100109046	All Organisms → cellular organisms → Bacteria	3017	Open in IMG/M
3300006844\|Ga0075428_101193008	All Organisms → cellular organisms → Bacteria	802	Open in IMG/M
3300006844\|Ga0075428_101316013	All Organisms → cellular organisms → Bacteria	760	Open in IMG/M
3300006845\|Ga0075421_102086649	Not Available	601	Open in IMG/M
3300006846\|Ga0075430_100584095	Not Available	922	Open in IMG/M
3300006847\|Ga0075431_100160330	All Organisms → cellular organisms → Bacteria	2313	Open in IMG/M
3300006847\|Ga0075431_100399598	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1375	Open in IMG/M
3300006847\|Ga0075431_100777708	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia amicalis	931	Open in IMG/M
3300006847\|Ga0075431_101508880	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	631	Open in IMG/M
3300006852\|Ga0075433_10845191	All Organisms → cellular organisms → Bacteria	799	Open in IMG/M
3300006853\|Ga0075420_100247981	All Organisms → cellular organisms → Bacteria	1548	Open in IMG/M
3300006854\|Ga0075425_102133670	Not Available	625	Open in IMG/M
3300006871\|Ga0075434_101866837	Not Available	607	Open in IMG/M
3300006880\|Ga0075429_100610795	Not Available	955	Open in IMG/M
3300006880\|Ga0075429_101137601	Not Available	682	Open in IMG/M
3300006903\|Ga0075426_10647252	Not Available	791	Open in IMG/M
3300006969\|Ga0075419_10488466	Not Available	854	Open in IMG/M
3300006969\|Ga0075419_11197267	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	560	Open in IMG/M
3300006969\|Ga0075419_11526780	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	502	Open in IMG/M
3300007255\|Ga0099791_10238975	Not Available	860	Open in IMG/M
3300007265\|Ga0099794_10065853	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1767	Open in IMG/M
3300009012\|Ga0066710_102816226	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	687	Open in IMG/M
3300009012\|Ga0066710_104276949	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	533	Open in IMG/M
3300009089\|Ga0099828_10232916	All Organisms → cellular organisms → Bacteria	1648	Open in IMG/M
3300009090\|Ga0099827_11107051	Not Available	688	Open in IMG/M
3300009090\|Ga0099827_11138233	Not Available	678	Open in IMG/M
3300009094\|Ga0111539_12825229	Not Available	562	Open in IMG/M
3300009098\|Ga0105245_10760287	Not Available	1005	Open in IMG/M
3300009100\|Ga0075418_10303071	All Organisms → cellular organisms → Bacteria	1703	Open in IMG/M
3300009100\|Ga0075418_10511535	Not Available	1289	Open in IMG/M
3300009100\|Ga0075418_10630542	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1154	Open in IMG/M
3300009100\|Ga0075418_12488452	Not Available	565	Open in IMG/M
3300009100\|Ga0075418_12762599	Not Available	536	Open in IMG/M
3300009137\|Ga0066709_100947666	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1257	Open in IMG/M
3300009137\|Ga0066709_101009399	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1219	Open in IMG/M
3300009143\|Ga0099792_10508528	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	755	Open in IMG/M
3300009156\|Ga0111538_10490523	All Organisms → cellular organisms → Bacteria	1557	Open in IMG/M
3300009156\|Ga0111538_13250059	Not Available	566	Open in IMG/M
3300009162\|Ga0075423_12164143	Not Available	604	Open in IMG/M
3300009162\|Ga0075423_13011362	Not Available	516	Open in IMG/M
3300010043\|Ga0126380_11103973	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	676	Open in IMG/M
3300010046\|Ga0126384_11165044	Not Available	709	Open in IMG/M
3300010046\|Ga0126384_12089361	Not Available	543	Open in IMG/M
3300010048\|Ga0126373_10186997	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1997	Open in IMG/M
3300010358\|Ga0126370_11181458	Not Available	710	Open in IMG/M
3300010359\|Ga0126376_10359734	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	1294	Open in IMG/M
3300010359\|Ga0126376_11270766	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	755	Open in IMG/M
3300010360\|Ga0126372_10571045	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	1079	Open in IMG/M
3300010360\|Ga0126372_13103759	Not Available	516	Open in IMG/M
3300010362\|Ga0126377_11767382	Not Available	694	Open in IMG/M
3300010366\|Ga0126379_10101397	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	2562	Open in IMG/M
3300010366\|Ga0126379_13292339	Not Available	541	Open in IMG/M
3300012198\|Ga0137364_11446950	Not Available	507	Open in IMG/M
3300012199\|Ga0137383_10917542	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	639	Open in IMG/M
3300012199\|Ga0137383_10944747	Not Available	629	Open in IMG/M
3300012203\|Ga0137399_10078476	Not Available	2499	Open in IMG/M
3300012203\|Ga0137399_10646685	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	890	Open in IMG/M
3300012203\|Ga0137399_11181469	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300012206\|Ga0137380_11746618	All Organisms → cellular organisms → Bacteria → Proteobacteria	506	Open in IMG/M
3300012209\|Ga0137379_10163113	Not Available	2140	Open in IMG/M
3300012209\|Ga0137379_11291494	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	635	Open in IMG/M
3300012210\|Ga0137378_11272228	Not Available	652	Open in IMG/M
3300012211\|Ga0137377_10295468	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1554	Open in IMG/M
3300012349\|Ga0137387_10848549	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	661	Open in IMG/M
3300012353\|Ga0137367_10492606	Not Available	864	Open in IMG/M
3300012357\|Ga0137384_10939578	Not Available	696	Open in IMG/M
3300012359\|Ga0137385_10456345	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	1085	Open in IMG/M
3300012361\|Ga0137360_10514619	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	1019	Open in IMG/M
3300012361\|Ga0137360_11109194	Not Available	683	Open in IMG/M
3300012363\|Ga0137390_11466220	Not Available	624	Open in IMG/M
3300012391\|Ga0134035_1120985	Not Available	1092	Open in IMG/M
3300012908\|Ga0157286_10444203	Not Available	514	Open in IMG/M
3300012948\|Ga0126375_10071580	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Cyanothecaceae → Cyanothece → unclassified Cyanothece → Cyanothece sp. SIO1E1	1947	Open in IMG/M
3300012971\|Ga0126369_11380133	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	795	Open in IMG/M
3300012971\|Ga0126369_12174941	Not Available	642	Open in IMG/M
3300013297\|Ga0157378_10992366	All Organisms → cellular organisms → Bacteria	874	Open in IMG/M
3300013306\|Ga0163162_10354149	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1600	Open in IMG/M
3300014154\|Ga0134075_10446970	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	574	Open in IMG/M
3300014326\|Ga0157380_11976879	All Organisms → cellular organisms → Bacteria	645	Open in IMG/M
3300014326\|Ga0157380_13543485	Not Available	500	Open in IMG/M
3300015264\|Ga0137403_10272249	All Organisms → cellular organisms → Bacteria → Proteobacteria	1596	Open in IMG/M
3300015371\|Ga0132258_13033788	All Organisms → cellular organisms → Bacteria	1163	Open in IMG/M
3300015371\|Ga0132258_13348235	Not Available	1102	Open in IMG/M
3300015372\|Ga0132256_100349803	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella → unclassified Fischerella → Fischerella sp. PCC 9605	1572	Open in IMG/M
3300015373\|Ga0132257_100883466	Not Available	1119	Open in IMG/M
3300015373\|Ga0132257_101092763	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	1006	Open in IMG/M
3300015374\|Ga0132255_101319802	Not Available	1089	Open in IMG/M
3300018082\|Ga0184639_10212246	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	1026	Open in IMG/M
3300025910\|Ga0207684_11048764	Not Available	680	Open in IMG/M
3300025936\|Ga0207670_10343509	All Organisms → cellular organisms → Bacteria	1180	Open in IMG/M
3300025961\|Ga0207712_10896910	Not Available	783	Open in IMG/M
3300025961\|Ga0207712_11350040	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	637	Open in IMG/M
3300025961\|Ga0207712_12139431	Not Available	500	Open in IMG/M
3300026313\|Ga0209761_1192562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	908	Open in IMG/M
3300026318\|Ga0209471_1103688	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	1227	Open in IMG/M
3300026318\|Ga0209471_1302018	Not Available	530	Open in IMG/M
3300026552\|Ga0209577_10710502	Not Available	568	Open in IMG/M
3300027577\|Ga0209874_1058186	All Organisms → cellular organisms → Bacteria	987	Open in IMG/M
3300027655\|Ga0209388_1169542	Not Available	613	Open in IMG/M
3300027873\|Ga0209814_10529766	Not Available	523	Open in IMG/M
3300027880\|Ga0209481_10461337	Not Available	654	Open in IMG/M
3300027882\|Ga0209590_10809547	Not Available	595	Open in IMG/M
3300027909\|Ga0209382_10423512	Not Available	1479	Open in IMG/M
3300027909\|Ga0209382_11495505	Not Available	673	Open in IMG/M
3300027909\|Ga0209382_11522367	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	665	Open in IMG/M
3300028587\|Ga0247828_10251768	Not Available	950	Open in IMG/M
3300028587\|Ga0247828_10443021	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	758	Open in IMG/M
3300028587\|Ga0247828_10988944	Not Available	549	Open in IMG/M
3300028819\|Ga0307296_10549262	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300030563\|Ga0247653_1041352	Not Available	620	Open in IMG/M
3300031081\|Ga0308185_1033543	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	627	Open in IMG/M
3300031092\|Ga0308204_10159751	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	675	Open in IMG/M
3300031099\|Ga0308181_1160566	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	533	Open in IMG/M
3300031561\|Ga0318528_10469532	Not Available	676	Open in IMG/M
3300031572\|Ga0318515_10498355	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	650	Open in IMG/M
3300031640\|Ga0318555_10608645	Not Available	592	Open in IMG/M
3300031770\|Ga0318521_10489488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas juntendi	738	Open in IMG/M
3300031858\|Ga0310892_11343713	Not Available	512	Open in IMG/M
3300031873\|Ga0315297_10579986	All Organisms → cellular organisms → Bacteria	942	Open in IMG/M
3300031890\|Ga0306925_12049937	Not Available	538	Open in IMG/M
3300031908\|Ga0310900_11046820	Not Available	673	Open in IMG/M
3300031947\|Ga0310909_10483321	All Organisms → cellular organisms → Bacteria	1039	Open in IMG/M
3300032001\|Ga0306922_11132039	Not Available	800	Open in IMG/M
3300032068\|Ga0318553_10572664	Not Available	591	Open in IMG/M
3300032159\|Ga0268251_10325331	Not Available	645	Open in IMG/M
3300032180\|Ga0307471_102620260	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	639	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	64.67%
Host-Associated	Host-Associated	35.33%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	63.33%
Plants	Host-Associated → Plants	35.33%
Aquatic	Environmental → Aquatic	1.33%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	63.33%
Rhizosphere	Host-Associated → Plants → Rhizosphere	29.33%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.33%
Freshwater	Environmental → Aquatic → Freshwater	0.67%
Sediment	Environmental → Aquatic → Sediment	0.67%
Phylloplane	Host-Associated → Plants → Phylloplane	0.67%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	56.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	28.67%
Loam	Environmental → Terrestrial → Soil → Loam	6.00%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.33%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.00%
Lake	Environmental → Aquatic → Freshwater → Lake	0.67%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.67%
Sand	Environmental → Terrestrial → Soil → Sand	0.67%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.67%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.67%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	34.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	28.67%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	12.00%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.67%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.33%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.33%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.33%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.00%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.00%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.67%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.67%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.67%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.67%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.67%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	24.00%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	20.00%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	10.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	8.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.33%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.33%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.33%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.33%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.00%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.33%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.33%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.33%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.33%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.67%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.67%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.67%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.67%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.67%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.67%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.67%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	0.67%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000858	Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006194	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Host-Associated	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012391	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014154	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026313	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300027577	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027655	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental	Open in IMG/M
3300030563	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031081	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031092	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031099	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental	Open in IMG/M
3300031640	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23	Environmental	Open in IMG/M
3300031770	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032068	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21	Environmental	Open in IMG/M
3300032159	Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)	Host-Associated	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F047167

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F14TC_1020158942	3300000559	Soil	MARGRITSLTISLTPTERQTLLAWQRATTIAAGRARRG
JGI10213J12805_104770132	3300000858	Soil	MARGRKTSLTISLTPEERQTLRAWQRATIVPSGVS
JGI10213J12805_109473631	3300000858	Soil	MPRGRPTALTIRLTPAERQTLLAWQRATTIPAGRARRGRMIL
JGI1027J12803_1027144661	3300000955	Soil	MPRGRRTSLTIRLTPAERLTLLAWQRATSIPAGLARRARIILLL
Ga0066388_1022610591	3300005332	Tropical Forest Soil	MARGRTTALTLTLTPAERRTLLAWQRATTIAAGRARRGRMILLIA
Ga0066388_1029783021	3300005332	Tropical Forest Soil	MARGRKTALTIRLASDERHTLMAWQRSTTIPAGRARRGRI
Ga0066388_1046244182	3300005332	Tropical Forest Soil	MVLFPKGVCMPRGRKTSLTIRLTPTQRQALRAWQRALTIPAGMA
Ga0070706_1019292621	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MARGRHTALTMQLTADERQTLLAWQRSTTIPAGSVRRGQIM
Ga0066698_107069752	3300005558	Soil	MGQGRTTSLTLRLTPAERRTLLAWQRATTTISAGRARR
Ga0066700_109858172	3300005559	Soil	MARGRKTSLTIRLTPAERLTLLTWQRATTIPAGLARRARLLVL
Ga0066708_106817972	3300005576	Soil	MPRGRTTALTIRLTPAQRQTLLAWESSTTIPAGLARR
Ga0066691_103417433	3300005586	Soil	MARGRTTSLTIRLTPTERQTLLTWQRATTIAAGRARRG
Ga0068859_1021149391	3300005617	Switchgrass Rhizosphere	MARGRKTSLMIRLTPAERQTLLTWQRATTISAGRAR
Ga0068861_1005163723	3300005719	Switchgrass Rhizosphere	MARGRKTALTIRLAADERHTLMAWQRSTTIPAGRARRGR
Ga0066903_1042237162	3300005764	Tropical Forest Soil	MARGRKTALTIRLAADERHTLMAWQRSTTIPAGRAR
Ga0066903_1088290541	3300005764	Tropical Forest Soil	MPRGRKTALRISLTADEYQTLRAWQRSTTMPAGQARRGRI
Ga0075427_100259071	3300006194	Populus Rhizosphere	MARGRKSSFTIRLTPAERLTLLTWQRATTISAGVARRARLLLL
Ga0075422_101654552	3300006196	Populus Rhizosphere	MARGRKTSLSIRLTPAVRQTLLAWQRAPTIPAGRV
Ga0066658_107804511	3300006794	Soil	MARGRKTSFTIRLTPAERQTLLAWQRATTIPAGIARRGR
Ga0066665_115055611	3300006796	Soil	MARGRKTALTIRLTADQRRTLLALQRSTTIRAGRARRGR
Ga0066659_103974823	3300006797	Soil	MALGRRTSFTITLTDEERQTLLAWQPSTSIPAGIARRGRIIL
Ga0075428_1001090464	3300006844	Populus Rhizosphere	MARKTSLTIHLTPADRQTLRAWQWSTTLRPGLGRRARMILLRA
Ga0075428_1011930083	3300006844	Populus Rhizosphere	MAQRRKTSLIIRLTPEERQTLLAWQRAPTIRAGLVRRARMILLLAD
Ga0075428_1013160133	3300006844	Populus Rhizosphere	MARGRKTALTIRLTPAERLTLLTWQRATTISAGVARRARLLLL
Ga0075421_1020866492	3300006845	Populus Rhizosphere	MARGRKTSLTIRLTPAERQTLLAWQRATAIPAGLAR
Ga0075430_1005840953	3300006846	Populus Rhizosphere	MARGRTTTLTISLTPAQQQTLLGWQHARTVTARHARRAGSSS
Ga0075431_1001603305	3300006847	Populus Rhizosphere	MARGRKTALHIHLTPADRQTLLAWQRSTTMPAGRARR
Ga0075431_1003995981	3300006847	Populus Rhizosphere	MAHGRKTSLTIELTLEERQTLLAWQRSTTMPAGRA
Ga0075431_1007777081	3300006847	Populus Rhizosphere	MARKTSLTIHLTPADRQTLRAWQWSTTLRPGLGRRARMILLRAD
Ga0075431_1015088802	3300006847	Populus Rhizosphere	CMARGRTTSLTIRLTPTERQTLLAWQRATTISAGPDYFWL*
Ga0075433_108451912	3300006852	Populus Rhizosphere	MARGRKTSFTIRLTPAQRQTLLMWQRATSVPAGLARRARMIL
Ga0075420_1002479811	3300006853	Populus Rhizosphere	MARGRTTSLTISLTPTERQTLLAWQRATTIAAGRARRG
Ga0075425_1021336701	3300006854	Populus Rhizosphere	MARGRRTSLTICLMPAERQTLLAWQGATTIAAGRTRRGRII
Ga0075434_1018668372	3300006871	Populus Rhizosphere	MPCGRKTSLIIRLTPAQRLTLLTWQRSTSIPAGLARRA
Ga0075429_1006107951	3300006880	Populus Rhizosphere	MARGRRTSFTISLTPAQRQTLLAWQRAPTTPAGLARRAR
Ga0075429_1011376012	3300006880	Populus Rhizosphere	MASGRKTALTIRLTPAQRQLLLVRQRATGIPAGDARR
Ga0075426_106472521	3300006903	Populus Rhizosphere	MPRGRKTALSVLSVQLTPAQRQTLLAWQRSTAIPAGLAR
Ga0075419_104884661	3300006969	Populus Rhizosphere	MARGRKTSLSIRLTPAVHQTLLAWQRATTIPAGRVRRGR
Ga0075419_111972671	3300006969	Populus Rhizosphere	MARGRTTSLTVRLTPMERQTLLAWQRATTIGAGRARRGRI
Ga0075419_115267802	3300006969	Populus Rhizosphere	MARGRKTALTIRLAADERHTLMAWQRSTTIPAGRARR
Ga0099791_102389752	3300007255	Vadose Zone Soil	MILFLKKSHMPRGRKTSLTIRLTPAQRQTLLAWQRATTIPAGQAR
Ga0099794_100658531	3300007265	Vadose Zone Soil	MARGRKTSLTIRLTPAERRTLLAWQRATTISAGRARRGRI
Ga0066710_1028162261	3300009012	Grasslands Soil	MRRGRRTSLTIRLTDDARQPLLAWQRSTTIPAGIARRGGALVLMA
Ga0066710_1042769491	3300009012	Grasslands Soil	MAGGRKTALTICFTQEEQQSLRSWQRSTTIPAGRAQRGRIILL
Ga0099828_102329161	3300009089	Vadose Zone Soil	MARGRKTSLTIRLTPAERQTLLAWQRATTISAGRARR
Ga0099827_111070511	3300009090	Vadose Zone Soil	MARGRKTSLSVPLTPAERRTLLAWQRATTISAGRAR
Ga0099827_111382332	3300009090	Vadose Zone Soil	MARGRTTSLTIRLTLAQRQTLLAWQRSATTISAGRARRGRI
Ga0111539_128252291	3300009094	Populus Rhizosphere	MTRGRKTSLTITLTPAERQTLLAWQRATTIAAGRA
Ga0105245_107602871	3300009098	Miscanthus Rhizosphere	MARGRKTSFTIRLTPAERRTLLTWQRATTVPAGLARRARLLLLLAD
Ga0075418_103030715	3300009100	Populus Rhizosphere	MAQRRKTSLIIRLTPEERQTLLAWQRAPTIRAGLVRRARMILLLADGV
Ga0075418_105115351	3300009100	Populus Rhizosphere	MEEYSMAQGRKTSLTIRLTPAERQTLLAWQRATTIRAGL
Ga0075418_106305421	3300009100	Populus Rhizosphere	MTRGRKTSLTLTLTPEERQTLLAWQRSTTMPAGRARRGRI
Ga0075418_124884522	3300009100	Populus Rhizosphere	MARGRKTALTIRLTPEERRTLLGWQRATTISAGRAR
Ga0075418_127625991	3300009100	Populus Rhizosphere	MARGRKTSLTIRLTPAERQTLLAWQRATAIPAGLARR
Ga0066709_1009476661	3300009137	Grasslands Soil	MARGRTTSLTIRLTEAERRTLQAWQRATTISAGRARRG
Ga0066709_1010093991	3300009137	Grasslands Soil	MTRGRRTSLTIRLTPAERRTLLTWQRATTVPAGLARRARLL
Ga0099792_105085282	3300009143	Vadose Zone Soil	MARGRKTSLTIRLTPAERRTLLAWQRATTISAGRARRG
Ga0111538_104905231	3300009156	Populus Rhizosphere	MARGRKTLLTIRLTPAERLTLLTWQRVTTISVGVARRARLLLL
Ga0111538_132500591	3300009156	Populus Rhizosphere	MARGRRTSFTIRLTPAERRTLLTWQRATTIPAGLARRA
Ga0075423_121641431	3300009162	Populus Rhizosphere	MARGRKTSLTIRLTPPECQTLLMWQRLTTIPAGQARRARLL
Ga0075423_130113621	3300009162	Populus Rhizosphere	MARGRRTSFTIRLTPAERRTLLTWQRATTVPAGLARRA
Ga0126380_111039731	3300010043	Tropical Forest Soil	MAQGCKTSVTIRLTPAQRQTLMAWQRATTISAGLARRGRMI
Ga0126384_111650441	3300010046	Tropical Forest Soil	MARGRTTALTLRLTPTQRRTLLTWQRATTIHAGLARRGR
Ga0126384_120893611	3300010046	Tropical Forest Soil	MARGRTTSFTIRLTPAQRQTLLAWQRATSVSAGLARRARLIL
Ga0126373_101869973	3300010048	Tropical Forest Soil	MVQGRKTALTIRLTPAERLTLLAWQRATAIPAGQARQ
Ga0126370_111814582	3300010358	Tropical Forest Soil	MVSGRKTSFSIRLTPVERQTLLAWQCATTLSAGLARRA
Ga0126376_103597343	3300010359	Tropical Forest Soil	MPRGRTTSFTIRLTPAQRQTLRTWQQATTLPAGLARRA
Ga0126376_112707661	3300010359	Tropical Forest Soil	MARGRTTSLTIRLTPAERRTLLAWQRATTIAAGRAR
Ga0126372_105710452	3300010360	Tropical Forest Soil	MARGRRTALTIRLAADERHTLMAWQRSTTIPAGRARR
Ga0126372_131037591	3300010360	Tropical Forest Soil	MARGRKTSLMIRLTPAERHTLLAWQRATTISAGRAR
Ga0126377_117673821	3300010362	Tropical Forest Soil	MAQGRTTSLTIRLTPAQRRTLLAWQRATTISAGRARRGRL
Ga0126379_101013971	3300010366	Tropical Forest Soil	MREGEIGMPRGRTTSLTITLTDAERQTLMAWQRSTTIRAG*
Ga0126379_132923391	3300010366	Tropical Forest Soil	MARGRKTSLRIRLTPAQRQTLLAWQRATTIPAGQARR
Ga0137364_114469502	3300012198	Vadose Zone Soil	MARGRHPSFRIRLTPDDRQTLRSWQRSTTIPAGRARRGRSIVQLADG
Ga0137383_109175421	3300012199	Vadose Zone Soil	MVLFLKGLTMARGRKTSFTIRLTPGQRQTLLAWQRATTIPAGQARRGRMV
Ga0137383_109447472	3300012199	Vadose Zone Soil	MARGRRTSLTIRLTPAQRQTLLAWQRATTIHAGQARRGRILLLLADGV
Ga0137399_100784761	3300012203	Vadose Zone Soil	MARGRKTALTIRLTPAERRTLLAWQRATTLSAGRARRGRI
Ga0137399_106466851	3300012203	Vadose Zone Soil	MARGRKTSLTIRLTPAQRQTLLAWQRATTISAGRAR
Ga0137399_111814691	3300012203	Vadose Zone Soil	MAQGRPTALVIRLTPAERLTLLTWQRGTTLSAGLARRARLILLRAE
Ga0137362_111423372	3300012205	Vadose Zone Soil	MARGRKTSLTICLTLSQRQTLLAWQRATTVPAGLARRARMISLLADGV
Ga0137380_103819282	3300012206	Vadose Zone Soil	MARGRKTSFIIRLTLAQRQTLLVWQRATNISAGLARRARIILLLADGM
Ga0137380_117466182	3300012206	Vadose Zone Soil	MPRGRETALTIRLTVEERQTLMAWQRSTTIPAGRA
Ga0137379_101631131	3300012209	Vadose Zone Soil	MARGRRTSLTICLTPAQRQTLLAWQRATTITAGLAR
Ga0137379_110869061	3300012209	Vadose Zone Soil	MARGRKTALTIHLTPGERWTLLVWQRATTIAAGRARRGRILLLVAEGMP
Ga0137379_112914941	3300012209	Vadose Zone Soil	MARGRKTALTIRLTAEERHTLLAWQRSTTIPAGRARR
Ga0137378_112722281	3300012210	Vadose Zone Soil	MARGRTTALTIRLTPAERRTLVAWQRATTFSAGRARRG
Ga0137377_102954681	3300012211	Vadose Zone Soil	MARGRITALTIRLTPAERRTLLAWQRATTISAGRARR
Ga0137387_108485491	3300012349	Vadose Zone Soil	MARGRSTSLTIRLTPAERLTLLAWQRATTISAGRARRGRI
Ga0137367_104926061	3300012353	Vadose Zone Soil	MARGRRTSLTIRLTPEERQTLLAWHRSMTIPASIARRGQVI
Ga0137384_109395781	3300012357	Vadose Zone Soil	MARGRKTSLTIRLTPAERRTLQAWQRATTISAGRAR
Ga0137385_104563452	3300012359	Vadose Zone Soil	MARGRKTALTIRLASDERHTLMAWQRSTTIPAGRARRG
Ga0137360_105146191	3300012361	Vadose Zone Soil	MARGRTTSLTIRLTAEERQTLLAWQRATTISAGRARRGRMILLIADRV
Ga0137360_111091942	3300012361	Vadose Zone Soil	MARGRTTSLTIRLTPAERQTLLAWQRAKTITAGRA
Ga0137390_114662201	3300012363	Vadose Zone Soil	MARGRKTSLSIRLTPAERLTLLAWQRATTIPAGLARRAR
Ga0134035_11209852	3300012391	Grasslands Soil	MARGRTTSLTIRLTPTERQTLLTWQRATTIAAGRAR
Ga0157286_104442031	3300012908	Soil	MILFLKKSRMPRGRTTSLTIRLTPAQRQTLLAWQRATTIPAGQ
Ga0126375_100715804	3300012948	Tropical Forest Soil	MARGRKTTLTIYLTPAQRQMLLAWQRATTISAGRA
Ga0126369_113801331	3300012971	Tropical Forest Soil	MARGRKTALTIRLTPAQRHTLLAWQRSTTIAAGRVR
Ga0126369_121749411	3300012971	Tropical Forest Soil	MLEGEIGMPRGRTTSLTITLTDAERQTLMAWQRSTTIRAG*
Ga0157378_109923662	3300013297	Miscanthus Rhizosphere	MARGRTTSLTVCLTPAQRQFLLARQRAITTPAGLARRARIIILMA
Ga0163162_103541491	3300013306	Switchgrass Rhizosphere	MILFLKKSRMPSGRKTSLTIRLTPAQRQTLLAWQHATTIPAGQARR
Ga0134075_104469701	3300014154	Grasslands Soil	MPRGRTTALTIRLTPAQRQTLLAWERSTTIPAGLARRARMVLL
Ga0157380_119768791	3300014326	Switchgrass Rhizosphere	MILFLKKSRMPRGRTTSLTIRLTPAQRQTLLAWQLATTIPAGQA
Ga0157380_135434851	3300014326	Switchgrass Rhizosphere	MARGRKTALILHLTPAQRQTLLAWQRATTISAGRARR
Ga0137403_102722495	3300015264	Vadose Zone Soil	MARGRVTSLTIRLTSAERQTLLAWQRATTISAGRARRGRMILL
Ga0132258_130337882	3300015371	Arabidopsis Rhizosphere	MARGRKTSLSIRLTPAVRQTLLAWQRAPTIPAGRVRRGRMILL
Ga0132258_133482351	3300015371	Arabidopsis Rhizosphere	MARGRKTSFTIRLTPAERRTLLTWQRATTVPAGLARRARL
Ga0132256_1003498031	3300015372	Arabidopsis Rhizosphere	MARGRTTSFTLRLTPTQRRTLLAWQRATRIPAGLARRGRIILL
Ga0132257_1008834662	3300015373	Arabidopsis Rhizosphere	MARGRRTSFTIRLTPAERLTLLTWQRATTVPAGLA
Ga0132257_1010927632	3300015373	Arabidopsis Rhizosphere	MARGRKTSLTIRLTPAERRTLLAWQRATTISAGRARR
Ga0132255_1013198021	3300015374	Arabidopsis Rhizosphere	MARGRTTSLTIHLTPAERQTLVAWQRATTIPAGLARRSRIILLAAD
Ga0184639_102122462	3300018082	Groundwater Sediment	MARGWKTLLTIDLTAEQRETLTAWQRSTTIPAGHAKRGRIILLI
Ga0207684_110487641	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MARGRKTSLTISLTVEEPQTLMAWQRSTTIRAGRA
Ga0207670_103435093	3300025936	Switchgrass Rhizosphere	MARGRTTSLTVCLTPAERQLLVARQRATNIPAGLA
Ga0207712_108969102	3300025961	Switchgrass Rhizosphere	MARGRKTSFTIRLTPAERRTLLTWQRATTVPAGLAR
Ga0207712_113500402	3300025961	Switchgrass Rhizosphere	MARGRKTALTIRLANDERHTLMAWQRSTTIPAGRA
Ga0207712_121394311	3300025961	Switchgrass Rhizosphere	MARGRTTSLTVCLTPAERQLLVARQRAITTPAGLAR
Ga0209761_11925621	3300026313	Grasslands Soil	MARGRKTSLSIQLTPAQRQMLLVWQRSTTTISAGHARRGRM
Ga0209471_11036881	3300026318	Soil	MGQGRTTSLTIRLTPAERRTLLAWQRSTTTISAGRARRGRIIVLV
Ga0209471_13020181	3300026318	Soil	MARGRTTSLTIYLTPAERRTLLAWQRSTTTISAGR
Ga0209577_107105022	3300026552	Soil	MGQGRTTSLTLRLTPAERRTLLAWQRATTTISAGRARRGRILLLVA
Ga0209874_10581862	3300027577	Groundwater Sand	MARGRRTSLTIRLTPAERETLLAWQRATTISAGRARR
Ga0209388_11695421	3300027655	Vadose Zone Soil	MILFLKKSRMPRGRKTSLTIRLTPAQRQTLLAWQRATTIPAGQARR
Ga0209814_105297661	3300027873	Populus Rhizosphere	MARGRTTAFIIRLTPAERLTLLTWQRATTISAGVARRARLLLL
Ga0209481_104613371	3300027880	Populus Rhizosphere	MARGRTTSLTIRLTPTERQTLLAWQRATTIAAGRARRG
Ga0209590_108095471	3300027882	Vadose Zone Soil	MARGRRTSLTIRLTPAERRTLQAWQRTTTLSAGLA
Ga0209382_104235122	3300027909	Populus Rhizosphere	MPRGRKTSLLIRLTPAERLTLLTWQRSTTIPAGLA
Ga0209382_114955052	3300027909	Populus Rhizosphere	MASGRKTALTIRLTPAQRQLLLVRQRATGIPAGDARRARIILLLAD
Ga0209382_115223672	3300027909	Populus Rhizosphere	MARGRKTSLTIHLTPAQRQTLLAWQRATNIPAGLARRARIV
Ga0247828_102517681	3300028587	Soil	MAHGRKSALTMHVTPAQRHTLLAWQRATTVSAGLARRGRLIFLVAD
Ga0247828_104430212	3300028587	Soil	MARGRKTSLSIRLTPAVRQTLLAWQRATTIPAGRVRRGRMILL
Ga0247828_109889441	3300028587	Soil	MARGRKTSLTIRLTPAERQTLRAWQRATTIAAGRARR
Ga0307296_105492621	3300028819	Soil	MARGRHTASHICLTPEDRHTPLAWQRSTTIRAAPDRF
Ga0247653_10413521	3300030563	Soil	MAHGRQTALTLTLNLTPEERQTLQAWQRSPTMPAGPARRGRMIVRVA
Ga0308185_10335431	3300031081	Soil	MARGRKTSLTIRLTPAERRTLLAWQRATTISAGRARRGRILLLM
Ga0308204_101597513	3300031092	Soil	MARGRTTSLTIRLTLSERRTLLAWQRATTIPAGQARRGRIMLLRAD
Ga0308181_11605661	3300031099	Soil	MARGRKTSLMIRLTPAERRTLLAWQRATIISAGRARRGRIL
Ga0318528_104695321	3300031561	Soil	MARGRKTSLAIRLTPAVRQTLLAWQRATTMPAGRARRGRI
Ga0318515_104983551	3300031572	Soil	MARGRKTSLVIRLTPAVRQTLLAWQRATTIPAGRAR
Ga0318555_106086452	3300031640	Soil	MARGRKTSFTIRLTPAERLTLLTWQRATTLSAGVARRARLLLLL
Ga0318521_104894882	3300031770	Soil	MARGRKTSLAIRLTPAVRQTLLAWQRATTIPAGRARRGRLILLV
Ga0310892_113437131	3300031858	Soil	MPRERTTSLTIRLMPAERLTLMTWQRSVTLSAGLARRARIRLLRAD
Ga0315297_105799863	3300031873	Sediment	MARGRKTSLTVTLTAEERDELEFWQRCTTLPVGLV
Ga0306925_120499371	3300031890	Soil	MASGRKTSFSIRLTPAERQTLLAWQRTTTISAGLFRISRII
Ga0310900_110468201	3300031908	Soil	MARGRKTSLTIRLTSAERQTLRAWQRATTIAAGRARRGRI
Ga0310909_104833212	3300031947	Soil	MARGRKTALKIPLTPAERRTLLAWQRATTISAGRA
Ga0306922_111320392	3300032001	Soil	MARGRKTSRTLRLTPAERQTLLAWQRASLIPAGLARRGRIV
Ga0318553_105726641	3300032068	Soil	MARGRKTSLVVRLTPAERQTLLAWQRATTIAAGRARRGRLIVLVA
Ga0268251_103253312	3300032159	Agave	MARGRKTSLTITLTPEERRTLLAWQRSTTIHAGML
Ga0307471_1026202602	3300032180	Hardwood Forest Soil	MPRGRKTSLMIRLTADDRQTLTRWQRSTTIRAGDA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign