| Basic Information | |
|---|---|
| Family ID | F047156 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MSNSGPEQRNYAEIERLEALLQTLRENPSTARETEAIREIGLEIALA |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.33 % |
| % of genes near scaffold ends (potentially truncated) | 96.67 % |
| % of genes from short scaffolds (< 2000 bps) | 94.67 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.33% β-sheet: 0.00% Coil/Unstructured: 50.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF00313 | CSD | 51.33 |
| PF01084 | Ribosomal_S18 | 4.00 |
| PF00106 | adh_short | 1.33 |
| PF14023 | DUF4239 | 1.33 |
| PF01176 | eIF-1a | 1.33 |
| PF01197 | Ribosomal_L31 | 1.33 |
| PF12840 | HTH_20 | 0.67 |
| PF07498 | Rho_N | 0.67 |
| PF11799 | IMS_C | 0.67 |
| PF00326 | Peptidase_S9 | 0.67 |
| PF01545 | Cation_efflux | 0.67 |
| PF04545 | Sigma70_r4 | 0.67 |
| PF14333 | DUF4389 | 0.67 |
| PF03006 | HlyIII | 0.67 |
| PF00196 | GerE | 0.67 |
| PF07690 | MFS_1 | 0.67 |
| PF02655 | ATP-grasp_3 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0238 | Ribosomal protein S18 | Translation, ribosomal structure and biogenesis [J] | 4.00 |
| COG0254 | Ribosomal protein L31 | Translation, ribosomal structure and biogenesis [J] | 1.33 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 1.33 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.67 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.67 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.67 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.33 % |
| Unclassified | root | N/A | 16.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_107266342 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
| 3300000956|JGI10216J12902_101869641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
| 3300000956|JGI10216J12902_104174090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300002028|A17_1312493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300004153|Ga0063455_101082563 | Not Available | 590 | Open in IMG/M |
| 3300004156|Ga0062589_100061445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2174 | Open in IMG/M |
| 3300004156|Ga0062589_101393097 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300004156|Ga0062589_102378883 | Not Available | 546 | Open in IMG/M |
| 3300004157|Ga0062590_100689273 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300004463|Ga0063356_100919915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1238 | Open in IMG/M |
| 3300004479|Ga0062595_101767072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300004480|Ga0062592_100426494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1066 | Open in IMG/M |
| 3300004480|Ga0062592_102099883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300005179|Ga0066684_10190362 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300005328|Ga0070676_11418906 | Not Available | 533 | Open in IMG/M |
| 3300005338|Ga0068868_101217734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300005338|Ga0068868_101594979 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005341|Ga0070691_10574174 | Not Available | 662 | Open in IMG/M |
| 3300005434|Ga0070709_10787044 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005440|Ga0070705_100747622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300005445|Ga0070708_101210892 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300005457|Ga0070662_100951943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300005518|Ga0070699_101418246 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005518|Ga0070699_101435504 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005529|Ga0070741_11181937 | Not Available | 646 | Open in IMG/M |
| 3300005546|Ga0070696_101820659 | Not Available | 526 | Open in IMG/M |
| 3300005547|Ga0070693_100553639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 824 | Open in IMG/M |
| 3300005549|Ga0070704_100444474 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300005568|Ga0066703_10263269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
| 3300005587|Ga0066654_10449330 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300005598|Ga0066706_10918337 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300005614|Ga0068856_100073728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3380 | Open in IMG/M |
| 3300005842|Ga0068858_102020940 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005843|Ga0068860_102304174 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005886|Ga0075286_1018523 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300006032|Ga0066696_10301022 | Not Available | 1042 | Open in IMG/M |
| 3300006042|Ga0075368_10571217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300006196|Ga0075422_10563925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300006573|Ga0074055_11574717 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300006579|Ga0074054_10869764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
| 3300006800|Ga0066660_11600369 | Not Available | 516 | Open in IMG/M |
| 3300006844|Ga0075428_100006164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13343 | Open in IMG/M |
| 3300006844|Ga0075428_101072349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 851 | Open in IMG/M |
| 3300006852|Ga0075433_10721640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 872 | Open in IMG/M |
| 3300006854|Ga0075425_101155812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 880 | Open in IMG/M |
| 3300006880|Ga0075429_100146187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2069 | Open in IMG/M |
| 3300006904|Ga0075424_101039491 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300007076|Ga0075435_100476728 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300009012|Ga0066710_101364827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1099 | Open in IMG/M |
| 3300009147|Ga0114129_10158584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3093 | Open in IMG/M |
| 3300009147|Ga0114129_12636679 | Not Available | 599 | Open in IMG/M |
| 3300009147|Ga0114129_12826097 | Not Available | 576 | Open in IMG/M |
| 3300009156|Ga0111538_12678022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300009176|Ga0105242_13166410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300009177|Ga0105248_10792703 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300009177|Ga0105248_11054499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 918 | Open in IMG/M |
| 3300010038|Ga0126315_10121913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1520 | Open in IMG/M |
| 3300010039|Ga0126309_10317313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
| 3300010044|Ga0126310_10376263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1004 | Open in IMG/M |
| 3300010154|Ga0127503_10362911 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300010301|Ga0134070_10072072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1181 | Open in IMG/M |
| 3300010304|Ga0134088_10611225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300010326|Ga0134065_10087019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1019 | Open in IMG/M |
| 3300010329|Ga0134111_10485419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300010364|Ga0134066_10278937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300010375|Ga0105239_10310382 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300010857|Ga0126354_1107557 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300010862|Ga0126348_1304097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 923 | Open in IMG/M |
| 3300011119|Ga0105246_11984126 | Not Available | 561 | Open in IMG/M |
| 3300012199|Ga0137383_10379007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1036 | Open in IMG/M |
| 3300012201|Ga0137365_11227691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300012380|Ga0134047_1228733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
| 3300012515|Ga0157338_1090758 | Not Available | 509 | Open in IMG/M |
| 3300012683|Ga0137398_10742629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300012883|Ga0157281_1010236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1030 | Open in IMG/M |
| 3300012896|Ga0157303_10163265 | Not Available | 610 | Open in IMG/M |
| 3300012903|Ga0157289_10353837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300012914|Ga0157297_10032661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1256 | Open in IMG/M |
| 3300012951|Ga0164300_10651985 | Not Available | 630 | Open in IMG/M |
| 3300012951|Ga0164300_11181166 | Not Available | 506 | Open in IMG/M |
| 3300012976|Ga0134076_10575091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300012977|Ga0134087_10065480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1462 | Open in IMG/M |
| 3300012984|Ga0164309_10522995 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300012984|Ga0164309_11688648 | Not Available | 543 | Open in IMG/M |
| 3300012985|Ga0164308_10626712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300013100|Ga0157373_11369940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300013296|Ga0157374_10693719 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300013308|Ga0157375_11003000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
| 3300014166|Ga0134079_10384155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300014325|Ga0163163_10517556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1255 | Open in IMG/M |
| 3300015077|Ga0173483_10789009 | Not Available | 547 | Open in IMG/M |
| 3300015357|Ga0134072_10465449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300015374|Ga0132255_101063287 | Not Available | 1215 | Open in IMG/M |
| 3300017659|Ga0134083_10074400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1310 | Open in IMG/M |
| 3300018061|Ga0184619_10066701 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300018076|Ga0184609_10316870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300018433|Ga0066667_10550347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
| 3300018433|Ga0066667_10786771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
| 3300018469|Ga0190270_11702795 | Not Available | 684 | Open in IMG/M |
| 3300018482|Ga0066669_10499210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1053 | Open in IMG/M |
| 3300018482|Ga0066669_10828198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300018482|Ga0066669_11735907 | Not Available | 574 | Open in IMG/M |
| 3300018482|Ga0066669_12322767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300019279|Ga0184642_1465396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300019279|Ga0184642_1700122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300019885|Ga0193747_1016164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1824 | Open in IMG/M |
| 3300019887|Ga0193729_1122328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 968 | Open in IMG/M |
| 3300019996|Ga0193693_1038682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300022195|Ga0222625_1195746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
| 3300022756|Ga0222622_10212591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1290 | Open in IMG/M |
| 3300022756|Ga0222622_10737442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 717 | Open in IMG/M |
| 3300024055|Ga0247794_10302767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300024187|Ga0247672_1037957 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300025901|Ga0207688_10189374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1230 | Open in IMG/M |
| 3300025918|Ga0207662_10359843 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300025933|Ga0207706_10478869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1076 | Open in IMG/M |
| 3300025935|Ga0207709_10689546 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300025938|Ga0207704_10207260 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300025949|Ga0207667_10895297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 879 | Open in IMG/M |
| 3300025961|Ga0207712_11873899 | Not Available | 537 | Open in IMG/M |
| 3300026301|Ga0209238_1243646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300026315|Ga0209686_1158544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
| 3300026331|Ga0209267_1287640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300026548|Ga0209161_10052048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2671 | Open in IMG/M |
| 3300027821|Ga0209811_10384904 | Not Available | 543 | Open in IMG/M |
| 3300028597|Ga0247820_11132540 | Not Available | 563 | Open in IMG/M |
| 3300028719|Ga0307301_10131563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300028791|Ga0307290_10339843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300028793|Ga0307299_10406010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300028799|Ga0307284_10087723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1148 | Open in IMG/M |
| 3300028807|Ga0307305_10214441 | Not Available | 883 | Open in IMG/M |
| 3300028810|Ga0307294_10380859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300028814|Ga0307302_10412023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300028814|Ga0307302_10528650 | Not Available | 586 | Open in IMG/M |
| 3300028828|Ga0307312_11166590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300030988|Ga0308183_1033427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 955 | Open in IMG/M |
| 3300031081|Ga0308185_1029633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
| 3300031095|Ga0308184_1052616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300031114|Ga0308187_10183159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300031366|Ga0307506_10079309 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300031421|Ga0308194_10144553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
| 3300031858|Ga0310892_10012106 | All Organisms → cellular organisms → Bacteria | 3562 | Open in IMG/M |
| 3300031995|Ga0307409_101727765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300032205|Ga0307472_100444748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1100 | Open in IMG/M |
| 3300032205|Ga0307472_100948400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300034644|Ga0370548_053858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300034644|Ga0370548_056013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
| 3300034680|Ga0370541_013177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
| 3300034680|Ga0370541_033084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300034681|Ga0370546_074063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.67% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.33% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.33% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.33% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.33% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.67% |
| Permafrost And Active Layer Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.67% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002028 | Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_A17 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031081 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031095 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1072663422 | 3300000955 | Soil | VASPEQRNYEEIERLEGLLTELRSNRSTARETEAIREIGLEIAIAVREVG |
| JGI10216J12902_1018696411 | 3300000956 | Soil | MVSPEQRNFAEIERLESLLTELRSGKSTPRQTEAIREIGLEIAI |
| JGI10216J12902_1041740901 | 3300000956 | Soil | MSNNGPEQKNYAEIERLELLLSELRGSPSTARETEAIREIGLEIALAVRE |
| A17_13124931 | 3300002028 | Permafrost And Active Layer Soil | MSPSDPGQRNHGEIERLERLLEDLRANPSTARETEAI |
| Ga0063455_1010825632 | 3300004153 | Soil | VSRTPEQRNYAEIERLESLLVALRANASTARETEAIREIGFEIAIAV |
| Ga0062589_1000614451 | 3300004156 | Soil | MGNSSPEQKNYAEIERLEQLLGELRQNPSTARETEAIREI |
| Ga0062589_1013930971 | 3300004156 | Soil | MANSPEQRNYAEIERLEQLLEELRRNRSTARETEAIREIGLEIAIAVRE |
| Ga0062589_1023788832 | 3300004156 | Soil | VSRPEQKNFAEIARLEGLLTELRANAATARETEAIREIGL |
| Ga0062590_1006892731 | 3300004157 | Soil | MALNNPEQKNYAEIERLEGLLVQLRSSASTARETEAIREIGLEIALAIREVGAMLVNV |
| Ga0063356_1009199153 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTLDNPEQKNYAEIERLERLLDELRASASTARETEAIREIGLEIA |
| Ga0062595_1017670721 | 3300004479 | Soil | MTSPEEKNYAEIERLEGLLAKLRAVNETTTPRETEAIREIGLEIAL |
| Ga0062592_1004264943 | 3300004480 | Soil | MGSPERKNYAEIERLEHLLAELRSGKSTPRQTEAIREIGLEIAIAIREVGAMLTNV |
| Ga0062592_1020998831 | 3300004480 | Soil | MSSNSPEQRNYGEIERLETLLQDLRANPSTARETEAIREIGLEIALAV |
| Ga0066684_101903625 | 3300005179 | Soil | MPNSGPEQKNFAEIERLEGLLHTLRESHSTARETEAIREIGLEIAL |
| Ga0070676_114189061 | 3300005328 | Miscanthus Rhizosphere | MNSPEQKNYAEIERLEALLAALRANAGTTRETEAIREIGFEIAV |
| Ga0068868_1012177341 | 3300005338 | Miscanthus Rhizosphere | MGSPERKNYAEIERLEHLLAELRSGKSTPRQTEAIREIGL |
| Ga0068868_1015949793 | 3300005338 | Miscanthus Rhizosphere | MSVNGPEQKNYAEIERLELLLSALRDSASTPREPEAIREIGLEIALAVREV |
| Ga0070691_105741743 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MASNNPEQKNYAEIDRLERLLEELRASASTARETEAIREIGLEIALAVREVGAML |
| Ga0070709_107870441 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVNGPEQKNYAEIERLELLLSALRDSASTPREPEAIREIGLEIALAVREVGAM |
| Ga0070705_1007476221 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VASPEQRNYEEIERLEGLLTELRGNRSTARETEAIREIGLEIAIAVREVGAM |
| Ga0070708_1012108921 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSPEERNYAEIERLEALLVALRANASTARETEAIREIGLEIAI |
| Ga0070662_1009519431 | 3300005457 | Corn Rhizosphere | VASPEQRNYEEIERLEGLLTELRGNRSTARETEAIREIGLEI |
| Ga0070699_1014182463 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSNSPEQRNYGEIERLETLLQDLRANPSTARETEAIREIGLEIALA |
| Ga0070699_1014355041 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VASPEQQNYEQIERLQALLTELRASASTARETEAIREIGLEIAV |
| Ga0070741_111819371 | 3300005529 | Surface Soil | MTSPEEKNYDEIVRLEARLRELRSSTSTPRETEALREAGLEIALAVREVGAMLVN |
| Ga0070696_1018206593 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSPEQRNYTEIERLESLLAALRARPRTDDQADALREVGLEIALAVR |
| Ga0070693_1005536391 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSPEQRNYLEIERLEQLLVDLRANRSTARETEAIREIGFEI |
| Ga0070704_1004444741 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VASPEQQNYEQIERLQALLTELRASASTARETEAIREIGLEIAVAIREVGAMLVNV |
| Ga0066703_102632691 | 3300005568 | Soil | MPNNGLGQKNYAEIERLETLLQTLRESASTARETEAI |
| Ga0066654_104493301 | 3300005587 | Soil | MPNNGLEQKNYAEIERLETLLQTLRESASTARETEAIREIG |
| Ga0066706_109183371 | 3300005598 | Soil | MSNSGPERKNYAEIERLESLLETLRENPSTAREREAIREI |
| Ga0068856_1000737286 | 3300005614 | Corn Rhizosphere | VASPEQRNYEEIERLEGLLTELRGNRSTARETEAIREIGLEIAIAV |
| Ga0068858_1020209401 | 3300005842 | Switchgrass Rhizosphere | VASPEQQNYEQIERLQALLTELRASASTARETEAIREIGLEIAVAI |
| Ga0068860_1023041741 | 3300005843 | Switchgrass Rhizosphere | VASPEQQNYEQIERLQALLTELRASASTARETEAIREIGLEIA |
| Ga0075286_10185231 | 3300005886 | Rice Paddy Soil | MGSPEQRNYDQIERLERLLTALRRDPSTARETEAIREIGLEIAIAIREVG |
| Ga0066696_103010224 | 3300006032 | Soil | MTNPEEKNYAEILRLEELLTELRANPSTARETEAIREIGLEIAIAVREV |
| Ga0075368_105712172 | 3300006042 | Populus Endosphere | MASNNPEQKNYAEIDRLERLLEELRASASTARETEAIREIGLEIALAVRE |
| Ga0075422_105639253 | 3300006196 | Populus Rhizosphere | MASNNPEQKNYAEIDRLERLLEELRASASTARETEAIR |
| Ga0074055_115747173 | 3300006573 | Soil | VASPEQRNYEEIERLEGLLTELRGNRSTARETEAIREIGLEIAI |
| Ga0074054_108697644 | 3300006579 | Soil | VNSPEQKNYVEIERLEALLAALRANAGTARETEAIREIGLEIAIA |
| Ga0066660_116003691 | 3300006800 | Soil | MSSPEQKNYEEIERLEGLVGELRANPSTAPEIDAIREVGLELAIAV |
| Ga0075428_10000616411 | 3300006844 | Populus Rhizosphere | MSNPETKNYAEIERLEASLAALRQAGGTARETEAIREIGLEIALAIREVGAMLGP* |
| Ga0075428_1010723491 | 3300006844 | Populus Rhizosphere | MASNNPEQKNYAEIDRLERLLEELRASASTARETEAIREIGLEIALAVR |
| Ga0075433_107216401 | 3300006852 | Populus Rhizosphere | MASNNPEQKNYAEIDRLERLLEELRASASTARETE |
| Ga0075425_1011558121 | 3300006854 | Populus Rhizosphere | MASNNPEQKNYAEIDRLERLLEELRASASTARETEAI |
| Ga0075429_1001461875 | 3300006880 | Populus Rhizosphere | MSNPETKNYTEIERLEAALAALRQAGGTARETEAIREIGLEIALAIREVGAMLGP* |
| Ga0075424_1010394911 | 3300006904 | Populus Rhizosphere | MNSPEERNFAEIERLEQLLATLRDNAGTARETEAIREIGLEIAIAVREVGAMLVNVGW |
| Ga0075435_1004767281 | 3300007076 | Populus Rhizosphere | LNSNPTQKNYAEIERLEQLLRELRDDAMTPRETEAIREIGLEIALA |
| Ga0066710_1013648274 | 3300009012 | Grasslands Soil | MSDSPEQKNFAEIERLEKLLGELRSNPSTARETEAIREIGLEIAVAIREVG |
| Ga0114129_101585843 | 3300009147 | Populus Rhizosphere | MSNPETKNHAEIERLAASLAALRQAGGTARETEAIREIGLEIALAIREVGAMLGP* |
| Ga0114129_126366794 | 3300009147 | Populus Rhizosphere | LNSNPTQKNYAEIERLEQLLRELRDDAMTPRETEAIREIGLEIALAIREVG |
| Ga0114129_128260974 | 3300009147 | Populus Rhizosphere | LNSNPTQKNYAEIERLEQLLRELRDDAMTPRETEAIREIGLEI |
| Ga0111538_126780222 | 3300009156 | Populus Rhizosphere | MSNPETKNYAEIERLAASLAALRQAGGTARETEAIREIGLEIALAIREVGAMLGP* |
| Ga0105242_131664102 | 3300009176 | Miscanthus Rhizosphere | MASDNPEQKNYAEIERLEGMLVQLRASASTARETEAIREIGLEIALAIREVGAMLVNV |
| Ga0105248_107927034 | 3300009177 | Switchgrass Rhizosphere | MNSPEERNFAEIERLEQLLATLRDNAGTARETEAIREIGLEI |
| Ga0105248_110544994 | 3300009177 | Switchgrass Rhizosphere | MSNSGPERKNYAEIERLEALLQTLRENPSTARETEAIREIGLEIALAVRE |
| Ga0126315_101219134 | 3300010038 | Serpentine Soil | MALNNPEQKNYAEVARLERLLDELRASASTARETEAI |
| Ga0126309_103173131 | 3300010039 | Serpentine Soil | MASSPEQKNYSEIERLEQLLEDLRANRSTARETEAIREI |
| Ga0126310_103762633 | 3300010044 | Serpentine Soil | MSTSPEQKNYIEIERLERLLGELRGDRAPGRETEAIREIGLEIAVAIREVG |
| Ga0127503_103629111 | 3300010154 | Soil | VNSPEQKNYAEIERLEALLAALRANAGTTRETEAIREIGFEIAVAIREVGAMLINVG |
| Ga0134070_100720725 | 3300010301 | Grasslands Soil | MSNSRPEQRNYAEIERLETLLQTLRENPSTARETEAIR |
| Ga0134088_106112253 | 3300010304 | Grasslands Soil | MSDSPEQKNFAEIERLEKLLGELRSNPSTARETEAIREIGL |
| Ga0134065_100870194 | 3300010326 | Grasslands Soil | MPNSGPEQKNFAEIERLEGLLHTLRESHSTARETEAIREIGLEIA |
| Ga0134111_104854193 | 3300010329 | Grasslands Soil | MSTNPEQKNYVEIDRIERLLAELRQNPSTARETEAIREIGLEIA |
| Ga0134066_102789371 | 3300010364 | Grasslands Soil | LNSNPAQKNYAEIERLEQLLRELRDDATTPRETEAIREIGFEIAL |
| Ga0105239_103103821 | 3300010375 | Corn Rhizosphere | MSNSGPEQRNYAEIERLEALLQTLRENPSTARETEA |
| Ga0126354_11075571 | 3300010857 | Boreal Forest Soil | VSRTPEQHNYEEIERLETLLAALRANSSTARETEAIREIG |
| Ga0126348_13040971 | 3300010862 | Boreal Forest Soil | MSSSSPEQRNYGEIERLENLLQDLRANPSTARETEAIREIGLEIALA |
| Ga0105246_119841261 | 3300011119 | Miscanthus Rhizosphere | VAPVDQTPEQRNYVEIARLEGLLTSLRAEPSTARETEAIREIGLEIAIAVREVGAML |
| Ga0137383_103790071 | 3300012199 | Vadose Zone Soil | MSSNSPEQRNYGEIERLENLLEDLRANPSTARETEAIREIGLEIALAV |
| Ga0137365_112276913 | 3300012201 | Vadose Zone Soil | MSNSRPEQRNYAEIERLETLLQTLRENPSTARETEAIREIGLEIALAVREVG |
| Ga0134047_12287331 | 3300012380 | Grasslands Soil | MSNSRPEQRNYAEIERLETLLQTLRENPSTARETEAIREIGLEIALAVREVGAMLINVG |
| Ga0157338_10907581 | 3300012515 | Arabidopsis Rhizosphere | MANSSPEQRNYAEIERLERLLGELRQNASTARETEAIREIGLEIAIAI |
| Ga0137398_107426293 | 3300012683 | Vadose Zone Soil | MSSNSPEQRNYGEIERLENLLQDLRANPSTARETEAIREIGLEI |
| Ga0157281_10102361 | 3300012883 | Soil | MTLDNPEQKNYAEIERLERLLDELRASASTARETEAIREIGLEIALAVREVGAMLVNV |
| Ga0157303_101632653 | 3300012896 | Soil | MNSPEERNFAEIERLEQLLATLRDNAGTARETEAIREIGLEIAIAVREVGAMLV |
| Ga0157289_103538371 | 3300012903 | Soil | MGSPERKNYAEIERLEHLLAELRSGKSTPRQTEAIREIGLEIAIAIREVGAMLTNVG |
| Ga0157297_100326614 | 3300012914 | Soil | MTLDNPEQKNYAEIERLERLLDELRASASTARETEAIREIGLEIAL |
| Ga0164300_106519851 | 3300012951 | Soil | MPSDSSPEQKNYAEIERLEKLLTQLRSSPSTARETE |
| Ga0164300_111811663 | 3300012951 | Soil | MSSNSPEQRNYVEIERLENLLQDLRANPSTARETEAIREICLEIALAVREVG |
| Ga0134076_105750913 | 3300012976 | Grasslands Soil | MSNSGPERKNYAEIERLESLLETLRENPSTAREREAIREIGLEIALAVREVGAML |
| Ga0134087_100654805 | 3300012977 | Grasslands Soil | MSSNTPEQKNYTEIERLEQLLSDLRDNRSTARETEAIREIGL |
| Ga0164309_105229951 | 3300012984 | Soil | VTNPEQKNYAEILRLEARLHELRAGTPTELDGEALREAGLEIALAVREVGAML |
| Ga0164309_116886483 | 3300012984 | Soil | VSRTPEQHNYEEIERLETLLAALRANSSTARETEAIREIGLE |
| Ga0164308_106267121 | 3300012985 | Soil | VASPEQRNYEEIERLEALLTELRVNRSTARETEAIREI |
| Ga0157373_113699401 | 3300013100 | Corn Rhizosphere | MGSPERKNYAEIERLEHLLAELRSGKSTPRQTEAIREI |
| Ga0157374_106937194 | 3300013296 | Miscanthus Rhizosphere | MNSPEQKNYAEIERLEALLAALRANAGTTRETEAIREI |
| Ga0157375_110030004 | 3300013308 | Miscanthus Rhizosphere | MSNSGPERKNYAEIERLEALLQTLRENPSTARETEAIREIGLEIALA |
| Ga0134079_103841553 | 3300014166 | Grasslands Soil | MPNNGLEQKNYAEIERLETLLQTLRESASTARETEAIREI |
| Ga0163163_105175563 | 3300014325 | Switchgrass Rhizosphere | VASPEQRNYEEIERLEALLTELRGNRSTARETEAIREIGLEIAIAVREVGAM |
| Ga0173483_107890093 | 3300015077 | Soil | MNSPEQKNYAEIERLEALLAALREERGTPRQTEAI |
| Ga0134072_104654491 | 3300015357 | Grasslands Soil | MPNSGPEQKNFAEIERLEGLLHTLRESHSTARETEAIREIGLEIALAMREVGAML |
| Ga0132255_1010632873 | 3300015374 | Arabidopsis Rhizosphere | VSRPEQKNFAEIARLEGLLTELRANAATARETEAIREIGLEIAIAVREV |
| Ga0134083_100744001 | 3300017659 | Grasslands Soil | MSNSRPEQRNYAEIERLETLLQTLRENPSTARETEAIREIGLEIALAVR |
| Ga0184619_100667016 | 3300018061 | Groundwater Sediment | MSNSGPERKNYAEIERLETLLQTLRENPSTARETEAIREIGLEIALAVREVGAMLINV |
| Ga0184609_103168701 | 3300018076 | Groundwater Sediment | MSNSGPEQRNYTEIERLETLLQTLRENPSTARETEAIREIGLEIALAVREVGA |
| Ga0066667_105503474 | 3300018433 | Grasslands Soil | MPNNGLEQKNYAEIERLETLLQTLRESASTARETEAIREIGLEMALAVRE |
| Ga0066667_107867711 | 3300018433 | Grasslands Soil | MSDSPEQKNFAEIERLEKLLGELRSNPSTARETEA |
| Ga0190270_117027951 | 3300018469 | Soil | MASPEERNYAAIERLERLLVEMRKNQSTPRETEAIREIG |
| Ga0066669_104992101 | 3300018482 | Grasslands Soil | MTNPEEKNYAEIVRLEELLTELRANPSTARETEAIREIGLEIAIAVREVGAMLVNV |
| Ga0066669_108281984 | 3300018482 | Grasslands Soil | MPNSGPEQKNFAEIERLEGLLHTLRESHSTARETEAIREIGLEIALAMREVG |
| Ga0066669_117359071 | 3300018482 | Grasslands Soil | MENPERKNYAEIERLEALLRDLRSNRSTARETEAIREIGL |
| Ga0066669_123227671 | 3300018482 | Grasslands Soil | MSNSGPEQRNYAEIERLETLLQTLRENPSTARETEAIREIG |
| Ga0184642_14653962 | 3300019279 | Groundwater Sediment | VANEISSNDPEQKNYAEIERLEQLLSELRKNRSTARETEAIREIGLEIAVAIR |
| Ga0184642_17001221 | 3300019279 | Groundwater Sediment | VASEMSNNDPEQKNYAEIERLEQLLSELRENRSTARETEAIREIGLEMA |
| Ga0193747_10161646 | 3300019885 | Soil | MSDNSPERRNFAEIERLEQLLQDLRENPSTARETE |
| Ga0193729_11223284 | 3300019887 | Soil | MLPSDPGQRNYGEIERLERLLEDLRANPSTARETEAIREIGLEIALAVREVGAMLVSVGS |
| Ga0193693_10386821 | 3300019996 | Soil | VRANGLMSSSSPEQRNYGEIERLENLLQDLRANPSTARETEAIR |
| Ga0222625_11957461 | 3300022195 | Groundwater Sediment | MSNSGPERKNYAEIERLETLLQTLRENPSTARETEAIREIGLEIA |
| Ga0222622_102125911 | 3300022756 | Groundwater Sediment | MSNSGPERKNYAEIERLETLLQTLRENPSTARETEAIREIGLEI |
| Ga0222622_107374424 | 3300022756 | Groundwater Sediment | MSDNSPERRNFAEIERLEQLLQDLRENPSTARETEAI |
| Ga0247794_103027671 | 3300024055 | Soil | MGSPERKNYAEIERLEHLLAELRSGKSTPRQTEAIREIGLEIAIAIREVGAML |
| Ga0247672_10379571 | 3300024187 | Soil | VASPEQQNYEQIERLQALLTELRASASTARETEAIREIGLEIAVAIREVGAMLV |
| Ga0207688_101893741 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNSGPEQRNYAEIERLEALLQTLRENPSTARETEAIREIGLEIALA |
| Ga0207662_103598431 | 3300025918 | Switchgrass Rhizosphere | MSSNSPEQRNYGEIERLENLLQDLRANPSTARETEAIR |
| Ga0207706_104788691 | 3300025933 | Corn Rhizosphere | VASPEQRNYEEIERLEGLLTELRGNRSTARETEAIREIGLEIAIAVREV |
| Ga0207709_106895461 | 3300025935 | Miscanthus Rhizosphere | VPSPEQHNYEQIERLQALLTELRASPSTARETEAIREIGIEIALAVR |
| Ga0207704_102072604 | 3300025938 | Miscanthus Rhizosphere | VPSPEQHNYEQIERLQALLTELRASPSTARETEAIREIGIEIALAVREVGAM |
| Ga0207667_108952971 | 3300025949 | Corn Rhizosphere | MSNSGPERKNYAEIERLEALLQTLRENPSTARETEAIREIGLEI |
| Ga0207712_118738992 | 3300025961 | Switchgrass Rhizosphere | MNSPEQKNYAEIERLEALLAALRANAGTTRETEAIREIGFEIAVAIREV |
| Ga0209238_12436461 | 3300026301 | Grasslands Soil | MPNNGLEQKNYAEIERLETLLQTLRESASTARETEAIREIGLEIALAV |
| Ga0209686_11585443 | 3300026315 | Soil | MANNGPEQKNYAEIERLETLLQTLRENPSTARETEAIREIGLEMALAVREVGAMLI |
| Ga0209267_12876401 | 3300026331 | Soil | MANNGPEQKNYAEIERLETLLQTLRENPSTARETEAIREIGLEMALAVREVGAMLINV |
| Ga0209161_100520481 | 3300026548 | Soil | MANNGPEQKNYAEIERLETLLQTLRENPSTARETEAIREIGLEMALA |
| Ga0209811_103849042 | 3300027821 | Surface Soil | MAPNNPEQKNYAEIERLERLLVQLRASASTARETEAIREIGLEIALAVREVGAML |
| Ga0247820_111325401 | 3300028597 | Soil | MASPEERNYAAIERLEQLLVEMRKYQSTPRETEAIREIGFEIAI |
| Ga0307301_101315633 | 3300028719 | Soil | VANEISSNDPEQKNYAEIERLEQLLSELRKNRSTARETEAIREIGLEI |
| Ga0307290_103398431 | 3300028791 | Soil | MSNSGPERKNYAEIERLETLLQTLRENPSTARETEAIREIGLEIALAVREVGAMLIN |
| Ga0307299_104060103 | 3300028793 | Soil | MSNSGPERKNYAEIERLETLLQTLRENPSTARETEAIREIG |
| Ga0307284_100877234 | 3300028799 | Soil | VANEISSNDPEQKNYAEIERLEQLLSELRKNRSTARETEAIREIGLEIAVAIREVGA |
| Ga0307305_102144411 | 3300028807 | Soil | LSSPEQKNYAEIERLEGLLGELRANAPTEQTTEAIREIGLE |
| Ga0307294_103808593 | 3300028810 | Soil | MSNSGPEQRNYAEIERLETLLQTLRENPSTARETEAI |
| Ga0307302_104120231 | 3300028814 | Soil | MSNSGPEQRNYAEIERLETLLQTLRENPSTARETEAIREIGLEIALAVREVGAMLINV |
| Ga0307302_105286503 | 3300028814 | Soil | MESAEQKNYQQIERLEQLLTELRSDPSTAREPAAIREIGLEIAIAVREVGAM |
| Ga0307312_111665901 | 3300028828 | Soil | MPNSGAEQKNYTEIERLEALLETLRENPSTARETE |
| Ga0308183_10334271 | 3300030988 | Soil | MSDNSPERRNFAEIERLEQLLQDLRENPSTARETEAIREIGLEIALAVREVGAML |
| Ga0308185_10296331 | 3300031081 | Soil | MSNSGPEQRNYTEIERLETLLQTLRENPSTARETEAIREIGLEIALAVREV |
| Ga0308184_10526161 | 3300031095 | Soil | MSNSGPERKNYAEIERLETLLQTLRENPSTARETE |
| Ga0308187_101831593 | 3300031114 | Soil | MANEISSNDPEQKNYAEIERLDQLLSELRKNRSTARETE |
| Ga0307506_100793093 | 3300031366 | Soil | VASPEQQNFEQIERLQGLLVELRANRSTARETEAI |
| Ga0308194_101445531 | 3300031421 | Soil | VANEISSNDPEQKNYAEIERLEQLLSELRKNRSTARETEAIREI |
| Ga0310892_100121069 | 3300031858 | Soil | MSVNGPEQKNYAEIERLELLLSALRDSASTPREPEAI |
| Ga0307409_1017277651 | 3300031995 | Rhizosphere | MSNPEGKNYAEIERLEGLLRDLRADGGTMRETEAIREIGLEIAI |
| Ga0307472_1004447484 | 3300032205 | Hardwood Forest Soil | MSSNSPEQRNYGEIERLENLLQDLRANPSTARETEAIREIGLEIALAVRE |
| Ga0307472_1009484004 | 3300032205 | Hardwood Forest Soil | MPSRSPEQKNYTEIERLEKLLTELRGSPSTARETEAIREIGLEI |
| Ga0370548_053858_548_724 | 3300034644 | Soil | MPNSGPEQKNYAEIERLEALLETLRENPSTARETEAIREIGLEIALAVREVGAMLVNVG |
| Ga0370548_056013_579_713 | 3300034644 | Soil | MSGTSPEQKNFAEIDRLEKLLTELRSGRSTARETEAIREIGLEIA |
| Ga0370541_013177_704_859 | 3300034680 | Soil | MPNSGPEQKNYAEIERLEALLETLRENPSTARETEAIREIGLEIALAVREVG |
| Ga0370541_033084_1_165 | 3300034680 | Soil | MPNSGAEQKNYTEIERLEALLETLRENPSTARETEAIREIGLEIALAVREVGAML |
| Ga0370546_074063_2_115 | 3300034681 | Soil | MSNSGPERKNYAEIERLEALLETLRENPSTARETEAIR |
| ⦗Top⦘ |