| Basic Information | |
|---|---|
| Family ID | F047137 |
| Family Type | Metagenome |
| Number of Sequences | 150 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LYIAYLGIRHTVKRVTLEEPDDILFTEIAQPEGAPPIAADEATAARLT |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.67 % |
| % of genes near scaffold ends (potentially truncated) | 97.33 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (24.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 7.89% Coil/Unstructured: 92.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF13751 | DDE_Tnp_1_6 | 39.33 |
| PF01145 | Band_7 | 3.33 |
| PF01814 | Hemerythrin | 2.67 |
| PF01738 | DLH | 0.67 |
| PF06737 | Transglycosylas | 0.67 |
| PF04892 | VanZ | 0.67 |
| PF13185 | GAF_2 | 0.67 |
| PF03466 | LysR_substrate | 0.67 |
| PF00115 | COX1 | 0.67 |
| PF13336 | AcetylCoA_hyd_C | 0.67 |
| PF04545 | Sigma70_r4 | 0.67 |
| PF00230 | MIP | 0.67 |
| PF01494 | FAD_binding_3 | 0.67 |
| PF04151 | PPC | 0.67 |
| PF00196 | GerE | 0.67 |
| PF13277 | YmdB | 0.67 |
| PF05193 | Peptidase_M16_C | 0.67 |
| PF08240 | ADH_N | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.33 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.67 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.67 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.67 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725004|GPKC_F5V46DG03FS7OS | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 513 | Open in IMG/M |
| 2140918007|ConsensusfromContig112888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 630 | Open in IMG/M |
| 2170459019|G14TP7Y01CKGY7 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300000953|JGI11615J12901_10952683 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300000956|JGI10216J12902_115595061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300002076|JGI24749J21850_1067540 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300002568|C688J35102_118512172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 567 | Open in IMG/M |
| 3300002568|C688J35102_119089458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300003996|Ga0055467_10037491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1196 | Open in IMG/M |
| 3300004156|Ga0062589_101031472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 771 | Open in IMG/M |
| 3300004157|Ga0062590_102543388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300004479|Ga0062595_101618799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300004643|Ga0062591_100936103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 817 | Open in IMG/M |
| 3300005093|Ga0062594_102373027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
| 3300005093|Ga0062594_102585736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
| 3300005172|Ga0066683_10394980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 855 | Open in IMG/M |
| 3300005331|Ga0070670_102167319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
| 3300005332|Ga0066388_104893636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300005336|Ga0070680_100530788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1008 | Open in IMG/M |
| 3300005337|Ga0070682_101211163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300005339|Ga0070660_101536066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300005339|Ga0070660_101666943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300005535|Ga0070684_101385258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300005543|Ga0070672_101023902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
| 3300005547|Ga0070693_100419552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 932 | Open in IMG/M |
| 3300005713|Ga0066905_101098875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 706 | Open in IMG/M |
| 3300005718|Ga0068866_10558212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 767 | Open in IMG/M |
| 3300005718|Ga0068866_11214594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
| 3300005718|Ga0068866_11447973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300005841|Ga0068863_100943618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 864 | Open in IMG/M |
| 3300005844|Ga0068862_101223089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
| 3300006237|Ga0097621_100751942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 900 | Open in IMG/M |
| 3300009094|Ga0111539_12210522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300009098|Ga0105245_12959492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 526 | Open in IMG/M |
| 3300009147|Ga0114129_12522498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300009174|Ga0105241_12346841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300009176|Ga0105242_11420846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300009176|Ga0105242_13005652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300009551|Ga0105238_10394404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 1377 | Open in IMG/M |
| 3300009789|Ga0126307_11104736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 641 | Open in IMG/M |
| 3300009789|Ga0126307_11620243 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009840|Ga0126313_10075577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2432 | Open in IMG/M |
| 3300009840|Ga0126313_10153158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1743 | Open in IMG/M |
| 3300009840|Ga0126313_10546475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 930 | Open in IMG/M |
| 3300010038|Ga0126315_10011273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4247 | Open in IMG/M |
| 3300010038|Ga0126315_10652249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 683 | Open in IMG/M |
| 3300010038|Ga0126315_10910198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300010039|Ga0126309_11007648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300010040|Ga0126308_10353053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 974 | Open in IMG/M |
| 3300010040|Ga0126308_10435139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 879 | Open in IMG/M |
| 3300010040|Ga0126308_10468407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 848 | Open in IMG/M |
| 3300010042|Ga0126314_10630943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
| 3300010044|Ga0126310_11473123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300010045|Ga0126311_10416039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1037 | Open in IMG/M |
| 3300010166|Ga0126306_10636164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
| 3300010166|Ga0126306_10951495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
| 3300010403|Ga0134123_11880412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300011003|Ga0138514_100066197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300011119|Ga0105246_11944987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300012188|Ga0136618_10272558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300012206|Ga0137380_11055157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300012355|Ga0137369_10634338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
| 3300012487|Ga0157321_1026260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300012490|Ga0157322_1021767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 623 | Open in IMG/M |
| 3300012531|Ga0136640_10271383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 724 | Open in IMG/M |
| 3300012680|Ga0136612_10434784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300012898|Ga0157293_10007121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1672 | Open in IMG/M |
| 3300012906|Ga0157295_10289501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300012941|Ga0162652_100034728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300012985|Ga0164308_10924554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
| 3300013297|Ga0157378_12714803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300013307|Ga0157372_12801977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300014969|Ga0157376_11794540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300015372|Ga0132256_100564748 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300015373|Ga0132257_101838429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300015373|Ga0132257_104423894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 511 | Open in IMG/M |
| 3300015374|Ga0132255_101712588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
| 3300017695|Ga0180121_10159452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 828 | Open in IMG/M |
| 3300017965|Ga0190266_10231090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
| 3300018054|Ga0184621_10363547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300018422|Ga0190265_10498445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1330 | Open in IMG/M |
| 3300018422|Ga0190265_13831762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300018432|Ga0190275_10159834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2087 | Open in IMG/M |
| 3300018432|Ga0190275_11568445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
| 3300018432|Ga0190275_11860949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300018432|Ga0190275_12168584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
| 3300018466|Ga0190268_10790573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| 3300018469|Ga0190270_12905770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300018476|Ga0190274_12758551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300018481|Ga0190271_10050075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3550 | Open in IMG/M |
| 3300018920|Ga0190273_11206143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
| 3300019356|Ga0173481_10852901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300019767|Ga0190267_10011924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2380 | Open in IMG/M |
| 3300019767|Ga0190267_11133092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300019767|Ga0190267_11196204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
| 3300021078|Ga0210381_10066180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 1117 | Open in IMG/M |
| 3300022756|Ga0222622_10400639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
| 3300022756|Ga0222622_11131470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300025721|Ga0209587_1084316 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300025934|Ga0207686_11719203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300025944|Ga0207661_11591833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
| 3300025945|Ga0207679_10480531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1106 | Open in IMG/M |
| 3300026067|Ga0207678_10537156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 1022 | Open in IMG/M |
| 3300026078|Ga0207702_10613223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 1068 | Open in IMG/M |
| 3300026088|Ga0207641_11011225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 828 | Open in IMG/M |
| 3300027866|Ga0209813_10303223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300027876|Ga0209974_10400163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300028281|Ga0247689_1039157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
| 3300028379|Ga0268266_10636631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 1026 | Open in IMG/M |
| 3300028380|Ga0268265_11045134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 809 | Open in IMG/M |
| 3300028589|Ga0247818_10350007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 989 | Open in IMG/M |
| 3300028589|Ga0247818_11176389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300028589|Ga0247818_11283911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300028597|Ga0247820_11359167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300028718|Ga0307307_10126903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 789 | Open in IMG/M |
| 3300028720|Ga0307317_10059485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1234 | Open in IMG/M |
| 3300028720|Ga0307317_10284444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300028744|Ga0307318_10042738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1493 | Open in IMG/M |
| 3300028754|Ga0307297_10335304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300028755|Ga0307316_10009340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3030 | Open in IMG/M |
| 3300028771|Ga0307320_10361846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 580 | Open in IMG/M |
| 3300028778|Ga0307288_10170833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
| 3300028810|Ga0307294_10084206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 983 | Open in IMG/M |
| 3300028810|Ga0307294_10421346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300028824|Ga0307310_10440905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300028872|Ga0307314_10007575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2304 | Open in IMG/M |
| 3300028875|Ga0307289_10004195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5674 | Open in IMG/M |
| 3300028876|Ga0307286_10030573 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300028880|Ga0307300_10365056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300028881|Ga0307277_10486951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300028885|Ga0307304_10443843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 590 | Open in IMG/M |
| 3300030010|Ga0302299_10659403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 515 | Open in IMG/M |
| 3300030336|Ga0247826_11433050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300031547|Ga0310887_11047569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300031562|Ga0310886_10507284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363 | 729 | Open in IMG/M |
| 3300031731|Ga0307405_10894927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 750 | Open in IMG/M |
| 3300031852|Ga0307410_10466926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
| 3300031852|Ga0307410_11182544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 666 | Open in IMG/M |
| 3300031858|Ga0310892_11412768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
| 3300031901|Ga0307406_10525677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acaciae | 964 | Open in IMG/M |
| 3300031995|Ga0307409_100369655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1359 | Open in IMG/M |
| 3300031995|Ga0307409_102276205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300031996|Ga0308176_10080426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2794 | Open in IMG/M |
| 3300031996|Ga0308176_11197918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300032004|Ga0307414_10110096 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
| 3300032013|Ga0310906_10375428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
| 3300032126|Ga0307415_101051804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
| 3300032126|Ga0307415_101809528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300033550|Ga0247829_10761879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
| 3300033550|Ga0247829_11797866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 24.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 11.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.33% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.33% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.33% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.67% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.67% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.67% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Host-Associated | Open in IMG/M |
| 3300012531 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ864 (21.06) | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025721 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKC_05627070 | 2067725004 | Soil | YIAYLGIRHTVKRVTLEEPDDILFTELDQPEGTPMVGREEATAARLR |
| A_all_C_03095340 | 2140918007 | Soil | RVTLEEPEDILFTEVSAPPGVDALSGDEATAARLT |
| 4MG_00831440 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | HRVKQVTLEEPEDILFTEITEPPGVAGPSPEEASAARTVA |
| JGI11615J12901_109526831 | 3300000953 | Soil | ALYIAYLGIRHTVKHVTLDEPDNLFTEVHEPEGVASATDAEAAAARLT* |
| JGI10216J12902_1155950612 | 3300000956 | Soil | YIAYLGIRHTVKRVTLEEPDDILFTEIAQPEGAAPIAAEEATAARLR* |
| JGI24749J21850_10675402 | 3300002076 | Corn, Switchgrass And Miscanthus Rhizosphere | GCAVPTLYIAYTGIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT* |
| C688J35102_1185121722 | 3300002568 | Soil | LPTLYIAYLGVRHTVKRVTLDEPEDILFTELRQADDAPLVGADEASAARLT* |
| C688J35102_1190894581 | 3300002568 | Soil | PALYIAYIGIRHTVTAVTLDEPDDILFTELSGATLDDDEATAARIG* |
| Ga0055467_100374911 | 3300003996 | Natural And Restored Wetlands | GVRHTVKRVTLDEPEDILFTEIEVPEGAPDVSSDEATAARVT* |
| Ga0062589_1010314721 | 3300004156 | Soil | GVRYTVKRVTLEEPEDILFTEIDVPEGAPAVSGEEASAARVT* |
| Ga0062590_1025433881 | 3300004157 | Soil | LGGAVPALYIALLGIRHTVKQVTYEEPEDILFTEIAQPAGIDAVAGDEAAAARLV* |
| Ga0062595_1016187991 | 3300004479 | Soil | PALYIAYLGIRHTVKHVTLEEPDDILFTEIAQPAGAAPIAAEEATAARLR* |
| Ga0062591_1009361032 | 3300004643 | Soil | LIAGCALPVLYIGYLGVRYTVKRVTLEEPEDILFTEIDVPEGAPAVSGEEASAARVT* |
| Ga0062594_1023730271 | 3300005093 | Soil | RHTVKRVTLEEPDDILFTEITAPEGVVAATGDEATAARLT* |
| Ga0062594_1025857361 | 3300005093 | Soil | AGGALPALYIAYLGIRHTVTRVTLEEPEDILFTTVEQPEGVPSMAHDEASAAKLT* |
| Ga0066683_103949803 | 3300005172 | Soil | LYIAYLGIRHTVKQVTLEQPDILFTDVYQPEGISAAGDEEAAAARLA* |
| Ga0070670_1021673192 | 3300005331 | Switchgrass Rhizosphere | AVPTLYIAYLGIRHTVTRVTLDEPEDILFTEISAPEGVAVAGDEATAAKLA* |
| Ga0066388_1048936361 | 3300005332 | Tropical Forest Soil | ALYIAYLGIRHTVKQVTIEEPDSLLFTEISQPAGVDAAAGDEAAAARLT* |
| Ga0070680_1005307881 | 3300005336 | Corn Rhizosphere | DVVFITGGAVPALYIAWLGIRYTVDRVTLDEPDDILFTVVREPEGVPRAGADEAAAARLV |
| Ga0070682_1012111631 | 3300005337 | Corn Rhizosphere | PALYIAYLGIRYTVKRVTLEEPEDILFTDLDLPDGAATVSDDEATAARIT* |
| Ga0070660_1015360661 | 3300005339 | Corn Rhizosphere | VFITGGAVPALYIAWLGIRYTVDRVTLDEPDDILFTVVREPEGVPRAGADEAAAARLV* |
| Ga0070660_1016669431 | 3300005339 | Corn Rhizosphere | PALYIAYLGVRHTVEHVTTEEPEDILFTDIAGADADSAEASAAGVRV* |
| Ga0070684_1013852582 | 3300005535 | Corn Rhizosphere | IRHTVKRVTLSEPEDILFTELSTPEGVPAPSGSEASAADTR* |
| Ga0070672_1010239022 | 3300005543 | Miscanthus Rhizosphere | PGDIVLIAGCAVPTLYIAYTGIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT* |
| Ga0070693_1004195522 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | GIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT* |
| Ga0066905_1010988751 | 3300005713 | Tropical Forest Soil | PALYIAYLGIRHTVRQMTLEEPDDILFTEIHEPAGVAEISPEEAAAARIT* |
| Ga0068866_105582121 | 3300005718 | Miscanthus Rhizosphere | CALPALYIAYLGIRYTVKRVTLEEPEDILFTDLDLPDGAATVSDDEATAARIT* |
| Ga0068866_112145942 | 3300005718 | Miscanthus Rhizosphere | LGVRHTVKRVTLDEPDDILFTEITAPEGVVAATGDEATAARLT* |
| Ga0068866_114479732 | 3300005718 | Miscanthus Rhizosphere | RHTVKRVTLEEPEDILFTEIGQPEGAEMIAADEATAARLT* |
| Ga0068863_1009436182 | 3300005841 | Switchgrass Rhizosphere | YLGIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT* |
| Ga0068862_1012230891 | 3300005844 | Switchgrass Rhizosphere | VKRVTLDEPDDILFTEISGITDAGADEATAARIG* |
| Ga0097621_1007519422 | 3300006237 | Miscanthus Rhizosphere | ALYIAYIGIRHTVKRVTLLEPEDILFTELTTPAGVPAPTDAEASAAETR* |
| Ga0111539_122105221 | 3300009094 | Populus Rhizosphere | IPALYIAYLGVRHTVKRVTLEEPDDILFTEIAQPAGAAPITAEEATAARLR* |
| Ga0105245_129594922 | 3300009098 | Miscanthus Rhizosphere | VTLDEPDDILFTEISGPPGVATAGSDEATAARLT* |
| Ga0114129_125224982 | 3300009147 | Populus Rhizosphere | VTLEEPEDILFTELAHPEGLPPADEEEAAAARLT* |
| Ga0105241_123468412 | 3300009174 | Corn Rhizosphere | GGAIPALYIAYLGIRHTVKQVTLDEPEDILFTEVHEPEGVAAMGDAEAAAARLT* |
| Ga0105242_114208461 | 3300009176 | Miscanthus Rhizosphere | IPALYIAYIGIRHTVKRVTLEEPEDILFTEILVSRDAGAAEEASAAKIT* |
| Ga0105242_130056522 | 3300009176 | Miscanthus Rhizosphere | YLGIRHTVKRVTLEEPEDILFTEVSAPPGVDSLSGDEATAARLT* |
| Ga0105238_103944041 | 3300009551 | Corn Rhizosphere | TVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT* |
| Ga0126307_111047361 | 3300009789 | Serpentine Soil | RHTVKRVTLEEPEDILFTEVLEPAGVPTMGDEEASAARLK* |
| Ga0126307_116202431 | 3300009789 | Serpentine Soil | VTLEEPEDILFTELIEPEGVEADGGVEASAAKVT* |
| Ga0126313_100755775 | 3300009840 | Serpentine Soil | RVTLEEPDDILFTEISAPEGVAAVSGEEATAARLT* |
| Ga0126313_101531582 | 3300009840 | Serpentine Soil | VKHVTLEEPDDILFTEVHEPEGVAPASGDEAAAARLT* |
| Ga0126313_105464751 | 3300009840 | Serpentine Soil | KRVTLEEPEDILFTEVDQPEGTPAMREDEATAARLT* |
| Ga0126315_100112731 | 3300010038 | Serpentine Soil | IAWVGIRHTVKRVTLEEPEDILFTEVKEPAGLTSVSADEATAARVT* |
| Ga0126315_106522491 | 3300010038 | Serpentine Soil | TVKRVTLEEPEDILFTEVVEPEGVPSMGQDEAAAARLT* |
| Ga0126315_109101981 | 3300010038 | Serpentine Soil | GDIVFMVGGALPALYIAYLGIRHTVKRVTLEEPEDILFTDLDQPDGVPQLSDEEATAARIT* |
| Ga0126309_110076481 | 3300010039 | Serpentine Soil | AVPTLYIAYLGIRHTVKRVTLDEPEDILFTELAQPAGVPAMGGDEATAARLT* |
| Ga0126308_103530531 | 3300010040 | Serpentine Soil | LYIAYLGIRHTVKRVTLEEPDDILFTEIAQPEGAPPIAADEATAARLT* |
| Ga0126308_104351393 | 3300010040 | Serpentine Soil | PALYIAWLGIRYTVKQVTLEEPEDILFTDVHEPEGVAAMGVAEAAAARLT* |
| Ga0126308_104684071 | 3300010040 | Serpentine Soil | YIAYLGIRHTVKRVTLDEPEDILFTQLEQPAGTPAVTGEEASAARVT* |
| Ga0126314_106309432 | 3300010042 | Serpentine Soil | RVTLDEPEDILFTELAHPAGLPSADDEEAAAARLT* |
| Ga0126310_114731232 | 3300010044 | Serpentine Soil | VERVTLDEPDDILFTELDEAEGTPQVTGEEATAARVT* |
| Ga0126311_104160391 | 3300010045 | Serpentine Soil | ALYIAYLGIRHTVKRVTLEEPEDILFTELDQPEGFPAISADEATAAKLT* |
| Ga0126306_106361641 | 3300010166 | Serpentine Soil | KRVTLEEPEDILFTEVKEPEGTPAVSKDEAAAARLT* |
| Ga0126306_109514951 | 3300010166 | Serpentine Soil | RHTVKRVTLEEPEDILFTDVREPEGAASVSVEEAAAASVT* |
| Ga0134123_118804121 | 3300010403 | Terrestrial Soil | AIPTLYIAYLGIRYTVERVTLEEPDDILFTEISAPEGAPVSGEEATAARLT* |
| Ga0138514_1000661972 | 3300011003 | Soil | GGPGVGIRHAVKQVTLEEPDDILFTDVYQPEGISAAGDEEAAAARLA* |
| Ga0105246_119449871 | 3300011119 | Miscanthus Rhizosphere | PVPTLYIAYLGIRHTVTRVTLDEPEDILFTEISAPEGVAVAGDEATAAKLA* |
| Ga0136618_102725581 | 3300012188 | Polar Desert Sand | LYIAYLGVRHTVKRVTLEEPEDILFTEVAEPEGLEKVGDREAAAARTT* |
| Ga0137380_110551572 | 3300012206 | Vadose Zone Soil | HTVKQVTLEEPDDILFADVYQPEGVSAAGDEEAAAARLV* |
| Ga0137369_106343381 | 3300012355 | Vadose Zone Soil | PVLYIAWVGIRHTVKRVTLEEPEDILFTDVTQPEGAAAVSELEAAAAKVT* |
| Ga0157321_10262601 | 3300012487 | Arabidopsis Rhizosphere | LYIAYLGIRHTVKRVTLEEPDDILFTEIDQPEDGPMVGPDEATAARLT* |
| Ga0157322_10217672 | 3300012490 | Arabidopsis Rhizosphere | HTVKRVTLDEPDDILFTELSGPPGVETPGGDEATAARLT* |
| Ga0136640_102713832 | 3300012531 | Polar Desert Sand | VKRVTLEEPEDILFTEVEEPEHIPSMKDEEAAAARLT* |
| Ga0136612_104347842 | 3300012680 | Polar Desert Sand | VKRSTLDEPEDILFTELSHPEGALPGSEEATAARLT* |
| Ga0157293_100071214 | 3300012898 | Soil | FPGDTLFIMGGAVPALYIAYLGIRHTVKHVTLGEADTLFTEVSQPQEVSAFDEQEAAAARLT* |
| Ga0157295_102895011 | 3300012906 | Soil | GDTLFIMGGAVPALYIAYLGIRHTVKHVTLGEADTLFTEVSQPQEVSAFDEQEAAAARLT |
| Ga0162652_1000347282 | 3300012941 | Soil | RHTVKRVTLEAPDGILFTEVAQPEGAEPIAAEEATAARLR* |
| Ga0164308_109245542 | 3300012985 | Soil | DVLFIAGGAVPALYIAYLGIRHAVKGVTLHEPDDILFTEIVVPAGAEVDGSGASAADLK* |
| Ga0157378_127148031 | 3300013297 | Miscanthus Rhizosphere | IIFIAGGAIPTLYIAYLGVRHTVKRVTLDEPDDILFTALAHPDGLPPADEEEAAAARLT* |
| Ga0157372_128019772 | 3300013307 | Corn Rhizosphere | VRHTVKRVTLDEPDDILFTEISGITDAGADEATAARIG* |
| Ga0157376_117945402 | 3300014969 | Miscanthus Rhizosphere | GIRHTVKRVTLLEPEDILFTELTTPAGVPAPTDAEASAAETR* |
| Ga0132256_1005647481 | 3300015372 | Arabidopsis Rhizosphere | GVRYTVKRVTLDEPDDILFTELSGPPGAEALGGDEATAARLT* |
| Ga0132257_1018384292 | 3300015373 | Arabidopsis Rhizosphere | AYLGIRHTVKRVTLDEPDDILFTELSGPPGVETLGGDEATAARLT* |
| Ga0132257_1044238942 | 3300015373 | Arabidopsis Rhizosphere | YLGVRHTVKRVTFDEPDDILFTELSGPPGVETLGGDEATAARLT* |
| Ga0132255_1017125882 | 3300015374 | Arabidopsis Rhizosphere | VTLEEPDDILFTDVHEPSGVAAMGDSEAAAARLT* |
| Ga0180121_101594521 | 3300017695 | Polar Desert Sand | YLGIRHTVKRTTLEEPEDILFTEIAQPDHVPSMDREEATAARLT |
| Ga0190266_102310903 | 3300017965 | Soil | GGALPVLYITYVGIRPTVQRTTLEEPEDILFTEIHEPAGVATIGDEAAAAKTTS |
| Ga0184621_103635472 | 3300018054 | Groundwater Sediment | YIAYLGIRHTVKRVTLDEPEDILFTELSGVTETGEQEATAARLR |
| Ga0190265_104984451 | 3300018422 | Soil | CIAYVGIRHTVKRMTLEEPEDILFTEIIEPAGVARTGDEEAAAARTT |
| Ga0190265_138317622 | 3300018422 | Soil | GALPVLYICYIGIRHTVKRVTLEEPEDILFTEIDDPGGVTGVSSDEAAAARVT |
| Ga0190275_101598345 | 3300018432 | Soil | RHTVKRITLEEPEDILFTELAEPDGVAAIGPDEASAAKLT |
| Ga0190275_115684452 | 3300018432 | Soil | GGGALPVLYISYVGIRHTVKRSTLSEPDDILFTEIHEPAGVARIGEDEAAAAKTTS |
| Ga0190275_118609491 | 3300018432 | Soil | IRHTVKRITLEEPEDILFTELSEPEGVAAVGPDEASAAKLT |
| Ga0190275_121685842 | 3300018432 | Soil | VLYITYVGIRHTVKRTTLEEPEDILFTEIHEPAGVGTVGAEAGAAKTTP |
| Ga0190268_107905731 | 3300018466 | Soil | AYLGIRHTVNRITLEEPEDILFTEIDFPHGADGAEEASAARVT |
| Ga0190270_129057702 | 3300018469 | Soil | LYIAYVGIRHTVKRVTLEEPKDILFTDITEPAGVGAAGDAEAAAPRTTT |
| Ga0190274_127585512 | 3300018476 | Soil | LPALYIAYLGIRHTVNRVTLDEPDDILFTEISGITEPAADEATAARIA |
| Ga0190271_100500751 | 3300018481 | Soil | VKRVTLDEPEDILFTVIEQPAGVDAPGEAEATAAKVT |
| Ga0190273_112061431 | 3300018920 | Soil | HTVRRITLEEPEDILFTEVAHPEGVPVEGGEEATAARLT |
| Ga0173481_108529012 | 3300019356 | Soil | PALYIAYLGVRYTVKRVTLDEPDDILFTELSGPPGVETPGGDEATAARLT |
| Ga0190267_100119241 | 3300019767 | Soil | LYIAYIGIRHTVKRVTLEEPEDILFTTVAVPAGADAVAEEASAASVT |
| Ga0190267_111330921 | 3300019767 | Soil | IAYLGVRHTVKRVTLEEPEDILFTELAHPEGLAAADAEEAAAARLT |
| Ga0190267_111962042 | 3300019767 | Soil | YLGIRHTVKRVTLEEPQDILFTEISEPAGVAGVVHDEASAAKLT |
| Ga0210381_100661801 | 3300021078 | Groundwater Sediment | AVPALYIAYLGIRHTVKRVTLDEPDDILFTELSVPGDVAAAGGDEATAARLT |
| Ga0222622_104006393 | 3300022756 | Groundwater Sediment | TLYIAYLGIRHTVKRVTLEEPDDILFTEISAPEGIAAVSGEEATAARLR |
| Ga0222622_111314702 | 3300022756 | Groundwater Sediment | YLGIRHTVKRVTLEEPDEILFTEIGQPEGAEMIAAEEATAARLR |
| Ga0209587_10843161 | 3300025721 | Arctic Peat Soil | LYIAYLGIRHTVDRVTLDEPDDILFTEIHEPAGVPNMGDEEAAAARRIQA |
| Ga0207686_117192032 | 3300025934 | Miscanthus Rhizosphere | LGIRHTVTRVTLEEPEDILFTEVSAPPGVDSLSGDEATAARLT |
| Ga0207661_115918331 | 3300025944 | Corn Rhizosphere | PTLYIAYLGVRHTVKRVTLEEPDDILFTEITAPEGVAAASGDEATAARLT |
| Ga0207679_104805313 | 3300025945 | Corn Rhizosphere | RVTLREPEDILFTELSTPEGVPAPSGSEASAADTR |
| Ga0207678_105371563 | 3300026067 | Corn Rhizosphere | GCAVPTLYIAYTGIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT |
| Ga0207702_106132232 | 3300026078 | Corn Rhizosphere | IAYLGIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT |
| Ga0207641_110112252 | 3300026088 | Switchgrass Rhizosphere | HTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT |
| Ga0209813_103032232 | 3300027866 | Populus Endosphere | ALYIAYLGIRHTVQRVTLEEPEDILFSDIAFADGAAAPEEAGAR |
| Ga0209974_104001633 | 3300027876 | Arabidopsis Thaliana Rhizosphere | RHTVKHVTFEEPDDILFTEIAQPEGVEMIAAQEATAARLR |
| Ga0247689_10391572 | 3300028281 | Soil | LYIAYLGIRYTVRQVTYEGPETLFTEVEQPEGVGAFGEDEAAAARLT |
| Ga0268266_106366311 | 3300028379 | Switchgrass Rhizosphere | YLGIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT |
| Ga0268265_110451341 | 3300028380 | Switchgrass Rhizosphere | YLGVRHTVKRVTLDEPDDILFTEISGITDAGADEATAARIG |
| Ga0247818_103500073 | 3300028589 | Soil | AYLGIRHTVKHVTLEEPDDILFTEIAQPEGAVPIAAEEATAARLR |
| Ga0247818_111763891 | 3300028589 | Soil | LYIAYVGIRHTVKRVTLEEPEDILFTDITEPAGVGVAGDSGATAAGRTTS |
| Ga0247818_112839111 | 3300028589 | Soil | AYLGIRHTVKRVTLEEPEDILFTELVQPEGVETAGESEATAARLT |
| Ga0247820_113591672 | 3300028597 | Soil | LPALYIAYLGIRHTVKRVTLEEPEDILFTEVDQPEGVPMVGPGEASAAKLS |
| Ga0307307_101269032 | 3300028718 | Soil | GGALPALYIAYLGIRHTVKRVTFDEPDDILFTELSEPGGVVAGGDEATAARLT |
| Ga0307317_100594854 | 3300028720 | Soil | LYIAYLGIRHTVKRVTLEEPDDILFTEISAPEGIAAVSGEEATAARLR |
| Ga0307317_102844441 | 3300028720 | Soil | IVGGAVPALYIAYLGIRHTVKRVTLDEPDDILFTELSVPGDVAAAGGDEATAARLT |
| Ga0307318_100427382 | 3300028744 | Soil | VGGALPALYIAYLGIRYTVKRVTLEQPDDILFTEIGQPEGYPGIAADEATAAKLT |
| Ga0307297_103353042 | 3300028754 | Soil | PVLYICFVGIRHTVKRVTLEEPDDILFSEIDDPGGVTGVSSDEAAAAKVT |
| Ga0307316_100093405 | 3300028755 | Soil | VGGALPALYIAYLGIRHTVKRVTLDEPDDILFTEIAQPAGAAPIAPEEATAARLR |
| Ga0307320_103618461 | 3300028771 | Soil | KRVTLDEPDDILFTELSEPGGVVVGGDEATAARLT |
| Ga0307288_101708331 | 3300028778 | Soil | VGGAIPALYIAYIGIRHTVKRVTLDEPEDILFTEIAVPEGAAGAEEASAARVT |
| Ga0307294_100842063 | 3300028810 | Soil | YIAYLGIRHTVKRVTLDEPDDILFTELSVPGDVAAAGGDEATAARLT |
| Ga0307294_104213462 | 3300028810 | Soil | AYLGIRHTVKRVTFDEPDDILFTELSEPGGVVAGGDEATAARLT |
| Ga0307310_104409051 | 3300028824 | Soil | IAYLGIRHTVTRITLDEPEDLLFTEISEPAGIAKVGVDEASAARLT |
| Ga0307314_100075754 | 3300028872 | Soil | LGIRHTVKRVTFDEPDDILFTELSEPGGVVAGGDEATAARLT |
| Ga0307289_100041951 | 3300028875 | Soil | PALYIAYLGIRHTVKRVTLDEPDDILFTELSVPGDVAAAGGDEATAARLT |
| Ga0307286_100305734 | 3300028876 | Soil | IRHTVKRVKLDEPDDILFTELSVPGGVAAPGGDEATAARLT |
| Ga0307300_103650562 | 3300028880 | Soil | HTVKRVTLEEPDDILFTEIAQPEGAALIAAEEATAARLR |
| Ga0307277_104869511 | 3300028881 | Soil | KRTTLEEPADILFTEITEPPGIAKLGDEEATAARLT |
| Ga0307304_104438432 | 3300028885 | Soil | LPALYISYLGIRHTVKRVTFDEPDDILFTELSEPGGVVVGGDEATAARLT |
| Ga0302299_106594032 | 3300030010 | Fen | LYIAYLGIRHTVKRVTLDEPEDILFTELSQPAGAGDSGEEEATAARLT |
| Ga0247826_114330502 | 3300030336 | Soil | IRHTVKRVTLEEPEDILFTEIDAPAGVTDVSPDEAAAAKVT |
| Ga0310887_110475691 | 3300031547 | Soil | YIAYLGVRHTVKRVTLDEPDDILFTELTVPGDLAAAGGDEATAARLT |
| Ga0310886_105072842 | 3300031562 | Soil | YIAYLGIRHTVKRVTLEEPDDILFTEIAQPAGAAPIAAEEATAARLR |
| Ga0307405_108949272 | 3300031731 | Rhizosphere | GGAIPALYIAYLGIRHTVKRVTLEEPDDILFTEIHQPVGAAPIASDEATAARLT |
| Ga0307410_104669261 | 3300031852 | Rhizosphere | IPVLYIAYIGIRHTVKRVTLEEPEDILFTELTEPPGVGDPGDAEAASAAKTTT |
| Ga0307410_111825441 | 3300031852 | Rhizosphere | RVTLEEPDDILFTEIHEPDGVAATGVQEAAAAKTTP |
| Ga0310892_114127682 | 3300031858 | Soil | YLGIRHTVKRVTLEEPEDILFTEIGQPEGAEMIAADEATAARLT |
| Ga0307406_105256773 | 3300031901 | Rhizosphere | RVTLEEPEDILFTEIAEPEGVASPGDAEAASAARTVT |
| Ga0307409_1003696551 | 3300031995 | Rhizosphere | AGGAIPALYIAYLGIRHTVKRVTLEEPDDILFTEIHQPVGAAPIASDEATAARLT |
| Ga0307409_1022762051 | 3300031995 | Rhizosphere | HTVKRVTLEEPEDILFTELAHPDGLPPADEEEAAAARLT |
| Ga0308176_100804261 | 3300031996 | Soil | YIAYIGIRHTVKRVLLEEPEDILFTEVAAPADLRPDAAEAAAAKTT |
| Ga0308176_111979181 | 3300031996 | Soil | GLPGDLIFIGAGAVPVLYICYIGVRHTVKRVTLEEPEDILFTELTEPAGVGQAGDAEAASAARTTT |
| Ga0307414_101100961 | 3300032004 | Rhizosphere | HTVKRVTLEEPEDILFTELTEPPGVGDPGDAEAASAAKTTT |
| Ga0310906_103754283 | 3300032013 | Soil | IPALYIAYLGVRYTVKQVTYEEPDLLFTELHQPGGLEAAGEDEALAARVT |
| Ga0307415_1010518041 | 3300032126 | Rhizosphere | RLPGDIILIGGGAVPVLYIAYIGIRHTVKRVTLEEPEDILFTSITEPEGVGATGDAEATAAQTTT |
| Ga0307415_1018095282 | 3300032126 | Rhizosphere | YIAYLGIRHTVKRVTLEEPDDILFTEIAQPEGAAPIAADEATAARLR |
| Ga0247829_107618791 | 3300033550 | Soil | YIAYLGIRHTVKRVTLDEPILFTEIHQPEGEQAEVEEAAAARLT |
| Ga0247829_117978661 | 3300033550 | Soil | VLYIAYIGIRHTVKRVTLDEPEDILFTDITEPEGVSKTKPEEAAAARTT |
| ⦗Top⦘ |