Basic Information | |
---|---|
Family ID | F047056 |
Family Type | Metagenome |
Number of Sequences | 150 |
Average Sequence Length | 46 residues |
Representative Sequence | MLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Number of Associated Samples | 87 |
Number of Associated Scaffolds | 150 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 5.33 % |
% of genes near scaffold ends (potentially truncated) | 76.00 % |
% of genes from short scaffolds (< 2000 bps) | 82.67 % |
Associated GOLD sequencing projects | 77 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (82.000 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (52.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (76.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (80.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 62.22% Coil/Unstructured: 37.78% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 150 Family Scaffolds |
---|---|---|
PF16778 | Phage_tail_APC | 4.00 |
PF00959 | Phage_lysozyme | 3.33 |
PF13884 | Peptidase_S74 | 2.00 |
PF13392 | HNH_3 | 2.00 |
PF00182 | Glyco_hydro_19 | 2.00 |
PF00149 | Metallophos | 1.33 |
PF07603 | DUF1566 | 0.67 |
PF02945 | Endonuclease_7 | 0.67 |
PF03819 | MazG | 0.67 |
PF01464 | SLT | 0.67 |
COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
---|---|---|---|
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 2.00 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 2.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.67 % |
Unclassified | root | N/A | 5.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002447|JGI24768J34885_10084714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1062 | Open in IMG/M |
3300003393|JGI25909J50240_1030110 | All Organisms → Viruses → Predicted Viral | 1196 | Open in IMG/M |
3300003393|JGI25909J50240_1095429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300003393|JGI25909J50240_1105970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300003411|JGI25911J50253_10139356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300003412|JGI25912J50252_10151085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300003493|JGI25923J51411_1032752 | Not Available | 995 | Open in IMG/M |
3300004054|Ga0063232_10029714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1356 | Open in IMG/M |
3300004123|Ga0066181_10134200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300005581|Ga0049081_10047923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1619 | Open in IMG/M |
3300005581|Ga0049081_10099886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1082 | Open in IMG/M |
3300005581|Ga0049081_10140576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
3300005581|Ga0049081_10140846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
3300005581|Ga0049081_10179230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
3300005581|Ga0049081_10187900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300005582|Ga0049080_10023175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2168 | Open in IMG/M |
3300005584|Ga0049082_10040020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1642 | Open in IMG/M |
3300005831|Ga0074471_10945741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300005832|Ga0074469_10722776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
3300005940|Ga0073913_10092273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300006484|Ga0070744_10026554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1715 | Open in IMG/M |
3300006805|Ga0075464_10268840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1022 | Open in IMG/M |
3300007542|Ga0099846_1211525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300007636|Ga0102856_1051906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300007973|Ga0105746_1021108 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 1934 | Open in IMG/M |
3300007974|Ga0105747_1087599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300008108|Ga0114341_10528075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300008113|Ga0114346_1290713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300008117|Ga0114351_1146398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1307 | Open in IMG/M |
3300008120|Ga0114355_1214017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300008264|Ga0114353_1157589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1131 | Open in IMG/M |
3300008265|Ga0114361_1043842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1440 | Open in IMG/M |
3300008266|Ga0114363_1106314 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
3300008267|Ga0114364_1005846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9075 | Open in IMG/M |
3300008267|Ga0114364_1057296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1367 | Open in IMG/M |
3300008448|Ga0114876_1156483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
3300008448|Ga0114876_1165598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300008450|Ga0114880_1051425 | All Organisms → Viruses → Predicted Viral | 1740 | Open in IMG/M |
3300009026|Ga0102829_1202558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300009068|Ga0114973_10336518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300009111|Ga0115026_11112370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300009158|Ga0114977_10005211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8262 | Open in IMG/M |
3300009181|Ga0114969_10034199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3492 | Open in IMG/M |
3300009183|Ga0114974_10026103 | Not Available | 4080 | Open in IMG/M |
3300009419|Ga0114982_1016433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2512 | Open in IMG/M |
3300010160|Ga0114967_10303604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300013004|Ga0164293_10935134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300013006|Ga0164294_10851426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300013372|Ga0177922_10142611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
3300013372|Ga0177922_10413129 | All Organisms → Viruses → Predicted Viral | 2932 | Open in IMG/M |
3300013372|Ga0177922_10786655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300017716|Ga0181350_1089958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300017716|Ga0181350_1160198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300017722|Ga0181347_1047623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
3300017722|Ga0181347_1074867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
3300017722|Ga0181347_1101580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
3300017723|Ga0181362_1067896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300017736|Ga0181365_1038357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1206 | Open in IMG/M |
3300017736|Ga0181365_1088715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300017736|Ga0181365_1110965 | Not Available | 660 | Open in IMG/M |
3300017747|Ga0181352_1078043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
3300017761|Ga0181356_1187338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300017761|Ga0181356_1211911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300017761|Ga0181356_1235259 | Not Available | 527 | Open in IMG/M |
3300017761|Ga0181356_1249896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300017774|Ga0181358_1202154 | Not Available | 649 | Open in IMG/M |
3300017774|Ga0181358_1210886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300017777|Ga0181357_1256037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300017777|Ga0181357_1338043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300017778|Ga0181349_1072010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1325 | Open in IMG/M |
3300017778|Ga0181349_1161263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300017778|Ga0181349_1243303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300017780|Ga0181346_1004647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5984 | Open in IMG/M |
3300017780|Ga0181346_1165688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300017780|Ga0181346_1200104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300017780|Ga0181346_1272894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300017784|Ga0181348_1061669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Azotobacter group → Azotobacter → Azotobacter chroococcum | 1516 | Open in IMG/M |
3300017784|Ga0181348_1113363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1047 | Open in IMG/M |
3300017784|Ga0181348_1140155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
3300017784|Ga0181348_1181372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300017784|Ga0181348_1306911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300017785|Ga0181355_1360324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300017785|Ga0181355_1396350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300019784|Ga0181359_1022887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2377 | Open in IMG/M |
3300019784|Ga0181359_1029663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2107 | Open in IMG/M |
3300019784|Ga0181359_1136345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
3300019784|Ga0181359_1140461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
3300019784|Ga0181359_1151784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300019784|Ga0181359_1152675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300019784|Ga0181359_1188840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
3300019784|Ga0181359_1204429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300019784|Ga0181359_1208756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300020530|Ga0208235_1028534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300022190|Ga0181354_1011572 | All Organisms → Viruses → Predicted Viral | 2619 | Open in IMG/M |
3300022190|Ga0181354_1048635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1411 | Open in IMG/M |
3300022190|Ga0181354_1066154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1200 | Open in IMG/M |
3300022190|Ga0181354_1099823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
3300022190|Ga0181354_1149324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300022190|Ga0181354_1181492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300022407|Ga0181351_1017304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3026 | Open in IMG/M |
3300022407|Ga0181351_1179768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
3300022407|Ga0181351_1189623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300022407|Ga0181351_1204109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300022407|Ga0181351_1254512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300024346|Ga0244775_10000814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37928 | Open in IMG/M |
3300024346|Ga0244775_11180565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300024348|Ga0244776_10014839 | Not Available | 6587 | Open in IMG/M |
3300027563|Ga0209552_1031544 | All Organisms → Viruses → Predicted Viral | 1556 | Open in IMG/M |
3300027586|Ga0208966_1115977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300027608|Ga0208974_1004796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4708 | Open in IMG/M |
3300027631|Ga0208133_1093751 | Not Available | 703 | Open in IMG/M |
3300027644|Ga0209356_1065810 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
3300027656|Ga0209357_1042570 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
3300027659|Ga0208975_1004343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5325 | Open in IMG/M |
3300027659|Ga0208975_1053573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1234 | Open in IMG/M |
3300027659|Ga0208975_1097507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
3300027659|Ga0208975_1107104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
3300027659|Ga0208975_1116524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300027679|Ga0209769_1044485 | All Organisms → Viruses → Predicted Viral | 1509 | Open in IMG/M |
3300027732|Ga0209442_1266509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300027772|Ga0209768_10010177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5393 | Open in IMG/M |
3300027785|Ga0209246_10004857 | All Organisms → Viruses → Predicted Viral | 4994 | Open in IMG/M |
3300027785|Ga0209246_10299875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300027798|Ga0209353_10013582 | All Organisms → Viruses → Predicted Viral | 3901 | Open in IMG/M |
3300027798|Ga0209353_10091464 | All Organisms → Viruses → Predicted Viral | 1377 | Open in IMG/M |
3300027798|Ga0209353_10100891 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
3300027798|Ga0209353_10143566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
3300027798|Ga0209353_10245534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300027808|Ga0209354_10028529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2228 | Open in IMG/M |
3300027808|Ga0209354_10051823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1655 | Open in IMG/M |
3300027808|Ga0209354_10059492 | Not Available | 1545 | Open in IMG/M |
3300027808|Ga0209354_10380573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300027836|Ga0209230_10329904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300027892|Ga0209550_10053512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3245 | Open in IMG/M |
3300027969|Ga0209191_1024227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2972 | Open in IMG/M |
3300028025|Ga0247723_1088838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300031758|Ga0315907_10223430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1570 | Open in IMG/M |
3300031857|Ga0315909_10044198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4184 | Open in IMG/M |
3300031857|Ga0315909_10642998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300032050|Ga0315906_10355539 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
3300032053|Ga0315284_10341958 | All Organisms → Viruses → Predicted Viral | 1868 | Open in IMG/M |
3300032092|Ga0315905_10168281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2175 | Open in IMG/M |
3300033233|Ga0334722_11191401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300033992|Ga0334992_0050432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2372 | Open in IMG/M |
3300034068|Ga0334990_0399385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300034093|Ga0335012_0319998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300034120|Ga0335056_0003130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11832 | Open in IMG/M |
3300034120|Ga0335056_0108518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1698 | Open in IMG/M |
3300034122|Ga0335060_0451514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300034283|Ga0335007_0673773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 52.00% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 10.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.00% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.00% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.33% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.67% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.00% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.00% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.33% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.33% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.33% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.33% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.33% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.67% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.67% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.67% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24768J34885_100847144 | 3300002447 | Freshwater And Sediment | MFFTLVASSKEKYRCVKWAWTGDVYNRKVVCLEWQKVERK* |
JGI25909J50240_10301102 | 3300003393 | Freshwater Lake | VLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR* |
JGI25909J50240_10954291 | 3300003393 | Freshwater Lake | MLFTLVASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
JGI25909J50240_11059702 | 3300003393 | Freshwater Lake | MFFTLVASSKEKYRCVKWAWTGDVYNRKVVCLEWQKVDRK* |
JGI25911J50253_101393562 | 3300003411 | Freshwater Lake | GYDVKWLLVLSMFFTLVASSKEKYRCVKWAWTGDVYNRKVVCLEWQKVDRK* |
JGI25912J50252_101510852 | 3300003412 | Freshwater Lake | KWLLMLSVLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
JGI25923J51411_10327524 | 3300003493 | Freshwater Lake | MVLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDK |
Ga0063232_100297144 | 3300004054 | Freshwater Lake | SILFTLVASSKEKTEYRCVRWAWTGDVYNRNVVCLEWQKVDKK* |
Ga0066181_101342001 | 3300004123 | Freshwater Lake | VKWLLVLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR* |
Ga0049081_100479232 | 3300005581 | Freshwater Lentic | MLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWKKVEKK* |
Ga0049081_100998862 | 3300005581 | Freshwater Lentic | MLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0049081_101405761 | 3300005581 | Freshwater Lentic | MLSILFTLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDK |
Ga0049081_101408461 | 3300005581 | Freshwater Lentic | SNKEKKPEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0049081_101792301 | 3300005581 | Freshwater Lentic | VVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0049081_101879002 | 3300005581 | Freshwater Lentic | MLSMLITLVASSKEKTEYRCVRWAWTGDVYNRNVVCLEWKKVEKK* |
Ga0049080_100231753 | 3300005582 | Freshwater Lentic | MLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQ |
Ga0049082_100400205 | 3300005584 | Freshwater Lentic | ASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0074471_109457412 | 3300005831 | Sediment (Intertidal) | MLFTLEASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR* |
Ga0074469_107227762 | 3300005832 | Sediment (Intertidal) | FTLVASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0073913_100922732 | 3300005940 | Sand | LGYAVKWLVVLSILFTLVASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0070744_100265542 | 3300006484 | Estuarine | MLLTLVASSKEKTEYRCVKWAWTGDVYNRKVFCLKWEKVERK* |
Ga0075464_102688401 | 3300006805 | Aqueous | LLMSSILFTLGASSKDKNEYRSVRWAWEGGVYNRKVVCLEWQKVDKR* |
Ga0099846_12115252 | 3300007542 | Aqueous | LVLSVLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR* |
Ga0102856_10519062 | 3300007636 | Estuarine | VSVKWLLMLSMFVILVASSEDKYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0105746_10211083 | 3300007973 | Estuary Water | MLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDK |
Ga0105747_10875991 | 3300007974 | Estuary Water | SSQQDKKTEYRCVRWTWTGDVYSRKVWCLEWKKIEK* |
Ga0114341_105280752 | 3300008108 | Freshwater, Plankton | ASSKEKYRCVKWAWTGDVYNRKVVCLEWQKVERK* |
Ga0114346_12907133 | 3300008113 | Freshwater, Plankton | MLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKV |
Ga0114351_11463984 | 3300008117 | Freshwater, Plankton | LLVLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVRR* |
Ga0114355_12140171 | 3300008120 | Freshwater, Plankton | MVFLHHRLGYDVKWLLVLSTLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVEKK* |
Ga0114353_11575891 | 3300008264 | Freshwater, Plankton | RLGYDVKWLLVLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVEKK* |
Ga0114361_10438421 | 3300008265 | Freshwater, Plankton | RLVFLHHRLGYDVRWLLVLSMFFTLVASSKEKYRCVKWAWTGDVYNRKVVCLEWQKVERK |
Ga0114363_11063141 | 3300008266 | Freshwater, Plankton | VKWLLVLSTLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR* |
Ga0114364_10058463 | 3300008267 | Freshwater, Plankton | VKWLLVLSVLFTLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR* |
Ga0114364_10572961 | 3300008267 | Freshwater, Plankton | LFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVEKK* |
Ga0114876_11564831 | 3300008448 | Freshwater Lake | VLSTLITLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVGKK* |
Ga0114876_11655983 | 3300008448 | Freshwater Lake | SLGDAVKWLLMLSMLFTLVASSKEKAEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0114880_10514251 | 3300008450 | Freshwater Lake | VFLHHRLGYDVKWLLVLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQK |
Ga0102829_12025581 | 3300009026 | Estuarine | VLSMLLTLVASSKEKTEYRCVKWAWTGDVYNRKVFCLKWEKVERK* |
Ga0114973_103365181 | 3300009068 | Freshwater Lake | SSQDKKTEYRCVRWAWTGDVYNRKVVCLQWEKVERK* |
Ga0115026_111123702 | 3300009111 | Wetland | VFLHHRLGYDVKWLLVLSMFFTLVASSKEKYRCVKWAWTGDVYNRKVVCLEWQKVDRK* |
Ga0114977_100052115 | 3300009158 | Freshwater Lake | MLSMFVILVASSEDKYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0114969_100341993 | 3300009181 | Freshwater Lake | VKWILVLAMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0114974_100261033 | 3300009183 | Freshwater Lake | MLSMFVILVTSSEDKYRCIRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0114982_10164331 | 3300009419 | Deep Subsurface | CHSLGYAVRWLIMLSILFTLVASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0114967_103036042 | 3300010160 | Freshwater Lake | MLSMFVILVASSEDKYRCVRWAWTGDVYNRKVVCLEWQKVEKK* |
Ga0164293_109351341 | 3300013004 | Freshwater | MKWLLVLFLLFSPEVSNKEKKPEYRCVRWSWSGDVYNRRVVCLEW |
Ga0164294_108514262 | 3300013006 | Freshwater | MLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0177922_101426112 | 3300013372 | Freshwater | LFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0177922_104131296 | 3300013372 | Freshwater | VFLHHRLGYDVKWLLVLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVEK |
Ga0177922_107866552 | 3300013372 | Freshwater | VSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
Ga0181350_10899583 | 3300017716 | Freshwater Lake | LVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181350_11601981 | 3300017716 | Freshwater Lake | LGYDVRWLLVLSMFFTLVASSKEKYRCVKWAWTGDVYNRKVVCLEWQKVDRK |
Ga0181347_10476231 | 3300017722 | Freshwater Lake | LVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVEKK |
Ga0181347_10748673 | 3300017722 | Freshwater Lake | LFTLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181347_11015803 | 3300017722 | Freshwater Lake | SVLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181362_10678961 | 3300017723 | Freshwater Lake | ILHHRLGYDVKWLLVLSMFFTLVASSKEKYRCVKWAWTGDVYNRKVVCLEWQKVDRK |
Ga0181365_10383572 | 3300017736 | Freshwater Lake | MLFTLVASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181365_10887152 | 3300017736 | Freshwater Lake | CLGVPVKWILVLSMLFTLVASSKEKAEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181365_11109652 | 3300017736 | Freshwater Lake | KVLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181352_10780433 | 3300017747 | Freshwater Lake | LILTAFLFLPIAAGKDKTEYRCVRWMWSGDVYNRKVVCLEWKKVERK |
Ga0181356_11873382 | 3300017761 | Freshwater Lake | LFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKIDKK |
Ga0181356_12119111 | 3300017761 | Freshwater Lake | MLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVD |
Ga0181356_12352591 | 3300017761 | Freshwater Lake | LGDAVKWLLVLSMLFTLVASSKEKTEYRCVRWAWTGDVYN |
Ga0181356_12498961 | 3300017761 | Freshwater Lake | VKWILVLSILFTLVASSKEKAEYRCVRWAWTGDVYNRKVVCLEWQKVDKR |
Ga0181358_12021541 | 3300017774 | Freshwater Lake | VKWLLVLSILFTLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLE |
Ga0181358_12108862 | 3300017774 | Freshwater Lake | VLSVLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKIDKK |
Ga0181357_12560372 | 3300017777 | Freshwater Lake | FTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKIDKK |
Ga0181357_13380432 | 3300017777 | Freshwater Lake | VFLHHRLGYDVKWLLVLSMLFTLVASSKEKTEYRCVRWVWTGDVYNRKVVCLEWQKVEKK |
Ga0181349_10720102 | 3300017778 | Freshwater Lake | MLSILFTLVVSSKEKTEYRCVRWAWTGDVYNRNVVCLEWQKVEKK |
Ga0181349_11612634 | 3300017778 | Freshwater Lake | MLFTLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181349_12433032 | 3300017778 | Freshwater Lake | FTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVEKK |
Ga0181346_100464711 | 3300017780 | Freshwater Lake | VRCLILTAFLFLPIAVSKDKAEYRCVRWSWTGDVYNRKVICLEWKKVERK |
Ga0181346_11656883 | 3300017780 | Freshwater Lake | LFTLVASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVEKK |
Ga0181346_12001042 | 3300017780 | Freshwater Lake | MSSMLFTLVASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVEKK |
Ga0181346_12728943 | 3300017780 | Freshwater Lake | VFLHHHLGYVVKWLLMLSILFTLVASSKEKYRCVKWAWTGDVYNRKVVCLEWQKVDRK |
Ga0181348_10616693 | 3300017784 | Freshwater Lake | VFLHHRLGYVVKWLLVLSILFTLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181348_11133631 | 3300017784 | Freshwater Lake | GYDVKWLLMLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181348_11401553 | 3300017784 | Freshwater Lake | FTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR |
Ga0181348_11813723 | 3300017784 | Freshwater Lake | MLSVLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181348_13069112 | 3300017784 | Freshwater Lake | LGNAVKWLLMSSILFTLVASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVEKK |
Ga0181355_13603242 | 3300017785 | Freshwater Lake | VKWLLVLSILFTLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181355_13963502 | 3300017785 | Freshwater Lake | AVKWLMVLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR |
Ga0181359_10228873 | 3300019784 | Freshwater Lake | VFLHHRLGYGVKWLLVLSTLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVEKK |
Ga0181359_10296632 | 3300019784 | Freshwater Lake | LGDAVKWLLVLSMLVTLVASSKEKTEYRCVRWAWTGDVYNRKVICLEWQKVEKK |
Ga0181359_11363451 | 3300019784 | Freshwater Lake | VVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181359_11404612 | 3300019784 | Freshwater Lake | MSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR |
Ga0181359_11517842 | 3300019784 | Freshwater Lake | VLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR |
Ga0181359_11526751 | 3300019784 | Freshwater Lake | MLSMLVTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVEKKFL |
Ga0181359_11888401 | 3300019784 | Freshwater Lake | TLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKIDKK |
Ga0181359_12044292 | 3300019784 | Freshwater Lake | VFLHHRLGYDVKWLLVLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181359_12087561 | 3300019784 | Freshwater Lake | MLFTLVASSKEKAEYRCVRWAWTGDVYNRKVVCLEWQKVDK |
Ga0208235_10285341 | 3300020530 | Freshwater | SSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
Ga0181354_10115721 | 3300022190 | Freshwater Lake | GDAVKWLMVLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR |
Ga0181354_10486351 | 3300022190 | Freshwater Lake | SILFTLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181354_10661541 | 3300022190 | Freshwater Lake | LGVPVKWILVLAMLFTLVASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181354_10998231 | 3300022190 | Freshwater Lake | ASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181354_11493244 | 3300022190 | Freshwater Lake | LGDGVKWLLVLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181354_11814921 | 3300022190 | Freshwater Lake | MLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDK |
Ga0181351_10173045 | 3300022407 | Freshwater Lake | VFLHHRLGYGVKWLLVLSTLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181351_11797681 | 3300022407 | Freshwater Lake | VSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181351_11896231 | 3300022407 | Freshwater Lake | ITLVASSKEKTEYRCIKWTWTGDVFNRKVVCLEWKKVEKR |
Ga0181351_12041091 | 3300022407 | Freshwater Lake | VPVKWILVLSILFTLVASSKEKAEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0181351_12545121 | 3300022407 | Freshwater Lake | MLSILFTLVASSKEKYRCVKWAWTGDVYNRKVVCLEWQKVDR |
Ga0244775_1000081461 | 3300024346 | Estuarine | MSSLLFTLVASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVDK |
Ga0244775_111805652 | 3300024346 | Estuarine | TLVASSKEKTEYRCVRWAWTGDVYSRKVVCLEWQKVDKR |
Ga0244776_100148394 | 3300024348 | Estuarine | MLSMFVILVASSEDKYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0209552_10315441 | 3300027563 | Freshwater Lake | MVLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVV |
Ga0208966_11159772 | 3300027586 | Freshwater Lentic | SMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0208974_10047962 | 3300027608 | Freshwater Lentic | MKWLLVLFLLFSPEVSNKEKKPEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0208133_10937513 | 3300027631 | Estuarine | SILFTLVASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR |
Ga0209356_10658102 | 3300027644 | Freshwater Lake | MLSVLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDK |
Ga0209357_10425704 | 3300027656 | Freshwater Lake | SILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR |
Ga0208975_10043435 | 3300027659 | Freshwater Lentic | MSSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQ |
Ga0208975_10535731 | 3300027659 | Freshwater Lentic | PEVSNKEKKPEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0208975_10975072 | 3300027659 | Freshwater Lentic | VKWLLVLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQ |
Ga0208975_11071041 | 3300027659 | Freshwater Lentic | YDVKWLLVLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0208975_11165242 | 3300027659 | Freshwater Lentic | LHRCLGYDVRWLLVLSMFFTLVASSKEKYRCVKWAWTGDVYNRKVVCLEWQKVDRK |
Ga0209769_10444853 | 3300027679 | Freshwater Lake | MLSILFTLVASSKEKTEYRCVRWAWTGDVYNRNVVCLEWQKVDKK |
Ga0209442_12665091 | 3300027732 | Freshwater Lake | WLLVLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0209768_100101771 | 3300027772 | Freshwater Lake | YDVKWLLMLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVEKK |
Ga0209246_100048571 | 3300027785 | Freshwater Lake | VFLHHRLGYDVKWLLVLSILFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0209246_102998751 | 3300027785 | Freshwater Lake | LFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0209353_100135828 | 3300027798 | Freshwater Lake | SSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0209353_100914644 | 3300027798 | Freshwater Lake | LGYDVKWLLVLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0209353_101008913 | 3300027798 | Freshwater Lake | SLGDAVKWLLVLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR |
Ga0209353_101435663 | 3300027798 | Freshwater Lake | LVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0209353_102455341 | 3300027798 | Freshwater Lake | LSVLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0209354_100285292 | 3300027808 | Freshwater Lake | VKWLLVLSMLFTLVASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0209354_100518231 | 3300027808 | Freshwater Lake | ILFTLVASSKEKTEYRCVRWVWTGDVYNRKVVCLEWQKVEKK |
Ga0209354_100594921 | 3300027808 | Freshwater Lake | LFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVEKK |
Ga0209354_103805731 | 3300027808 | Freshwater Lake | VKWLLVLSILFTLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDK |
Ga0209230_103299043 | 3300027836 | Freshwater And Sediment | LVLSMFFTLVASSKEKYRCVRWAWTGDVYNRKVVCLEWQKVERK |
Ga0209550_100535121 | 3300027892 | Freshwater Lake | VASSKEKTEYRCVRWAWTGDVYNRNVVCLEWQKVDKK |
Ga0209191_10242272 | 3300027969 | Freshwater Lake | MLSMFVILVASSENKYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0247723_10888383 | 3300028025 | Deep Subsurface Sediment | SLGVSVRWLIMLSILFTLVASSKDKTEYRCVKWAWTGDVYNRKVVCLEWQKVDKR |
Ga0315907_102234301 | 3300031758 | Freshwater | VFLHHRLGYDVKWLLVLSMFFTLVASSKEKYRCVRWTWTGDVYNRKVVCLEWQKVERK |
Ga0315909_100441981 | 3300031857 | Freshwater | VFLHHRLGYDVKWLLVLSMFFTLVASSKEKYRCVRWAWTGDVYNRKVVCLEWQK |
Ga0315909_106429982 | 3300031857 | Freshwater | FTLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
Ga0315906_103555395 | 3300032050 | Freshwater | MVFLHHRLGYDVKWLLVLSTLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVEK |
Ga0315284_103419581 | 3300032053 | Sediment | LHYSLGIPVKWLLMLSMLFTLVASSKEKTEYRCVRWAWTGDVYDRKVVCLEWKKVEKK |
Ga0315905_101682813 | 3300032092 | Freshwater | LGDAVKWLLVLSMLVTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0334722_111914012 | 3300033233 | Sediment | FITQHPLGDAVKWLIILPIFFTLLASSQEKKTEYRCVRWAWTGDVYNRKVVCLQWEKVER |
Ga0334992_0050432_2_127 | 3300033992 | Freshwater | LFTLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR |
Ga0334990_0399385_136_291 | 3300034068 | Freshwater | MKWLLVLFFLFSPEVSNKEKKPEYRCVRWSWTGDVYNRRVVCLEWQKVDKK |
Ga0335012_0319998_1_120 | 3300034093 | Freshwater | TLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0335056_0003130_6785_6922 | 3300034120 | Freshwater | MLSMLFTLVASSKDKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKK |
Ga0335056_0108518_1_135 | 3300034120 | Freshwater | LSVLFTLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVDKR |
Ga0335060_0451514_2_145 | 3300034122 | Freshwater | ILVLSMLFTLVVSSKEKAEYRCVRWAWTGDVYNRKVVCLEWQKVDKR |
Ga0335007_0673773_2_151 | 3300034283 | Freshwater | KWLLMLSMLFTLVASSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVEKK |
⦗Top⦘ |