NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047037

Metagenome / Metatranscriptome Family F047037

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047037
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 43 residues
Representative Sequence MRRAIQDATACREALARLPELDLGELRQQWRALYKADASPHLSREL
Number of Associated Samples 131
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 92.67 %
% of genes near scaffold ends (potentially truncated) 98.67 %
% of genes from short scaffolds (< 2000 bps) 95.33 %
Associated GOLD sequencing projects 126
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.333 % of family members)
Environment Ontology (ENVO) Unclassified
(26.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(64.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.65%    β-sheet: 0.00%    Coil/Unstructured: 51.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF11994DUF3489 90.67
PF01979Amidohydro_1 1.33
PF00589Phage_integrase 1.33
PF07992Pyr_redox_2 0.67
PF13276HTH_21 0.67
PF13924Lipocalin_5 0.67
PF13737DDE_Tnp_1_5 0.67
PF13683rve_3 0.67
PF07506RepB 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG1475Chromosome segregation protein Spo0J, contains ParB-like nuclease domainCell cycle control, cell division, chromosome partitioning [D] 0.67

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.67 %
UnclassifiedrootN/A1.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2040502001|FACENC_GAMC6GA01BR7FOAll Organisms → cellular organisms → Bacteria502Open in IMG/M
3300001867|JGI12627J18819_10487103All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300004103|Ga0058903_1473771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300004268|Ga0066398_10225113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300005175|Ga0066673_10565171All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300005179|Ga0066684_10811662All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005187|Ga0066675_11080903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria600Open in IMG/M
3300005332|Ga0066388_104620824All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300005435|Ga0070714_101237062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria728Open in IMG/M
3300005546|Ga0070696_100895430All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300005546|Ga0070696_101946724All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005554|Ga0066661_10876919All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005561|Ga0066699_11104263All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300005566|Ga0066693_10062447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae1273Open in IMG/M
3300005574|Ga0066694_10378317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria668Open in IMG/M
3300005575|Ga0066702_10604091All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300005576|Ga0066708_10625762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria688Open in IMG/M
3300005598|Ga0066706_10822037All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300006031|Ga0066651_10700943All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria544Open in IMG/M
3300006032|Ga0066696_10480368All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300006574|Ga0074056_11712449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria567Open in IMG/M
3300006755|Ga0079222_10400242All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300006755|Ga0079222_11880233All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300006755|Ga0079222_12497085All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300006791|Ga0066653_10554105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300006794|Ga0066658_10248762All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300006794|Ga0066658_10702876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria559Open in IMG/M
3300006806|Ga0079220_11686911All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300006854|Ga0075425_102283927All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300006871|Ga0075434_100814703All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300006954|Ga0079219_10209770All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300006954|Ga0079219_11319451All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300006954|Ga0079219_12530291All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300007076|Ga0075435_100528691All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1020Open in IMG/M
3300009011|Ga0105251_10261913All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300009100|Ga0075418_11855102Not Available656Open in IMG/M
3300009100|Ga0075418_12625699All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300009101|Ga0105247_10478962All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300009143|Ga0099792_10995857All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300009162|Ga0075423_13054356All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300009553|Ga0105249_11703630All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium703Open in IMG/M
3300010159|Ga0099796_10524372All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300010359|Ga0126376_11596630All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300010361|Ga0126378_12670706All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300010373|Ga0134128_10708144All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300010375|Ga0105239_10890027All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300010376|Ga0126381_104768113All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300010398|Ga0126383_10377401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1447Open in IMG/M
3300010401|Ga0134121_10934360All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300012056|Ga0153925_1024738All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300012212|Ga0150985_107362989All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300012285|Ga0137370_10642512All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300012361|Ga0137360_11569150All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300012469|Ga0150984_118214377All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300012582|Ga0137358_10948581All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300012977|Ga0134087_10485952All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300012984|Ga0164309_10483510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium944Open in IMG/M
3300012985|Ga0164308_10828280All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300012989|Ga0164305_11594337All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300015077|Ga0173483_10390304All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300015372|Ga0132256_101607045All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300018433|Ga0066667_10521956All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300018468|Ga0066662_10791827All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300018468|Ga0066662_11930898All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300018482|Ga0066669_12004354All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300020022|Ga0193733_1170232All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300020140|Ga0179590_1181156All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300020579|Ga0210407_10780963All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300020579|Ga0210407_11222030All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300020580|Ga0210403_10034883All Organisms → cellular organisms → Bacteria4021Open in IMG/M
3300020580|Ga0210403_10779120All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300021168|Ga0210406_10430405All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300021178|Ga0210408_10087262All Organisms → cellular organisms → Bacteria → Proteobacteria2449Open in IMG/M
3300021178|Ga0210408_10391490All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300021178|Ga0210408_10488361All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300021178|Ga0210408_10641418All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300021362|Ga0213882_10207621All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300021384|Ga0213876_10754521All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300021404|Ga0210389_10830083All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300021432|Ga0210384_11188649All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300021432|Ga0210384_11257330All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300021474|Ga0210390_11585460All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300021478|Ga0210402_10672588All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300021560|Ga0126371_11087986Not Available939Open in IMG/M
3300022529|Ga0242668_1008141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1342Open in IMG/M
3300023056|Ga0233357_1008375All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300025901|Ga0207688_10277375All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300025908|Ga0207643_10345187All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300025915|Ga0207693_11042664All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300025916|Ga0207663_10112048All Organisms → cellular organisms → Bacteria1853Open in IMG/M
3300025929|Ga0207664_10754522All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300026088|Ga0207641_11310869All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300026312|Ga0209153_1269909All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300026316|Ga0209155_1145093All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300026320|Ga0209131_1272797All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300026322|Ga0209687_1063478All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300026345|Ga0257148_1009468All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300026497|Ga0257164_1076112All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300026515|Ga0257158_1054321All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300026547|Ga0209156_10307290All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300026547|Ga0209156_10416481All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300026551|Ga0209648_10395442All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300026552|Ga0209577_10065997All Organisms → cellular organisms → Bacteria3008Open in IMG/M
3300026557|Ga0179587_10603367All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300027104|Ga0208095_1009497All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300027521|Ga0209524_1017479All Organisms → cellular organisms → Bacteria1472Open in IMG/M
3300027537|Ga0209419_1057622All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300027603|Ga0209331_1053365All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300027646|Ga0209466_1085085All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300027667|Ga0209009_1066645All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300027698|Ga0209446_1106973All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300027701|Ga0209447_10053811All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300027703|Ga0207862_1090566All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300027729|Ga0209248_10202297All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300027737|Ga0209038_10122135All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300027737|Ga0209038_10251958All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300027765|Ga0209073_10426839All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300027767|Ga0209655_10005722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium4273Open in IMG/M
3300027768|Ga0209772_10012516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2342Open in IMG/M
3300027768|Ga0209772_10051236All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300027855|Ga0209693_10089912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1518Open in IMG/M
3300027889|Ga0209380_10017720All Organisms → cellular organisms → Bacteria → Proteobacteria4040Open in IMG/M
3300027903|Ga0209488_11113867All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300028047|Ga0209526_10353177All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300029636|Ga0222749_10424639All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300030935|Ga0075401_11803920All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300030973|Ga0075395_11213081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300031057|Ga0170834_108114758All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031231|Ga0170824_126183399All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300031469|Ga0170819_13095719All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300031679|Ga0318561_10299478All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300031715|Ga0307476_11207384All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300031719|Ga0306917_11599562All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300031736|Ga0318501_10503244All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300031768|Ga0318509_10262123All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300031821|Ga0318567_10620447All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300031890|Ga0306925_11755078All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300031893|Ga0318536_10436640All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300031910|Ga0306923_12537582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300031945|Ga0310913_10428878All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300032013|Ga0310906_10853153All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300032051|Ga0318532_10188894All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300032059|Ga0318533_10113586All Organisms → cellular organisms → Bacteria → Proteobacteria1887Open in IMG/M
3300032063|Ga0318504_10166631All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300032261|Ga0306920_100318448All Organisms → cellular organisms → Bacteria2316Open in IMG/M
3300032261|Ga0306920_101793191All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300033289|Ga0310914_11129300All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300033290|Ga0318519_10133684All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300033290|Ga0318519_10519495All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300034268|Ga0372943_0751055All Organisms → cellular organisms → Bacteria645Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.67%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil5.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.33%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.33%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.67%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.33%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.33%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.67%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.67%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.67%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.67%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.67%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.67%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2040502001Soil microbial communities from sample at FACE Site 2 North Carolina CO2+EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300004103Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012056Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ009 MetaGHost-AssociatedOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023056Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026345Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-AEnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes)EnvironmentalOpen in IMG/M
3300027521Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030935Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030973Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCE_22795202040502001SoilMRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASAYLSRELLLRAVAYR
JGI12627J18819_1048710323300001867Forest SoilMSRALRDVGACREALARLPELDLTELRQQWRTLYKSDASRHLS
Ga0058903_147377123300004103Forest SoilMSRAIQDVTACREALARLPQLGLGELRQQWRVLYKAEASAYLSRELLLRAVAY
Ga0066398_1022511323300004268Tropical Forest SoilMSRAIRDATACREAFARLLELDLAELRQQWRALYKTEPSPRLSRELLLRAV
Ga0066673_1056517113300005175SoilMKRGIQDATACREALSRLPTLDIGELRQQWRGLYKTQAPANLSRELL
Ga0066684_1081166223300005179SoilMSRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASAYL
Ga0066675_1108090313300005187SoilMSRATQDAAACREALARLPELDLGELRQQWRALYKAEASPHLSRELL
Ga0066388_10462082423300005332Tropical Forest SoilMSRAIRAATACREAFARLPRLDLGELREHWRALYKTEPSPRLS
Ga0070714_10123706213300005435Agricultural SoilMSRAIQDPAACLEALARLPELDLGALRQQWRTLYKAEASPHLSRELLVRAV
Ga0070696_10089543013300005546Corn, Switchgrass And Miscanthus RhizosphereMRPAIHAAACQEALSGLPELDLGELRQQWRALYKADVSPHLSRE
Ga0070696_10194672413300005546Corn, Switchgrass And Miscanthus RhizosphereMNRALPDATACREALSHLTELNLGELRQQWRALYKAEASPHLSRELLVRAV
Ga0066661_1087691923300005554SoilMKRGIQDATACREALSRLPTLDIGELRQQWRGLYKTQAP
Ga0066699_1110426323300005561SoilMRRAIQDVTACREALLRLPKLGLGELRRQWRVLYKAEASPYLSRELLLRAVAY
Ga0066693_1006244733300005566SoilMSRAIQDATACREALSRLPQLDLGELRQQWRTLYKANASPHLSRELLLRA
Ga0066694_1037831723300005574SoilMSRAVRDVAICREALARLPELSLSELRQQWRTLYKFDASPHLSRELLLRAV
Ga0066702_1060409113300005575SoilMSRSIKDATACREALARLPELELSELRQHWRALYKSDASPHLSRELLVRA
Ga0066708_1062576213300005576SoilMSRTVRDVAICREALARLPELALSELRQQWRTLYKSEASPHLSRELL
Ga0066706_1082203723300005598SoilMSRALRDVRVCQEALARLPELALSELRQQWRALYKS
Ga0066651_1070094323300006031SoilMRRAIQDATACGEALARLPELDLGELRQQWRALYKADASPHLSRELLVR
Ga0066696_1048036833300006032SoilMSRVLQDATVRREALARLPELNLGELRQQWRALYKAD
Ga0074056_1171244913300006574SoilMRRAIHDATACREALLRLPKLGLGELRQQWRVLYKAEASPYLSRELLLRAVA
Ga0079222_1040024213300006755Agricultural SoilMKRGIQDATACREALSRLPTLDIGELRQQWRGLYKTQPT
Ga0079222_1188023323300006755Agricultural SoilMSRAIQDATACREVLSRLPKLDLGELRQQWRALYKSE
Ga0079222_1249708513300006755Agricultural SoilMSRAVRDATICREALARLPELALSELRQQWRTLYK
Ga0066653_1055410513300006791SoilMKPRIQDATAYREALSRLPTLDIGELRQQWRGLYKTQAPPNVSRELLLRAV
Ga0066658_1024876213300006794SoilMSRARQNVTDCREALARLPELALSELRQQWRALYKSEASPHLSREL
Ga0066658_1070287623300006794SoilMSRAVRDVAICREALARLREFALSELRQQWRTLYKSEASPHL
Ga0079220_1168691123300006806Agricultural SoilMSRARRNVTGCREALARLPELALSALRQQWRALYKSEASPHLSRELLL
Ga0075425_10228392723300006854Populus RhizosphereMRRAIQDAAACREALARLPELDLGELRQQWRALYKSDASP
Ga0075434_10081470323300006871Populus RhizosphereMSRAIRDATACREAFARLLELDLAELRQQWRALYKTAASP
Ga0079219_1020977033300006954Agricultural SoilMRRAIQDATACGEALARLPELDLGELRRQWRALYKSEASPHL
Ga0079219_1131945133300006954Agricultural SoilMSRALRDVTVCREALARLPELELSELRQQWRALYKS
Ga0079219_1253029113300006954Agricultural SoilMSRTIEDATACREALSRLPELDLGELRQQWRALYKADASPHL
Ga0075435_10052869113300007076Populus RhizosphereMRRPIQDATTCREALARLPELDLGELRQQWRALYKSDASPHLSREL
Ga0105251_1026191323300009011Switchgrass RhizosphereMRHAIQDATPCREALARLPELDLGELRQQWRALYKSEASPHLSRELLVR
Ga0075418_1185510223300009100Populus RhizosphereMRRAIQDATTCREALARLPELDLGELRQQWRALYKSDASP
Ga0075418_1262569913300009100Populus RhizosphereMRRAIQDATPCREALARLPELDLGELREQWRALYKSEASPHLSREL
Ga0105247_1047896213300009101Switchgrass RhizosphereMRRAIHDATACREALLRLPKLGLGELRRQWRVLYKAEASPYLSRELLLRAVAYR
Ga0099792_1099585723300009143Vadose Zone SoilMNRAIQHATACREALSRLPTLEIGELSQQWRALYKAEASPHL
Ga0075423_1305435613300009162Populus RhizosphereMNRQVQIPTACREALSRLPGLELGGLRQQWRALYKNQAPP
Ga0105249_1170363023300009553Switchgrass RhizosphereMSRAIHNAAACREAIARLPELDLGELCRQWRALYKTAASPHLSRELLM
Ga0099796_1052437223300010159Vadose Zone SoilMSRAIQRASACREALARLPELDISELRQQWRALYKA
Ga0126376_1159663023300010359Tropical Forest SoilMSRAIHDATACREALARLPALDLGELRQQWRALYKTAASPHFSREL
Ga0126378_1267070623300010361Tropical Forest SoilMPTAGPEALSRLPELDLSELRQQWRALYKAEASPHL
Ga0134128_1070814413300010373Terrestrial SoilMRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAQASAYLSRELLLRAVAYRM
Ga0105239_1089002713300010375Corn RhizosphereMRRTIHDATACREALARLPELDLGGLRQQWRTLYKAEASPHLSRELLLRAVA
Ga0126381_10476811313300010376Tropical Forest SoilMSRVIQDATACREALARLPELDLGELRQKWRALYKTEP
Ga0126383_1037740143300010398Tropical Forest SoilMSRAIQDATACREALSRLPELDLGELRQRWRALYKADASPHLSRELL
Ga0134121_1093436023300010401Terrestrial SoilMRRAIQDATTCREALARLPELDLGELRQQWRALYKSEASPHLSREL
Ga0153925_102473813300012056Attine Ant Fungus GardensMSRAIHDATACREALSRLPELDLSELRQHWRALYKADASPHLS
Ga0150985_10736298923300012212Avena Fatua RhizosphereMKRGIQDATACREALSRLPTLDIGELRQQWRGLYKTQAPAN
Ga0137370_1064251223300012285Vadose Zone SoilMSRAIHHATGCREALARLPELGLRELRQHWRVLYKTEASPHLSR
Ga0137360_1156915013300012361Vadose Zone SoilMSRAIQDATACREALARLPELDLGALRRQWRAFYKA
Ga0150984_11821437723300012469Avena Fatua RhizosphereMSRALRDVTACREALARLPELALSELRQQWRALYKSDSSPHL
Ga0137358_1094858113300012582Vadose Zone SoilMRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAE
Ga0134087_1048595223300012977Grasslands SoilMSRAVQDATACREALLRLPELNLGELRQRWRILYKTG
Ga0164309_1048351013300012984SoilRAIQDATACREALLRLPKLGLGELRQQWRVLYKAAASPYL*
Ga0164308_1082828013300012985SoilMSRAIQDVTACREALARLPELDLGGVRQQWRTLYKAEASPHLSR
Ga0164305_1159433723300012989SoilMSRALQDATACREALARLPELDLGELRQHWRALYKAEASPHLSRE
Ga0173483_1039030423300015077SoilMRRAIQDATTCGEALTRLPELDLGELRRQWRALYKSEASPHLSREL
Ga0132256_10160704523300015372Arabidopsis RhizosphereMSRTIEDATACREALARLPELDLGELRQRWRTLYKADASPH
Ga0066667_1052195623300018433Grasslands SoilMSRALRDVRVCREALARLPELALSELRQQWRALYKSEASPHLSRELLL
Ga0066662_1079182713300018468Grasslands SoilMSRALRDVRTCREALVRLPQLELRELRQQWRALYKSEA
Ga0066662_1193089813300018468Grasslands SoilMSRAVRDVAICREALARLPELALSELRQQWRTLYKFEASPHLSRE
Ga0066669_1200435423300018482Grasslands SoilMNRAIPDATACREALSGLTELDLGELRQQWRGLYKMEASSHLSRDLLVRAGACRLQ
Ga0193733_117023213300020022SoilMRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASAYLSRELLL
Ga0179590_118115613300020140Vadose Zone SoilMSRAIQDATAWREALARLPELNLRELRQQWRILYKTEASPHLSRELLVRAVA
Ga0210407_1078096313300020579SoilMSRAIHDATACREALARLPKVGLGELRQQWRVLYKAEASPY
Ga0210407_1122203013300020579SoilMRRAIQDATACREALLRLPKLGLGELRQQWRVLYKA
Ga0210403_1003488363300020580SoilMSRAIQDATACRQALLRLPKLGLGELRQQWRVLYKAEAS
Ga0210403_1077912023300020580SoilMSRVIQDATACREALSRLTELNLGELRQRWRILYKTEASLHLSRELLVRA
Ga0210406_1043040513300021168SoilMSRSIKDATACWEALARLPELDLSELRQQCRALYKADAS
Ga0210408_1008726213300021178SoilMSRAIQHATACREALARLPELDLGELRDQWRALYKSDASPHLSRELLLRA
Ga0210408_1039149013300021178SoilMSRAIQDATACREALVRLPELDLGELRQQWRALYKADVSPHL
Ga0210408_1048836123300021178SoilMRRAIHDATACREALLRLPKLGLGELRQQWRTLYKAEASPHLS
Ga0210408_1064141823300021178SoilMRRAIQDATACREALARLPELDLGELRQQWRALYKADASPHLSREL
Ga0213882_1020762113300021362Exposed RockMSRAVRDATACREALSRLPELDLGELRQQWGALYKAEASPHLSRGLL
Ga0213876_1075452123300021384Plant RootsMSRAIQDATSCREALARLPKLSLRELRQQWRVLYKAEASPHLSRELLLRAV
Ga0210389_1083008323300021404SoilMSPAIQDAPACREALSRLAELDLGELRQQWRSLYKAD
Ga0210384_1118864923300021432SoilMRRAIQDATACREALARLPELDLGELRQQWRALYKADASPHLSRELMLRA
Ga0210384_1125733023300021432SoilMSRAIQDATACREALARLPELDLGELRQRWRALYKANASPHLSRELLV
Ga0210390_1158546023300021474SoilMSRAVRDATACREALSRLPKLDLGELRQQWRILYKTEASPHLSRDL
Ga0210402_1067258833300021478SoilMSRAIQDVTACREALARLPELDLGGVRQQWRTLYKAEAS
Ga0126371_1108798623300021560Tropical Forest SoilMSRVIRDATACREAFARLLELDLAELRQQCRVLYK
Ga0242668_100814113300022529SoilMRRAIHDATACREALLRLPKLGLGELRQQWRVLYKAEASA
Ga0233357_100837513300023056SoilMRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASPYLSRELLL
Ga0207688_1027737513300025901Corn, Switchgrass And Miscanthus RhizosphereMNRALPDATACREALSHLTELNLGELRQQWRALYKAEASPHLSRELLGARR
Ga0207643_1034518713300025908Miscanthus RhizosphereMRRAIHDATACREALLRLPKLGLGELRQQWRVLYKAEASAY
Ga0207693_1104266413300025915Corn, Switchgrass And Miscanthus RhizosphereMSRAIQDATACGEALSRLPELNLGELRQKWRTLYKAEASPHLN
Ga0207663_1011204833300025916Corn, Switchgrass And Miscanthus RhizosphereMRRAIQDATTCREALARLPELDLGELRQQWRALYKSEASPHLSRELLVRAV
Ga0207664_1075452213300025929Agricultural SoilMSRALRDVTVCRKALARLPELALSELRQQWRALYKSDAS
Ga0207641_1131086913300026088Switchgrass RhizosphereMRRAIQDATTCRETLARLPELDLGELRQQWRALYKSDVSCGRQS
Ga0209153_126990913300026312SoilMRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASPHLSRELLLR
Ga0209155_114509323300026316SoilMSRALRDVRACREALARLPELALSELRQQWRALYKSEAS
Ga0209131_127279723300026320Grasslands SoilMSRAIQDATACREALSRLPQLDLGALRQEWRALYKAEASPHLSRGLTPMVREIEV
Ga0209687_106347823300026322SoilMSRTIKDVTACREALARLPELDLGELRQQWRALYKADASPHL
Ga0257148_100946823300026345SoilMNRAIPDATACREALSRLTELNLGELRQQWRTLYKAEASPHLSRELLVRAI
Ga0257164_107611223300026497SoilMRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASAYLSRELLLRAVAY
Ga0257158_105432113300026515SoilMNRAIPDATACREALSRLTELNLGELRQQWRTLYKA
Ga0209156_1030729023300026547SoilMSRAIQDATACREALSRLPELNLDELRHQWRTLYKA
Ga0209156_1041648123300026547SoilMRRAIHDATACREALLRLPKLGLGELRQQWRVLYKAAASPCLSRE
Ga0209648_1039544213300026551Grasslands SoilMNRAIPDATACREALSRLTELNLGELRQQWRTLYKAEAS
Ga0209577_1006599753300026552SoilMSRAIQDATACREALSRLPQLDLGELRQEWRALYKAEA
Ga0179587_1060336713300026557Vadose Zone SoilMRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASAY
Ga0208095_100949723300027104Forest SoilMNRAIPDATACREALSRLTELNLGELRQQWRTLYKAEASPHLSRELL
Ga0209524_101747943300027521Forest SoilMSRAIQDATTCREALSRLPQLDLGELRQEWRALYK
Ga0209419_105762213300027537Forest SoilMSRAIHDGTACREALARLPKVGFGELRQQWRTLYKAEASPDLSRELLLRA
Ga0209331_105336533300027603Forest SoilMNRAIPDATACREALSRLTELNLGELRQQWRTLYKAEASPHFS
Ga0209466_108508513300027646Tropical Forest SoilMSRAIEDATACREALSRLPELDLGEIRQRGRALYKADASPHLSRELL
Ga0209009_106664523300027667Forest SoilMRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASP
Ga0209446_110697333300027698Bog Forest SoilMSRAIQDATACREALSRLPDLDLGELRQQWRALYKA
Ga0209447_1005381123300027701Bog Forest SoilMSRAIQDATACRGALARLPQLSLRELRQQWRVLYKA
Ga0207862_109056633300027703Tropical Forest SoilMSRAIHNAAACREALARLPELDLGELRRQWRVLYKTAASPHLS
Ga0209248_1020229713300027729Bog Forest SoilVSPAIPAAACQEALARLPQLDLGELRRQWRALYKTDASPYLSRELMVRAVA
Ga0209038_1012213523300027737Bog Forest SoilMSRAIQDATACREALARLPKLGLRELRQQWRVLYKTEASPHLS
Ga0209038_1025195823300027737Bog Forest SoilMNRGIQDAMACREALSRLPTLDIGELRQQWRGLYKTQAPANLSR
Ga0209073_1042683913300027765Agricultural SoilMRRAIHDATACREALLRLPKLGLGELRQQWRVLYKAEASPH
Ga0209655_1000572273300027767Bog Forest SoilMSRAIQDATGCREALARLPKLGLGELRQQWRVLYWD
Ga0209772_1001251613300027768Bog Forest SoilMSRAIQDTTGCREALVRLPKLGLRELRQHWRVLYKAEASPHLSRE
Ga0209772_1005123633300027768Bog Forest SoilMSRAIQDATGCREALARLPKLGLRELRQHWRVLYKAEASPHLSR
Ga0209693_1008991213300027855SoilMSRAIQDATACREALSRLPQLDLGELRQEWRALYKAEASPHLSGELLVRAVACRPVTP
Ga0209380_1001772013300027889SoilMNRAIPDATACREALSRLPQLDLGELRQEWRALYKAE
Ga0209488_1111386723300027903Vadose Zone SoilMSRAIHDATACREALSRLPELDLSELRQQWRALYK
Ga0209526_1035317733300028047Forest SoilMSRAIQDATACREALSRLPQLDLGELRQEWGALYKAEASPHLSR
Ga0222749_1042463913300029636SoilMRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEAS
Ga0075401_1180392033300030935SoilMRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASPYLSR
Ga0075395_1121308123300030973SoilMRRAIHDATACREALLRLPKLGLGELRQHWRVLYKAEASPYLSRELLLRAVAY
Ga0170834_10811475823300031057Forest SoilMSRAIQDATACREALSRLTALNLGELRQQWRALYKADA
Ga0170824_12618339913300031231Forest SoilMSRAIQDATACREALSRLPELNLGELRQQWRTLYKAEALP
Ga0170819_1309571913300031469Forest SoilMSRAVQDATACREALSRLPELNLGELRQQWRVLYKAEASAY
Ga0318561_1029947823300031679SoilMSRAIHNAAACREALARLPELDLGELRRQWRILYK
Ga0307476_1120738413300031715Hardwood Forest SoilMRRAIHDATACREALLRLPKLGLGELRQQWRVLYKAEASPYLSRELLL
Ga0306917_1159956223300031719SoilMSRTLPDARAYREALARLPTLDLGELRQKWRALDKS
Ga0318501_1050324423300031736SoilMSRAIHNAAACREALARLTELDLGELRRQWRVLYKTAASPH
Ga0318509_1026212333300031768SoilMSRTLPDARAYREALARLPTLDLGELRQKWRALDKSELLV
Ga0318567_1062044713300031821SoilMSRAIPDSTACREALARLPKLDLGELRQHWRALYKADASPHLSRELLLRAVAY
Ga0306925_1175507813300031890SoilMSPVIHAAACQEALARLPKLDRDELRQQWRALYQAEASPHLSREL
Ga0318536_1043664013300031893SoilMSRAIPDSTACREALARLPKLDLGELRQHWRALYKADASPHLSRELLLR
Ga0306923_1253758223300031910SoilMSRAIQDAPACREALARLPELDLGELRQQWRALYK
Ga0310913_1042887823300031945SoilMSRAIPDSTACREALARLPKLDLGELRQHWRALYKADASPHLSRELLL
Ga0310906_1085315313300032013SoilMRRAIQDATACREALARLPELDLGELRQQWRALYKSNA
Ga0318532_1018889423300032051SoilMSRAIHNAAACREALARLPELDLGELRRQWRVLYK
Ga0318533_1011358643300032059SoilMSPVIHAAACQEALARLPKLDRDELRQQWRALYQAEASPHLS
Ga0318504_1016663123300032063SoilMSRAIPDSTACREALARLPKLDLGELRQHWRALYKADAS
Ga0306920_10031844813300032261SoilMSRALPDGKACRETLARLPELDLAELRQQWRALYKS
Ga0306920_10179319123300032261SoilMRRAIQDATACREALLRLPKLGLGELRRQWRALYNAQASPY
Ga0310914_1112930013300033289SoilMSRALPDGKACRETLARLPELDLAELRQQWRALYKSDV
Ga0318519_1013368433300033290SoilMSRAIHNAAACREALARLPELDLGELRRQWRILYKTAA
Ga0318519_1051949523300033290SoilMSPVIHAAACQEALARLPKLDRDELRQQWRALYKAEASPHLSREL
Ga0372943_0751055_1_1233300034268SoilMRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASPY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.