Metagenome / Metatranscriptome Family F047031

Overview

Basic Information

• Family ID: F047031
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 150
• Average Sequence Length: 45 residues
• Representative Sequence: LNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP
• Number of Associated Samples: 134
• Number of Associated Scaffolds: 150

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 3.36 %
• % of genes near scaffold ends (potentially truncated): 93.33 %
• % of genes from short scaffolds (< 2000 bps): 94.00 %
• Associated GOLD sequencing projects: 130
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (64.000 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.333 % of family members)
• Environment Ontology (ENVO): Unclassified (32.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (48.667 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 20.29%
  β-sheet: 0.00%
  Coil/Unstructured: 79.71%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 150 Family Scaffolds
PF02771	Acyl-CoA_dh_N	18.67
PF01075	Glyco_transf_9	8.67
PF07485	DUF1529	6.00
PF00664	ABC_membrane	2.00
PF13505	OMP_b-brl	2.00
PF12697	Abhydrolase_6	2.00
PF09588	YqaJ	1.33
PF02530	Porin_2	1.33
PF01226	Form_Nir_trans	1.33
PF12806	Acyl-CoA_dh_C	0.67
PF00476	DNA_pol_A	0.67
PF13844	Glyco_transf_41	0.67
PF02518	HATPase_c	0.67
PF13683	rve_3	0.67
PF05726	Pirin_C	0.67
PF13467	RHH_4	0.67
PF13005	zf-IS66	0.67
PF03404	Mo-co_dimer	0.67
PF08388	GIIM	0.67
PF01339	CheB_methylest	0.67
PF13565	HTH_32	0.67
PF00078	RVT_1	0.67
PF00293	NUDIX	0.67
PF12071	DUF3551	0.67
PF04392	ABC_sub_bind	0.67
PF03401	TctC	0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 150 Family Scaffolds
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	18.67
COG0859	ADP-heptose:LPS heptosyltransferase	Cell wall/membrane/envelope biogenesis [M]	8.67
COG2116	Formate/nitrite transporter FocA, FNT family	Inorganic ion transport and metabolism [P]	1.33
COG2201	Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains	Signal transduction mechanisms [T]	1.33
COG3637	Opacity protein LomR and related surface antigens	Cell wall/membrane/envelope biogenesis [M]	1.33
COG0749	DNA polymerase I, 3'-5' exonuclease and polymerase domains	Replication, recombination and repair [L]	0.67
COG1741	Redox-sensitive bicupin YhaK, pirin superfamily	General function prediction only [R]	0.67
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.67
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.67

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	64.67 %
Unclassified	root	N/A	35.33 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	64.67 %
Unclassified	root	N/A	35.33 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	64.00 %
Unclassified	root	N/A	35.33 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.67 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	36.00 %
Unclassified	root	N/A	35.33 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	6.00 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.67 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	24.00 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	6.00 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.33 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.67 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	12.00 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	6.00 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	3.33 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	1.33 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.33 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.67 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2.67 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	1.33 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	1.33 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.67 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	0.67 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.67 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.67 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.67 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
unclassified Xanthobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae	1.33 %
Rhodovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum	1.33 %
Massilia group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Hydrogenophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga	0.67 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.67 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.67 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
unclassified Rhodovulum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.67 %
unclassified Hydrogenophaga	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga	0.67 %
Duganella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella	0.67 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
genistoids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
core genistoids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
Genisteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
Lupinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.33 %
Candidatus Sulfobium mesophilum	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	6.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.33 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.00 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.33 %
Xanthobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	1.33 %
Lupinus albus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	0.67 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.67 %
Duganella phyllosphaerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	0.67 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2124908009|FWIRA_GRAM18401DHFKN	All Organisms → cellular organisms → Bacteria	527
2170459021|G14TP7Y02FS8AQ	Not Available	590
3300001164|JGI11823J13286_1000805	Not Available	1941
3300001305|C688J14111_10212442	All Organisms → cellular organisms → Bacteria	602
3300001661|JGI12053J15887_10545890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	552
3300001977|JGI24746J21847_1008833	Not Available	1515
3300002075|JGI24738J21930_10016928	Not Available	1535
3300002076|JGI24749J21850_1029184	All Organisms → cellular organisms → Bacteria	789
3300002155|JGI24033J26618_1018800	Not Available	872
3300002239|JGI24034J26672_10109205	Not Available	527
3300004114|Ga0062593_101892060	Not Available	659
3300004157|Ga0062590_102892054	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	514
3300004480|Ga0062592_100244208	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	1310
3300004643|Ga0062591_102327849	All Organisms → cellular organisms → Bacteria	560
3300005332|Ga0066388_106875922	Not Available	573
3300005355|Ga0070671_102112509	Not Available	502
3300005440|Ga0070705_100993821	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	681
3300005518|Ga0070699_101744225	All Organisms → cellular organisms → Bacteria	570
3300005535|Ga0070684_100755555	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	908
3300005544|Ga0070686_101149895	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	643
3300005548|Ga0070665_100548870	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1168
3300005562|Ga0058697_10583348	Not Available	582
3300005564|Ga0070664_101611925	Not Available	615
3300005764|Ga0066903_100690255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae	1796
3300005764|Ga0066903_102868808	Not Available	935
3300005764|Ga0066903_102979569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	918
3300005842|Ga0068858_100628140	All Organisms → cellular organisms → Bacteria → Proteobacteria	1043
3300005937|Ga0081455_10143841	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1848
3300006042|Ga0075368_10454250	All Organisms → cellular organisms → Bacteria	568
3300006606|Ga0074062_10047339	Not Available	901
3300006844|Ga0075428_100949573	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	911
3300006847|Ga0075431_100905399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	851
3300006847|Ga0075431_101330107	All Organisms → cellular organisms → Bacteria → Proteobacteria	679
3300006852|Ga0075433_11914849	All Organisms → cellular organisms → Bacteria → Proteobacteria	509
3300006871|Ga0075434_102156535	All Organisms → cellular organisms → Bacteria	561
3300006871|Ga0075434_102440536	Not Available	525
3300006904|Ga0075424_102440997	All Organisms → cellular organisms → Bacteria → Proteobacteria	548
3300006953|Ga0074063_10134038	Not Available	618
3300009038|Ga0099829_11426654	Not Available	572
3300009094|Ga0111539_12315930	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	623
3300009100|Ga0075418_10075727	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3581
3300009100|Ga0075418_11241059	All Organisms → cellular organisms → Bacteria	808
3300009147|Ga0114129_13346639	All Organisms → cellular organisms → Bacteria	517
3300009156|Ga0111538_10160008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2860
3300009162|Ga0075423_12794291	All Organisms → cellular organisms → Bacteria	535
3300009162|Ga0075423_13161769	All Organisms → cellular organisms → Bacteria → Proteobacteria	505
3300009174|Ga0105241_10838125	All Organisms → cellular organisms → Bacteria	849
3300009176|Ga0105242_10234969	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1645
3300009176|Ga0105242_12268260	Not Available	589
3300009177|Ga0105248_12518373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	586
3300009792|Ga0126374_11136402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	622
3300010333|Ga0134080_10645396	Not Available	520
3300010358|Ga0126370_12295086	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	534
3300010360|Ga0126372_11155231	All Organisms → cellular organisms → Bacteria → Proteobacteria	796
3300010366|Ga0126379_10948840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	964
3300010366|Ga0126379_11533736	All Organisms → cellular organisms → Bacteria → Proteobacteria	772
3300010373|Ga0134128_12190331	Not Available	609
3300010396|Ga0134126_10592711	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1269
3300010401|Ga0134121_10416420	Not Available	1218
3300010403|Ga0134123_12224435	All Organisms → cellular organisms → Bacteria → Proteobacteria	611
3300011106|Ga0151489_1642992	All Organisms → cellular organisms → Bacteria	1001
3300012198|Ga0137364_10425460	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	995
3300012206|Ga0137380_10251701	All Organisms → cellular organisms → Bacteria	1592
3300012212|Ga0150985_121556208	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium	512
3300012212|Ga0150985_122360833	Not Available	510
3300012356|Ga0137371_10098688	All Organisms → cellular organisms → Bacteria → Proteobacteria	2274
3300012356|Ga0137371_10838364	Not Available	700
3300012683|Ga0137398_10320930	All Organisms → cellular organisms → Bacteria → Proteobacteria	1044
3300012685|Ga0137397_11048013	Not Available	597
3300012885|Ga0157287_1120423	Not Available	509
3300012906|Ga0157295_10020404	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1317
3300012915|Ga0157302_10553286	Not Available	507
3300012924|Ga0137413_10897354	All Organisms → cellular organisms → Bacteria	688
3300012941|Ga0162652_100008984	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1199
3300012944|Ga0137410_11771369	Not Available	545
3300012971|Ga0126369_13240840	All Organisms → cellular organisms → Bacteria → Proteobacteria	533
3300013308|Ga0157375_11268022	Not Available	866
3300013308|Ga0157375_11520792	All Organisms → cellular organisms → Bacteria	790
3300013308|Ga0157375_12277416	All Organisms → cellular organisms → Bacteria	646
3300013308|Ga0157375_12966717	Not Available	567
3300014157|Ga0134078_10057999	All Organisms → cellular organisms → Bacteria → Proteobacteria	1358
3300014325|Ga0163163_10300015	All Organisms → cellular organisms → Bacteria → Proteobacteria	1659
3300014326|Ga0157380_12011050	Not Available	640
3300014968|Ga0157379_10244834	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	1627
3300014969|Ga0157376_11228287	Not Available	778
3300015052|Ga0137411_1382640	Not Available	4787
3300015077|Ga0173483_10299010	Not Available	787
3300015245|Ga0137409_10851836	Not Available	747
3300015245|Ga0137409_10863104	All Organisms → cellular organisms → Bacteria → Proteobacteria	740
3300015371|Ga0132258_14004545	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	1000
3300015374|Ga0132255_102002815	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	881
3300015374|Ga0132255_104195206	Not Available	611
3300018027|Ga0184605_10084154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1390
3300018028|Ga0184608_10334006	Not Available	666
3300018052|Ga0184638_1220094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	663
3300018054|Ga0184621_10001820	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5369
3300018073|Ga0184624_10396014	All Organisms → cellular organisms → Bacteria	613
3300018077|Ga0184633_10201036	Not Available	1029
3300018465|Ga0190269_12010961	Not Available	503
3300018469|Ga0190270_10481235	Not Available	1177
3300019356|Ga0173481_10248592	All Organisms → cellular organisms → Bacteria	799
3300019875|Ga0193701_1107458	Not Available	513
3300019887|Ga0193729_1092889	Not Available	1160
3300020001|Ga0193731_1004047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3749
3300020016|Ga0193696_1061848	All Organisms → cellular organisms → Bacteria	981
3300021510|Ga0222621_1030224	Not Available	1113
3300022694|Ga0222623_10346454	Not Available	568
3300025321|Ga0207656_10273573	Not Available	831
3300025914|Ga0207671_10294233	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1282
3300025915|Ga0207693_10015043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6211
3300025922|Ga0207646_11947136	Not Available	500
3300025926|Ga0207659_11591250	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	558
3300025932|Ga0207690_10897645	All Organisms → cellular organisms → Bacteria	735
3300025949|Ga0207667_10533407	All Organisms → cellular organisms → Bacteria → Proteobacteria	1188
3300025972|Ga0207668_10514704	All Organisms → cellular organisms → Bacteria	1031
3300026023|Ga0207677_11665983	Not Available	591
3300027875|Ga0209283_10243481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1193
3300028380|Ga0268265_10023662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4333
3300028536|Ga0137415_10298310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1416
3300028587|Ga0247828_10575367	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	683
3300028708|Ga0307295_10151336	All Organisms → cellular organisms → Bacteria	644
3300028710|Ga0307322_10114975	Not Available	699
3300028718|Ga0307307_10308272	All Organisms → cellular organisms → Bacteria → Proteobacteria	510
3300028720|Ga0307317_10079203	All Organisms → cellular organisms → Bacteria	1076
3300028754|Ga0307297_10289841	All Organisms → cellular organisms → Bacteria	589
3300028784|Ga0307282_10618480	All Organisms → cellular organisms → Bacteria	525
3300028787|Ga0307323_10354885	Not Available	525
3300028790|Ga0307283_10057054	All Organisms → cellular organisms → Bacteria	944
3300028802|Ga0307503_10376254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	735
3300028811|Ga0307292_10143570	All Organisms → cellular organisms → Bacteria	961
3300028828|Ga0307312_10937531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	574
3300028875|Ga0307289_10182945	All Organisms → cellular organisms → Bacteria	862
3300028880|Ga0307300_10318821	Not Available	530
3300031094|Ga0308199_1157693	All Organisms → cellular organisms → Bacteria	545
3300031854|Ga0310904_10485476	All Organisms → cellular organisms → Bacteria	826
3300031858|Ga0310892_10485834	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	820
3300031890|Ga0306925_10617536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1143
3300031890|Ga0306925_11684976	All Organisms → cellular organisms → Bacteria	613
3300031896|Ga0318551_10211854	Not Available	1075
3300031908|Ga0310900_10163989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1521
3300031912|Ga0306921_11080932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	900
3300032000|Ga0310903_10099250	Not Available	1235
3300032017|Ga0310899_10051805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1506
3300032075|Ga0310890_10526153	Not Available	903
3300032159|Ga0268251_10559287	All Organisms → cellular organisms → Bacteria	520
3300033475|Ga0310811_11091322	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum	679
3300033550|Ga0247829_10646682	All Organisms → cellular organisms → Bacteria	880
3300033551|Ga0247830_10147805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	1714
3300034149|Ga0364929_0080017	Not Available	1015

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	64.00%
Host-Associated	Host-Associated	35.33%
Engineered	Engineered	0.67%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	58.67%
Plants	Host-Associated → Plants	35.33%
Aquatic	Environmental → Aquatic	5.33%
Solid Waste	Engineered → Solid Waste	0.67%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	57.33%
Rhizosphere	Host-Associated → Plants → Rhizosphere	22.00%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.67%
Sediment	Environmental → Aquatic → Sediment	5.33%
Roots	Host-Associated → Plants → Roots	1.33%
Phylloplane	Host-Associated → Plants → Phylloplane	1.33%
Floodplain	Environmental → Terrestrial → Floodplain	0.67%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.67%
Grass	Engineered → Solid Waste → Grass	0.67%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	48.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	17.33%
Loam	Environmental → Terrestrial → Soil → Loam	8.67%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.33%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.33%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.67%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.33%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	1.33%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.67%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.67%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.67%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.67%
Composting	Engineered → Solid Waste → Grass → Composting	0.67%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	37.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	17.33%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.33%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	6.00%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.67%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.00%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.00%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.33%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.67%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.67%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	1.33%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.67%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.67%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.67%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.67%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.67%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.67%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	17.33%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.33%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	9.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	6.00%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.00%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.00%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.67%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.67%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.67%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.67%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	2.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.00%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.00%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.00%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.00%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.33%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.33%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.33%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.33%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.33%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.33%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.33%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.33%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.33%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	1.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.67%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.67%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.67%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.67%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.67%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.67%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.67%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.67%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.67%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.67%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2124908009	Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2	Environmental
2170459021	Litter degradation NP4	Engineered
3300001164	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1	Environmental
3300001305	Grasslands soil microbial communities from Hopland, California, USA	Environmental
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental
3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Host-Associated
3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Host-Associated
3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Host-Associated
3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Host-Associated
3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Host-Associated
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated
3300006042	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Host-Associated
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300011106	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)	Environmental
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental
3300012885	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1	Environmental
3300012906	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1	Environmental
3300012915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2	Environmental
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental
3300012941	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015	Environmental
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015052	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)	Environmental
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental
3300018077	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1	Environmental
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental
3300019875	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2	Environmental
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental
3300020001	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2	Environmental
3300020016	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1	Environmental
3300021510	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex	Environmental
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental
3300028708	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152	Environmental
3300028710	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380	Environmental
3300028718	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194	Environmental
3300028720	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357	Environmental
3300028754	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157	Environmental
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental
3300028787	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381	Environmental
3300028790	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122	Environmental
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental
3300028875	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143	Environmental
3300028880	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181	Environmental
3300031094	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)	Environmental
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental
3300031896	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19	Environmental
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental
3300032159	Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)	Host-Associated
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FWIRA_08252230	2124908009	Soil	VPQLDIGLQVMYTHNNTAYKGPAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP
4NP_03974180	2170459021	Switchgrass, Maize And Mischanthus Litter	PKLDIGLDVTYTGLNTAYKGAAIYAANGSRPAVALLDDQSVWSAMVRWQRNFYP
JGI11823J13286_10008051	3300001164	Forest Soil	TAYKGNAVYGAPQNGSRPAVALIDDQNVWSAMFRWQRNFYP*
C688J14111_102124422	3300001305	Soil	IGLDVTYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
JGI12053J15887_105458902	3300001661	Forest Soil	AYKGPGTYAANGPRPAVTSFDNQGVWSALVRWQRNFYP*
JGI24746J21847_10088332	3300001977	Corn, Switchgrass And Miscanthus Rhizosphere	VPRLDIGLDVTYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
JGI24738J21930_100169282	3300002075	Corn Rhizosphere	YKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
JGI24749J21850_10291842	3300002076	Corn, Switchgrass And Miscanthus Rhizosphere	AAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
JGI24033J26618_10188002	3300002155	Corn, Switchgrass And Miscanthus Rhizosphere	LNTAYKRAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
JGI24034J26672_101092051	3300002239	Corn, Switchgrass And Miscanthus Rhizosphere	GLDVTYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
Ga0062593_1018920602	3300004114	Soil	LDIGLDVTYTGLNTAYKGAAIYAANGSRPAVALLDDQSVWSAMVRWQRNFYP*
Ga0062590_1028920542	3300004157	Soil	QWNPVPKLDIGLDVTYTGLNTAYKGAAIYAANGSRPAVALLDDQGIWSAMVRWQRNFYP*
Ga0062592_1002442081	3300004480	Soil	SHLTSAYKGPGVYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP*
Ga0062591_1023278492	3300004643	Soil	NPVPQLDIGLQVMYTHHNTAYKGPAALAANGSRPAVVDGLIDDQNVWSAMFRWQRNFYP*
Ga0066388_1068759222	3300005332	Tropical Forest Soil	YTGLNTAYKGAGVYAANASRPPVTVFDDQGVWSAMVRWQRNFYP*
Ga0070671_1021125091	3300005355	Switchgrass Rhizosphere	PQLDIGMEILYQHNNTAFKGPATLAANLSRPAVLNGVIDDQNVWSAMFRWQRNFYP*
Ga0070705_1009938212	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MSAYKGPGVYSANTSRPAVALIDDQNVWSAMFRWQRNFYP*
Ga0070699_1017442251	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	GLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
Ga0070684_1007555551	3300005535	Corn Rhizosphere	QLDIGLQVLYSHLTSAYKGPGVYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP*
Ga0070686_1011498951	3300005544	Switchgrass Rhizosphere	IGVDVTYTGLNTAYKGAGIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
Ga0070665_1005488702	3300005548	Switchgrass Rhizosphere	NPVPQLDIGLQVMYTHHNTAYKGAAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP*
Ga0058697_105833482	3300005562	Agave	YKGPGTYAANGSRPAVGLFDDQGIWSAMFRWQRNFYP*
Ga0070664_1016119251	3300005564	Corn Rhizosphere	LDIGLQVMYQHNNTAFKGPAALAANVSRPAVLNGVIDDQNVWSAMFRWQRNFYP*
Ga0066903_1006902551	3300005764	Tropical Forest Soil	GFEVLYSHHNTAYKGPALYTANPAKPAIALVDDQSVWSAIFRWQRNFYP*
Ga0066903_1028688082	3300005764	Tropical Forest Soil	KGPALYTVNLPRPAVPLMDDQSVWTGLFRWQRNFYP*
Ga0066903_1029795692	3300005764	Tropical Forest Soil	LYSQRNTAFKGPGVIPVNGSRPVVQAFDDQGVWSAMVRWQRNFFP*
Ga0068858_1006281401	3300005842	Switchgrass Rhizosphere	TGLNTAYKGAGIYAANGSRPPVALLDDQGVWSAMFRWQRNFYP*
Ga0081455_101438414	3300005937	Tabebuia Heterophylla Rhizosphere	GLEVLYSQRNTAFKGAAIVPASGARPPVLVLDDQGVWSAMFRWQRNFYP*
Ga0075368_104542501	3300006042	Populus Endosphere	DVTYTGLNTAYKGAAIYAANGSRPAVALLDDQGIWSAMVRWQRNFYP*
Ga0074062_100473391	3300006606	Soil	LDIGLDVTYTGLNTAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP*
Ga0075428_1009495732	3300006844	Populus Rhizosphere	GPGTYAVNLPRPALPLFDDQDVWSAFFRWQRNFYP*
Ga0075431_1009053993	3300006847	Populus Rhizosphere	TGLNTAYKGAGVYAANASRPPVFVFDDQGVWSAMVRWQRNFYP*
Ga0075431_1013301071	3300006847	Populus Rhizosphere	WNPVPQLDIGLDVTYTYHNTAYKGAGLYTANAPRPAVALIDDQNVWSAFFRWQRNFYP*
Ga0075433_119148492	3300006852	Populus Rhizosphere	NTAFKGVGIVPANASRPGVFVIDDQDVWSAMVRWQRNFYP*
Ga0075434_1021565352	3300006871	Populus Rhizosphere	NTAYKGAGIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
Ga0075434_1024405361	3300006871	Populus Rhizosphere	VPQLDIGLQVMYTHHNTAYKGPAALAANGSRPAVPVVDGFIDDQNVWSAMFRWQRNFYP*
Ga0075424_1024409972	3300006904	Populus Rhizosphere	TYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
Ga0074063_101340381	3300006953	Soil	KGAAIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
Ga0099829_114266541	3300009038	Vadose Zone Soil	HLNTAYKGVGTTPANGAQPAHTLVDDQNVWSAMFRWQRNFYP*
Ga0111539_123159302	3300009094	Populus Rhizosphere	KGAAVVPASGSRPPVLVIDDQDAWSAMFRWQRNFYP*
Ga0075418_100757274	3300009100	Populus Rhizosphere	FKGPAVVPASGSRPPVFVIDDQDVWSAMVRWQRNFYP*
Ga0075418_112410592	3300009100	Populus Rhizosphere	MRPYTGLNTAYKGAGVYAANASRPAVTVFDDQGVWSAMVRWQRNFYP*
Ga0114129_133466392	3300009147	Populus Rhizosphere	MKRRMRPYTGLNTAYKGAGVYAANASRPAVTVFDDQGVWSAMVRWQRNFYP*
Ga0111538_101600081	3300009156	Populus Rhizosphere	QLDIGLQVMYQHNNTAFKGPATLAANLSRPAVINGIIDDQNVWSAMFRWQRNFYP*
Ga0075423_127942911	3300009162	Populus Rhizosphere	IGVDVTYTGLNTAYKGAGIYAANGSRPPVALLDDQGVWSAMFRWQRNFYP*
Ga0075423_131617691	3300009162	Populus Rhizosphere	FKGNAVVPASGSRPPVFVIDDQDAWSAMVRWQRNFYP*
Ga0105241_108381252	3300009174	Corn Rhizosphere	NSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP*
Ga0105242_102349691	3300009176	Miscanthus Rhizosphere	LYQHNNTAYKGPATLAANGSRPAVINGVIDDQNVWSAMFRWQRNFYP*
Ga0105242_122682601	3300009176	Miscanthus Rhizosphere	HNTAYKGAAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP*
Ga0105248_125183731	3300009177	Switchgrass Rhizosphere	HHNTAYKGAAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP*
Ga0126374_111364021	3300009792	Tropical Forest Soil	LYSRRNTAFKGNGFVPATGSRPAVFALDDQDVWTAMVRWQRNFFP*
Ga0134080_106453962	3300010333	Grasslands Soil	EVLYSHLTSAYKGPGVYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP*
Ga0126370_122950862	3300010358	Tropical Forest Soil	SKLNSAFKGPATVQPNVPRPGVTAIDDQGVWSAMFRWQRNFYP*
Ga0126372_111552311	3300010360	Tropical Forest Soil	TAFKGPANVAANLPRPAVTLIDDQGVWSAFMRWQRNFYP*
Ga0126379_109488402	3300010366	Tropical Forest Soil	MYTGLNTAYKGAGIYAANGSRPPVTVFDDQGVWSAMVRWQRNFYP*
Ga0126379_115337362	3300010366	Tropical Forest Soil	PQLDIGFEVLYTHHNTAYRGPGLYTANPAQSAIPLFDNQNVWSGIVRWQRNFYP*
Ga0134128_121903311	3300010373	Terrestrial Soil	AALAANGSRPAVPVVDGFIDDQNVWSAMFRWQRNFYP*
Ga0134126_105927112	3300010396	Terrestrial Soil	VPRLDIGLDVTYTGLNTAYKGAAIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
Ga0134121_104164201	3300010401	Terrestrial Soil	TAFKGPATLAANLSRPAVLNGVIDDQNVWSAMFRWQRNFYP*
Ga0134123_122244351	3300010403	Terrestrial Soil	AALAANGSRPAVVNGVIDDQNVWSAMFRWQRNFYP*
Ga0151489_16429922	3300011106	Soil	LNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
Ga0137364_104254601	3300012198	Vadose Zone Soil	PGIVPATGSRPAVPAFDDQGVWSAMVRWQRNFYP*
Ga0137380_102517011	3300012206	Vadose Zone Soil	STGLVTGTNGSRPAVTLIDDQNVWSAMLRWQRNFYP*
Ga0150985_1215562081	3300012212	Avena Fatua Rhizosphere	WNPVPQLDIGLQVMYTHNNTAYKGPAALAANGSRPAGVNGIIDDQNVWSAMFRWQRNFYP
Ga0150985_1223608331	3300012212	Avena Fatua Rhizosphere	KGAASLPTNGSRPAVINAVLDDQNVWSAMFRWQRNFYP*
Ga0137371_100986882	3300012356	Vadose Zone Soil	PQLDIGLEVLYSQRNTAFKGLGTVAATGSRPAVAVLDDQGVWSAMVRWQRNFYP*
Ga0137371_108383641	3300012356	Vadose Zone Soil	TGINTAYKGPGIYATNGSRPAVGLFDDQGVWSAMFRWQRNFYP*
Ga0150984_1139565761	3300012469	Avena Fatua Rhizosphere	AQLDIGLEVLYSRRNTAFKGNAIVPPTGSRPTVFALDDQDVWSAMVRWQRNFYP*
Ga0137398_103209301	3300012683	Vadose Zone Soil	TRLNTAFKGNAVVVANGSRPAVPLLSDQDVWSAMFRWQRNFYP*
Ga0137397_110480131	3300012685	Vadose Zone Soil	VMYTRLNTAFKGNAVVVANGSRPAVPLLSDQDVWSAMFRWQRNFYP*
Ga0157287_11204231	3300012885	Soil	PVPQLDIGMEVLYQHNNTAYKGPATLAANGSRPAVINGVIDDQNVWSAMFRWQRNFYP*
Ga0157295_100204043	3300012906	Soil	DVTYTGLNTAYKGAGIYAANGSRPAVALLDDQGVWSAMFLWQRNFYP*
Ga0157302_105532862	3300012915	Soil	GLNTAYKRAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
Ga0137413_108973542	3300012924	Vadose Zone Soil	VPQLDIGFEVLYTHHNTAYKGPALYTANNPRPAVTLIDDQNVWSAIVRWQRNFYP*
Ga0162652_1000089842	3300012941	Soil	PIRASTPRKGAAIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP*
Ga0137410_117713692	3300012944	Vadose Zone Soil	LYTHVNTAYKGLGTTAANGSRNPVTLIDDQNVWSAMLRWQRNFYP*
Ga0126369_132408402	3300012971	Tropical Forest Soil	GLEVLYSHRNTAFKGVAIVPASGSRPPVFVLDDQGVWSAMVRWQRNFYP*
Ga0157375_112680221	3300013308	Miscanthus Rhizosphere	LYQHNNTAFKGPATLAANLSRPAVLNGVIDDQNVWSAMFRWQRNFYP*
Ga0157375_115207921	3300013308	Miscanthus Rhizosphere	IGLQVLYSHLTSAYKGPGVYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP*
Ga0157375_122774161	3300013308	Miscanthus Rhizosphere	KGAAIYAANGSRPAVALLDDQSVWSAMVRWQRNFYP*
Ga0157375_129667171	3300013308	Miscanthus Rhizosphere	FKGPAIVPASGSRPPVFALDDQNVWSAMFRWQRNFYP*
Ga0134078_100579991	3300014157	Grasslands Soil	LDIGLEVLYSQRNTAFKGLGTVAATGSRPAVAVLDDQGVWSAMVRWQRNFYP*
Ga0163163_103000151	3300014325	Switchgrass Rhizosphere	NTAFKGAAIVPANGSRPVVFALDDQNVLSAMFRWQRNFYP*
Ga0157380_120110502	3300014326	Switchgrass Rhizosphere	QHNNTAFKGPATLAANLSRPAVLNGVIDDQNVWSAMFRWQRKFYP*
Ga0157379_102448342	3300014968	Switchgrass Rhizosphere	GAGIYAANGSRPPVALLDDQGVWSAMFRWQRNFYP*
Ga0157376_112282871	3300014969	Miscanthus Rhizosphere	NNTAFKGPANLAANLSRPAVLNGVIDDQNVWSAMFRWQRNFYP*
Ga0137411_13826404	3300015052	Vadose Zone Soil	MSSHTAFQGPANLTANSHAGVLNGVIDDQNVWAAMFRWQRNFYP*
Ga0173483_102990102	3300015077	Soil	QLDIGLQVMYQHNNTAFKGPAALAANVSRPAVLNGVIDDQNVWSAMFRWQRNFYP*
Ga0137409_108518361	3300015245	Vadose Zone Soil	LEILYSHHNTAYKGAALYTANAPRPVVTLIDDQNVWSAFFRWQRNFYP*
Ga0137409_108631042	3300015245	Vadose Zone Soil	NTAYKGAANVAANGSRPAVALIDDQNVWSAMLRWQRNFYP*
Ga0132258_140045452	3300015371	Arabidopsis Rhizosphere	LNTAYKGPGVYSANPPRPAVVVLDDQNVWSAMFRWQRNFYP*
Ga0132255_1020028151	3300015374	Arabidopsis Rhizosphere	SHLTSAYKGPGIYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP*
Ga0132255_1041952062	3300015374	Arabidopsis Rhizosphere	IGLDITYTGLNTAYKLARVLAANTSRPAVTVFDDQGVWSAMVRWQRNFYP*
Ga0184605_100841541	3300018027	Groundwater Sediment	GNAVVAANGSRPPVPLLSDQDVWSAMFRWQRNFYP
Ga0184608_103340061	3300018028	Groundwater Sediment	NNTAFKGPATLAANASRPLVVNGVIDDQNVWSAMFRWQRNFYP
Ga0184638_12200942	3300018052	Groundwater Sediment	GLEVLYTHLNTAYKGAGVYPANGSRPAVTSIDDQNIWSAMFRWQRNFYP
Ga0184621_100018207	3300018054	Groundwater Sediment	MYTRLNTAYKGPATFAANGSRPAVANGIIDDQNVWSAMFRWQRNFYP
Ga0184624_103960141	3300018073	Groundwater Sediment	LDVTYTGLNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP
Ga0184633_102010362	3300018077	Groundwater Sediment	VMYTRLNTAYKGPATFAANGSRPAVANGIIDDQNVWSAMFRWQRNFYP
Ga0190269_120109612	3300018465	Soil	MEVMYTHHNTAFKGPATLAANGSRPLVVNGIIDDQNVWSAMFRWQRNFYP
Ga0190270_104812351	3300018469	Soil	ATLAANGSRPLVINGFMDHQNVWSAMFRWQRNFYP
Ga0173481_102485922	3300019356	Soil	TYTGLNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP
Ga0193701_11074581	3300019875	Soil	LQVMYTKLNTAYKGPATFAANGSRPAVANGIIDDQNVWSAMFRWQRNFYP
Ga0193729_10928891	3300019887	Soil	TGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP
Ga0193731_10040472	3300020001	Soil	VIYTRLNTAFKGNAVVVANGSRPPVALLSDQDVWSAMFRWQRNFYP
Ga0193696_10618481	3300020016	Soil	IGLDVTYTGLNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP
Ga0222621_10302241	3300021510	Groundwater Sediment	LDVTYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP
Ga0222623_103464541	3300022694	Groundwater Sediment	RTQWNPVPRLDIGLDVTYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFY
Ga0207656_102735732	3300025321	Corn Rhizosphere	GAAGYAANGSRPAVALLDDQGVWSAMFRWQRNFYP
Ga0207671_102942334	3300025914	Corn Rhizosphere	MEVLYQHNNTAYKGPATLAANGSRPAVINGVIDDQNVWSAMFRWQRNFYP
Ga0207693_100150431	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	RTQWNPVPRLDIGLDVTYTGLNTAYKRAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFY
Ga0207646_119471362	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	RRNTAFKGAAIVPANASRPAVFALDDQDVISAMFRWQRNFYP
Ga0207659_115912502	3300025926	Miscanthus Rhizosphere	HLTSAYKGPGVYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP
Ga0207690_108976452	3300025932	Corn Rhizosphere	IGLDVTYTGLNTAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP
Ga0207667_105334072	3300025949	Corn Rhizosphere	NNTAYKGPAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP
Ga0207668_105147042	3300025972	Switchgrass Rhizosphere	NTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP
Ga0207677_116659831	3300026023	Miscanthus Rhizosphere	GAAVHAANGSRPAVALLDDQGVWSAMFRWQRNFYP
Ga0209283_102434813	3300027875	Vadose Zone Soil	AYKGPGITPANGAQPAHNFVDDQNVWSAQFRWQRNFYP
Ga0268265_100236625	3300028380	Switchgrass Rhizosphere	TAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP
Ga0137415_102983101	3300028536	Vadose Zone Soil	THVNTAYKGVGTYAANGSRPAVTLIDDQNVWSAMLRWQRNFYP
Ga0247828_105753671	3300028587	Soil	YKGPGIYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP
Ga0307295_101513361	3300028708	Soil	TYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP
Ga0307322_101149751	3300028710	Soil	QWNPVPQLDIGMEVLYMHHDTAFKGPANLAANVSRPAVLAGVMDDQNVWSAMFRWQRNFY
Ga0307307_103082721	3300028718	Soil	GLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP
Ga0307317_100792032	3300028720	Soil	VPKLDIGLDVTYTGLNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP
Ga0307297_102898411	3300028754	Soil	GLNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP
Ga0307282_106184801	3300028784	Soil	GLDVTYTGINTAYKGPGVYAANGSRPAVGLFDDEGIWSAIFRWQRNFYS
Ga0307323_103548851	3300028787	Soil	YTHNNTAYKGPAALAANGSRPAVVNGIIDDRNVWSAMFRWQRNFYP
Ga0307283_100570542	3300028790	Soil	PKLDIGLDVTYTGLNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP
Ga0307503_103762542	3300028802	Soil	FNPVPQLDIGLDLLYTGLNTAYRGPGTYAANASRPAVTSFDNQGVWSALMRWQRNFYP
Ga0307292_101435701	3300028811	Soil	LNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP
Ga0307312_109375312	3300028828	Soil	RLDIGLDVTYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP
Ga0307289_101829451	3300028875	Soil	NSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP
Ga0307300_103188212	3300028880	Soil	RLQGPAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP
Ga0308199_11576931	3300031094	Soil	AYKGAAVYAANGSRPAVALLDDQGVWSAMVRWQRNFYP
Ga0310904_104854762	3300031854	Soil	AYKGDGIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP
Ga0310892_104858341	3300031858	Soil	DIGLQVLYSHLTSAYKGPGVYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP
Ga0306925_106175363	3300031890	Soil	YTHVNTAYKGPAVYLANNARPAVGLIDDQNVWSGMFRWQRNFYP
Ga0306925_116849762	3300031890	Soil	YTHHNTAYKGPALYTANAPRPAVTLMDDQNVWSGIVRWQRNFYP
Ga0318551_102118542	3300031896	Soil	FNTAYKGPAVYAANVARPAVGLIDDQNVWSVLFRWQRNFYP
Ga0310900_101639893	3300031908	Soil	QHNNTAYKGPATLAANGSRPAVINGVIDDQNVWSAMFRWQRNFYP
Ga0306921_110809323	3300031912	Soil	GPAVYLANNARPAVGLIDDQNVWSGMFRWQRNFYP
Ga0310903_100992501	3300032000	Soil	RRNTAFKGAAIVPANLSRPAVFALDDQSVWSAMFRWQRNFYP
Ga0310899_100518051	3300032017	Soil	GPAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP
Ga0310890_105261531	3300032075	Soil	GAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP
Ga0268251_105592872	3300032159	Agave	YKGPGTYAANGSRPAVGLFDDQGIWSAMFRWQRNFYP
Ga0310811_110913222	3300033475	Soil	LYSHLTSAYKGPGIYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP
Ga0247829_106466821	3300033550	Soil	PIPGSIARIGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP
Ga0247830_101478052	3300033551	Soil	GAGIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP
Ga0364929_0080017_901_1014	3300034149	Sediment	FKGAALVPANPSRPVVFALDDQDVISAMFRWQRNFYP