| Basic Information | |
|---|---|
| Family ID | F046980 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 45 residues |
| Representative Sequence | PRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGIKLLEQYL |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.67 % |
| % of genes near scaffold ends (potentially truncated) | 97.33 % |
| % of genes from short scaffolds (< 2000 bps) | 94.67 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (44.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (18.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (62.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF13328 | HD_4 | 12.67 |
| PF00004 | AAA | 2.00 |
| PF04545 | Sigma70_r4 | 1.33 |
| PF04542 | Sigma70_r2 | 1.33 |
| PF14902 | DUF4494 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.33 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.33 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.33 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.33 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.00 % |
| Unclassified | root | N/A | 44.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001839|RCM40_1082426 | Not Available | 534 | Open in IMG/M |
| 3300001938|GOS2221_1002042 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300002408|B570J29032_109238709 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300002483|JGI25132J35274_1076566 | Not Available | 695 | Open in IMG/M |
| 3300003277|JGI25908J49247_10054437 | Not Available | 1037 | Open in IMG/M |
| 3300004097|Ga0055584_101279950 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005527|Ga0068876_10746772 | Not Available | 520 | Open in IMG/M |
| 3300005528|Ga0068872_10227039 | Not Available | 1055 | Open in IMG/M |
| 3300005582|Ga0049080_10041348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1599 | Open in IMG/M |
| 3300006026|Ga0075478_10039391 | All Organisms → Viruses → Predicted Viral | 1563 | Open in IMG/M |
| 3300006026|Ga0075478_10085075 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
| 3300006029|Ga0075466_1089788 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300006738|Ga0098035_1231318 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300006750|Ga0098058_1136221 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300006752|Ga0098048_1141048 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300006753|Ga0098039_1038195 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
| 3300006790|Ga0098074_1101029 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300006793|Ga0098055_1376683 | Not Available | 526 | Open in IMG/M |
| 3300006802|Ga0070749_10018567 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4427 | Open in IMG/M |
| 3300006802|Ga0070749_10234656 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| 3300006805|Ga0075464_10672882 | Not Available | 639 | Open in IMG/M |
| 3300006924|Ga0098051_1190628 | Not Available | 537 | Open in IMG/M |
| 3300006928|Ga0098041_1287525 | Not Available | 523 | Open in IMG/M |
| 3300007229|Ga0075468_10120193 | Not Available | 816 | Open in IMG/M |
| 3300007234|Ga0075460_10196964 | Not Available | 687 | Open in IMG/M |
| 3300007344|Ga0070745_1172260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300007346|Ga0070753_1107104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
| 3300007542|Ga0099846_1097663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1083 | Open in IMG/M |
| 3300007542|Ga0099846_1104840 | Not Available | 1039 | Open in IMG/M |
| 3300007561|Ga0102914_1200408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300008012|Ga0075480_10233765 | Not Available | 958 | Open in IMG/M |
| 3300008262|Ga0114337_1328540 | Not Available | 531 | Open in IMG/M |
| 3300008266|Ga0114363_1048364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2045 | Open in IMG/M |
| 3300008267|Ga0114364_1057146 | Not Available | 1369 | Open in IMG/M |
| 3300008267|Ga0114364_1096536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| 3300008267|Ga0114364_1125686 | Not Available | 753 | Open in IMG/M |
| 3300008267|Ga0114364_1154003 | Not Available | 982 | Open in IMG/M |
| 3300008450|Ga0114880_1047566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1829 | Open in IMG/M |
| 3300009026|Ga0102829_1053567 | Not Available | 1213 | Open in IMG/M |
| 3300009051|Ga0102864_1054828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1079 | Open in IMG/M |
| 3300009161|Ga0114966_10184286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1334 | Open in IMG/M |
| 3300009423|Ga0115548_1143043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300009435|Ga0115546_1215944 | Not Available | 661 | Open in IMG/M |
| 3300009438|Ga0115559_1095335 | Not Available | 1170 | Open in IMG/M |
| 3300010151|Ga0098061_1260545 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010153|Ga0098059_1072317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1378 | Open in IMG/M |
| 3300010153|Ga0098059_1204091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300010354|Ga0129333_11390557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300010368|Ga0129324_10042588 | Not Available | 2107 | Open in IMG/M |
| 3300012013|Ga0153805_1038833 | Not Available | 809 | Open in IMG/M |
| 3300012352|Ga0157138_1052914 | Not Available | 638 | Open in IMG/M |
| 3300012936|Ga0163109_10610382 | Not Available | 799 | Open in IMG/M |
| 3300017706|Ga0181377_1058610 | Not Available | 720 | Open in IMG/M |
| 3300017706|Ga0181377_1060457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300017713|Ga0181391_1011190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2310 | Open in IMG/M |
| 3300017714|Ga0181412_1150887 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 523 | Open in IMG/M |
| 3300017717|Ga0181404_1028978 | Not Available | 1420 | Open in IMG/M |
| 3300017720|Ga0181383_1065917 | Not Available | 972 | Open in IMG/M |
| 3300017723|Ga0181362_1030146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1155 | Open in IMG/M |
| 3300017724|Ga0181388_1038411 | Not Available | 1169 | Open in IMG/M |
| 3300017727|Ga0181401_1025375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1736 | Open in IMG/M |
| 3300017727|Ga0181401_1153129 | Not Available | 561 | Open in IMG/M |
| 3300017727|Ga0181401_1176443 | Not Available | 511 | Open in IMG/M |
| 3300017728|Ga0181419_1114533 | Not Available | 658 | Open in IMG/M |
| 3300017737|Ga0187218_1169665 | Not Available | 512 | Open in IMG/M |
| 3300017738|Ga0181428_1012142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1975 | Open in IMG/M |
| 3300017739|Ga0181433_1080865 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 800 | Open in IMG/M |
| 3300017744|Ga0181397_1183878 | Not Available | 526 | Open in IMG/M |
| 3300017746|Ga0181389_1129100 | Not Available | 682 | Open in IMG/M |
| 3300017747|Ga0181352_1052118 | Not Available | 1188 | Open in IMG/M |
| 3300017748|Ga0181393_1019716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1979 | Open in IMG/M |
| 3300017748|Ga0181393_1032858 | All Organisms → Viruses → Predicted Viral | 1468 | Open in IMG/M |
| 3300017758|Ga0181409_1173152 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 628 | Open in IMG/M |
| 3300017762|Ga0181422_1268118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300017763|Ga0181410_1111721 | Not Available | 785 | Open in IMG/M |
| 3300017765|Ga0181413_1072483 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300017765|Ga0181413_1166232 | Not Available | 663 | Open in IMG/M |
| 3300017766|Ga0181343_1128088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300017766|Ga0181343_1229845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300017776|Ga0181394_1040960 | All Organisms → Viruses → Predicted Viral | 1589 | Open in IMG/M |
| 3300017818|Ga0181565_10617979 | Not Available | 693 | Open in IMG/M |
| 3300017951|Ga0181577_10629720 | Not Available | 659 | Open in IMG/M |
| 3300017952|Ga0181583_10550471 | Not Available | 700 | Open in IMG/M |
| 3300018682|Ga0188851_1030122 | Not Available | 601 | Open in IMG/M |
| 3300019784|Ga0181359_1110570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300020220|Ga0194119_10012280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10884 | Open in IMG/M |
| 3300020403|Ga0211532_10140416 | Not Available | 998 | Open in IMG/M |
| 3300020416|Ga0211644_10403764 | Not Available | 565 | Open in IMG/M |
| 3300020551|Ga0208360_1011668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1238 | Open in IMG/M |
| 3300021091|Ga0194133_10570867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300021961|Ga0222714_10312423 | Not Available | 857 | Open in IMG/M |
| 3300022065|Ga0212024_1101652 | Not Available | 512 | Open in IMG/M |
| 3300022176|Ga0212031_1077876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300022179|Ga0181353_1122355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300022752|Ga0214917_10426925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300023081|Ga0255764_10489130 | Not Available | 511 | Open in IMG/M |
| (restricted) 3300023112|Ga0233411_10038850 | Not Available | 1465 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10144503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1168 | Open in IMG/M |
| 3300025082|Ga0208156_1080070 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300025086|Ga0208157_1056708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1035 | Open in IMG/M |
| 3300025114|Ga0208433_1133456 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300025118|Ga0208790_1071304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1054 | Open in IMG/M |
| 3300025131|Ga0209128_1084126 | Not Available | 1060 | Open in IMG/M |
| 3300025141|Ga0209756_1272238 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 611 | Open in IMG/M |
| 3300025168|Ga0209337_1330583 | Not Available | 533 | Open in IMG/M |
| 3300025610|Ga0208149_1093107 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300025610|Ga0208149_1093596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300025626|Ga0209716_1092267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300025645|Ga0208643_1071083 | Not Available | 1012 | Open in IMG/M |
| 3300025652|Ga0208134_1048255 | All Organisms → Viruses → Predicted Viral | 1368 | Open in IMG/M |
| 3300025653|Ga0208428_1041466 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
| 3300025655|Ga0208795_1140111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300025687|Ga0208019_1158937 | Not Available | 630 | Open in IMG/M |
| 3300025769|Ga0208767_1086117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1304 | Open in IMG/M |
| 3300025810|Ga0208543_1072082 | Not Available | 836 | Open in IMG/M |
| 3300025818|Ga0208542_1098404 | Not Available | 845 | Open in IMG/M |
| 3300025828|Ga0208547_1081544 | All Organisms → Viruses → Predicted Viral | 1032 | Open in IMG/M |
| 3300025848|Ga0208005_1197168 | Not Available | 625 | Open in IMG/M |
| 3300025870|Ga0209666_1392106 | Not Available | 519 | Open in IMG/M |
| 3300025889|Ga0208644_1170282 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300027077|Ga0208941_1041556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300027522|Ga0209384_1004301 | Not Available | 5976 | Open in IMG/M |
| 3300027659|Ga0208975_1055788 | Not Available | 1204 | Open in IMG/M |
| 3300027693|Ga0209704_1267430 | Not Available | 500 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1117021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1138 | Open in IMG/M |
| 3300027798|Ga0209353_10100772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1304 | Open in IMG/M |
| 3300027899|Ga0209668_10136777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1471 | Open in IMG/M |
| 3300027899|Ga0209668_10598694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
| 3300027899|Ga0209668_10631128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300028125|Ga0256368_1086824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300031605|Ga0302132_10079007 | Not Available | 1679 | Open in IMG/M |
| 3300031758|Ga0315907_10705510 | Not Available | 767 | Open in IMG/M |
| 3300031787|Ga0315900_10058087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4023 | Open in IMG/M |
| 3300031963|Ga0315901_10579583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300031963|Ga0315901_10743037 | Not Available | 720 | Open in IMG/M |
| 3300031963|Ga0315901_10950028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300031963|Ga0315901_11107928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300032050|Ga0315906_10464064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1082 | Open in IMG/M |
| 3300032093|Ga0315902_10075195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3759 | Open in IMG/M |
| 3300032093|Ga0315902_10509295 | Not Available | 1044 | Open in IMG/M |
| 3300032093|Ga0315902_10564480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
| 3300032116|Ga0315903_10569417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300034020|Ga0335002_0690793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300034022|Ga0335005_0583895 | Not Available | 608 | Open in IMG/M |
| 3300034061|Ga0334987_0400776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
| 3300034061|Ga0334987_0730348 | Not Available | 562 | Open in IMG/M |
| 3300034096|Ga0335025_0582899 | Not Available | 553 | Open in IMG/M |
| 3300034105|Ga0335035_0117735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1698 | Open in IMG/M |
| 3300034106|Ga0335036_0755726 | Not Available | 568 | Open in IMG/M |
| 3300034356|Ga0335048_0583014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.67% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 14.67% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 14.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.67% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.67% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.67% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.00% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.00% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.33% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.33% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.67% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.67% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.67% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.67% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.67% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.67% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
| 3300001938 | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027077 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM40_10824261 | 3300001839 | Marine Plankton | YGIGLEYPQCMDQIAEEMGVTNERARQLVRGAELDLAKLPGIKLLEQYL* |
| GOS2221_10020426 | 3300001938 | Marine | AYPQCMEQIAEVLSVTGERARQLVRQAEKDITKVPGIKMLEQYL* |
| B570J29032_1092387091 | 3300002408 | Freshwater | RRFYGIGQEYPQCMDQIAEEMGVTGERARQLVRQAETELAKLPGIELLEQYL* |
| JGI25132J35274_10765661 | 3300002483 | Marine | IEYPRCMEQIADELQVTGERARQLVRQAEKEIRKIPGIKKLQQYL* |
| JGI25908J49247_100544371 | 3300003277 | Freshwater Lake | CMDQIAEELDVTGERARQLVRQAENALKALPGIKLLEQYK* |
| Ga0055584_1012799501 | 3300004097 | Pelagic Marine | EYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL* |
| Ga0068876_107467721 | 3300005527 | Freshwater Lake | QCMEQIAEELNVTGERARQLVRQAEVALSKMPGIKLLEQYR* |
| Ga0068872_102270391 | 3300005528 | Freshwater Lake | QCMEQIAEELDVTGERARQLVRAAEKTLSTMQGIELLEQYL* |
| Ga0049080_100413481 | 3300005582 | Freshwater Lentic | MDQIAEELDVTGERARQLVRQAENALKAMPGIKLLEQYK* |
| Ga0075478_100393911 | 3300006026 | Aqueous | YGIGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL* |
| Ga0075478_100850753 | 3300006026 | Aqueous | YGIGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGIKLLEQYL* |
| Ga0075466_10897884 | 3300006029 | Aqueous | IEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGIKLLEQYL* |
| Ga0098035_12313181 | 3300006738 | Marine | YPKPMEQIAIELSVTGERARQLVRQAELGLKKMSGIKLLEQYL* |
| Ga0098058_11362213 | 3300006750 | Marine | YGIGYDYPKPMEQIAIELSVTGERARQLVRQAELGLKQMSGIKLLEQYL* |
| Ga0098048_11410481 | 3300006752 | Marine | FYGIGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKIPGIKKLQQYL* |
| Ga0098039_10381951 | 3300006753 | Marine | KAAVEMFYGIGYDYPKPMEQIAIELSVTGERARQLVRQAELGLKKMSGIKLLEQYL* |
| Ga0098074_11010291 | 3300006790 | Marine | KPAAALKMFYGIDTEYPRCMEQIAEELQVTGERARQLVRQAEREIKNVPGIKLLEQYL* |
| Ga0098055_13766833 | 3300006793 | Marine | GYDYPKPMEQRAQVLSVTGERARQLVRQAELGLKKMSGIKLLEQYL* |
| Ga0070749_100185679 | 3300006802 | Aqueous | FYGIGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL* |
| Ga0070749_102346563 | 3300006802 | Aqueous | FYGIGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGIKLLEQYL* |
| Ga0075464_106728821 | 3300006805 | Aqueous | MEYAQCMEQIAEELEVTGERARQLVRQAEIELAKLPGIELLEQYL* |
| Ga0098051_11906281 | 3300006924 | Marine | IGCEYAACMERIAEELNVTGERARQLVRQAEKSLRGMDDINLLKQYS* |
| Ga0098041_12875252 | 3300006928 | Marine | YEACMERIAEELNVTGERARQLVRQAEKSLKAMEDIDLLKQYS* |
| Ga0075468_101201933 | 3300007229 | Aqueous | GIGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL* |
| Ga0075460_101969641 | 3300007234 | Aqueous | FYGIGMEYPQVMEQIADEMYITGERARQLVRQGEKDLRKLSGIKLLEKYL* |
| Ga0070745_11722601 | 3300007344 | Aqueous | TRFYGIGLEYPQCMEQIAEELQVTGERARQLVRAGEKALQSMDGVKVLEKYF* |
| Ga0070753_11071041 | 3300007346 | Aqueous | PEKQGQAVTGFYGIGLEYPQCMEQIAEELQVTGERARQLVRAGEKALQSMDGVKVLEKYF |
| Ga0099846_10976631 | 3300007542 | Aqueous | MDQIAEEMGVTGERARQLVRQAEIELAKLPGIKLLEQYL* |
| Ga0099846_11048405 | 3300007542 | Aqueous | PQSMDQIAEEMNITGERARQLVRQAEKSLAALPGIEQLKSYL* |
| Ga0102914_12004081 | 3300007561 | Estuarine | MFYGIDSEYAMCMDQIAEELGITGERARQLVRGAELALTKLPGIELLEQYL* |
| Ga0075480_102337651 | 3300008012 | Aqueous | CMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL* |
| Ga0114337_13285401 | 3300008262 | Freshwater, Plankton | GLEYPQCMEQIAEEMDVTGERARQLVRSGEKALASLPGIQMLAQYL* |
| Ga0114363_10483647 | 3300008266 | Freshwater, Plankton | TRFYGIDREYAQCMEQIAEELNVTGERARQLVRAAEKNIATLPGIELLEQYL* |
| Ga0114364_10571465 | 3300008267 | Freshwater, Plankton | RFYGIGREYAQCMDQIAEEMGVTGERARQLVRQAETEMAKLPGIQLLEQYL* |
| Ga0114364_10965363 | 3300008267 | Freshwater, Plankton | AISRFYGIGREYPQCMDQIAEEMGVTNERARQLVRGAELALASLPGIELLEQYL* |
| Ga0114364_11256863 | 3300008267 | Freshwater, Plankton | RFYGIGREYAQCMDQIAEEMGVTGERARQLVRQAETEMSKIPGIQLLEQYL* |
| Ga0114364_11540031 | 3300008267 | Freshwater, Plankton | GFEYEQCMEQIAEELNVTGERARQLVRQAEVALSKMPGIKLLEQYR* |
| Ga0114880_10475664 | 3300008450 | Freshwater Lake | EAVTRFYGIDREYAQCMEQIAEELNVTGERARQLVRLAESALRAMPGIQLLEQYL* |
| Ga0102829_10535671 | 3300009026 | Estuarine | REAITRFYGIGFEYEQCMDQIAEELNVTGERARQLVRQAELALKALPGIKLLEQYK* |
| Ga0102864_10548281 | 3300009051 | Estuarine | IGEEMGITNERARQLVRQAEIDLAKVPGIKLLEQYL* |
| Ga0114966_101842861 | 3300009161 | Freshwater Lake | IKMFYGIDSEYAMCMDQIAEELGVTGERARQLVRGAELALTKLPGIELLEQYL* |
| Ga0115548_11430431 | 3300009423 | Pelagic Marine | TMFYGIGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL* |
| Ga0115546_12159443 | 3300009435 | Pelagic Marine | MEQIAEELNVTGERARQLVRAAEKNIATLPGIELLEQYL* |
| Ga0115559_10953351 | 3300009438 | Pelagic Marine | PRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL* |
| Ga0098061_12605453 | 3300010151 | Marine | AAIEMFYGIGYDYPKPMEQIAIELSVTGERARQLVRQAELGLKKMSGIKLLEQYL* |
| Ga0098059_10723171 | 3300010153 | Marine | KQKLAVTMFYGIGYEYPKPMEQIAVELEVTGERARQLVRQGECALRKLSGIGILEKYL* |
| Ga0098059_12040911 | 3300010153 | Marine | MFYGIGCEYEACMERIAEELNVTGERARQLVRQAEKSLKAMEDIDLLKQYS* |
| Ga0129333_113905572 | 3300010354 | Freshwater To Marine Saline Gradient | FYGIGREYPQCMDQIAEEMGVTGERARQLVRGAELALAKLPGIELLEQYL* |
| Ga0129324_100425881 | 3300010368 | Freshwater To Marine Saline Gradient | QIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL* |
| Ga0153805_10388333 | 3300012013 | Surface Ice | TRFYGIDREYAQCMEQIAEELDVTGERARQLVRAAEKTLSTMQGIELLEQYL* |
| Ga0157138_10529142 | 3300012352 | Freshwater | MEQIGEEMGITNERARQLVRQGEKALAEVPGIKLLEQYL* |
| Ga0163109_106103821 | 3300012936 | Surface Seawater | EELNVTGERARQLVRQAEKSLKAMEDINLLKQYS* |
| Ga0181377_10586103 | 3300017706 | Marine | EACMERIAEELNVTGERARQLVRQAEKSLKAMEDINLLKQYS |
| Ga0181377_10604571 | 3300017706 | Marine | MEQIAEVLSVTGERARQLVRQAEIEITKVPGIKMLEQYL |
| Ga0181391_10111901 | 3300017713 | Seawater | QSAALTMFYGIGLEFPRCMEQIAEELKVTGERARQLVRQAEKDIIKVPGIKNLLQYL |
| Ga0181412_11508871 | 3300017714 | Seawater | LKPKQASALTMFYGIGIDFPRCMEQIAEELKVTGERARQLVRQAEKDIIKVPGIKNLLQY |
| Ga0181404_10289781 | 3300017717 | Seawater | GIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL |
| Ga0181383_10659171 | 3300017720 | Seawater | RIAEELNVTGERARQLVRQAEKSLKAMEDINLLKQYS |
| Ga0181362_10301461 | 3300017723 | Freshwater Lake | IGEEMGITNERARQLVRQAEIDLAKVPGIKLLEQYL |
| Ga0181388_10384115 | 3300017724 | Seawater | MEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL |
| Ga0181401_10253751 | 3300017727 | Seawater | GIGCEYEACMERIAEELNVTGERARQLVRQAEKSLKAMEDIDLLKQYS |
| Ga0181401_11531292 | 3300017727 | Seawater | GIGCEYEACMERIAEELNVTGERARQLVRQAEKSLKAMEDINLLKQYS |
| Ga0181401_11764431 | 3300017727 | Seawater | ACMERIAEELNVTGERARQLVRQAEKSLKAMEDINLLKQYS |
| Ga0181419_11145333 | 3300017728 | Seawater | CMEQIAEELKVTGERARQLVRQAEKDIIKVPGIKNLLQYL |
| Ga0187218_11696651 | 3300017737 | Seawater | ITMFYGIGCEYEACMERIAEELNVTGERARQLVRQAEKSLKAMEDINLLKQYS |
| Ga0181428_10121424 | 3300017738 | Seawater | MEQIAEELKVTGERARQLVRQAEKDIIKVPGIKNLLQYL |
| Ga0181433_10808651 | 3300017739 | Seawater | KQASALTMFYGIGIDFPRCMEQIAEELKVTGERARQLVRQAEKDIIKVPGIKNLLQYL |
| Ga0181397_11838782 | 3300017744 | Seawater | EYEACMERIAEELNVTGERARQLVRQAEKSLKAMEDINLLKQYS |
| Ga0181389_11291001 | 3300017746 | Seawater | IAEELNVTGERARQLVRQAEKSLKAMEDINLLKQYS |
| Ga0181352_10521181 | 3300017747 | Freshwater Lake | QCMDQIAEEMGVTGERARQLVRQAETEMSKIPGIQLLEQYL |
| Ga0181393_10197161 | 3300017748 | Seawater | EQIAEELKVTGERARQLVRQAEKDIIKVPGIKNLLQYL |
| Ga0181393_10328581 | 3300017748 | Seawater | KKAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL |
| Ga0181409_11731522 | 3300017758 | Seawater | GLEFPRCMEQIAEELKVTGERARQLVRQAEKDIIKVPGIKNLLQYL |
| Ga0181422_12681181 | 3300017762 | Seawater | FYGIGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL |
| Ga0181410_11117213 | 3300017763 | Seawater | GIGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGIKLLEQYL |
| Ga0181413_10724834 | 3300017765 | Seawater | IAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL |
| Ga0181413_11662322 | 3300017765 | Seawater | YEACMERIAEELNVTGERARQLVRQAEKSLKAMEDINLLKQYS |
| Ga0181343_11280881 | 3300017766 | Freshwater Lake | AEELGVTGERARQLVRLAENGLRAMPGIKLLEQYL |
| Ga0181343_12298451 | 3300017766 | Freshwater Lake | GIDREYAQCMEQIAEELNVTGERARQLVRLGETALRNMPGIRLLEQYL |
| Ga0181394_10409601 | 3300017776 | Seawater | KGIGIEYPRCMEQIADELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL |
| Ga0181565_106179791 | 3300017818 | Salt Marsh | YGIDTEYPRCMEQIAEELQVTGERARQLVRQAEREIKNVTGITLLEQYL |
| Ga0181577_106297201 | 3300017951 | Salt Marsh | YPQCMEQIAEELQVTGERARQLVRAGEKALQSLEGVKVLEKYF |
| Ga0181583_105504713 | 3300017952 | Salt Marsh | FYGIDTEYPRCMEQIAEELQVTGERARQLVRQAEREIKNVPGIKLLEQYL |
| Ga0188851_10301222 | 3300018682 | Freshwater Lake | LVRFYGIDREYAQCMDQIAEELNVTGERARQLVRAAEKTIKTLPGIELLEQYL |
| Ga0181359_11105701 | 3300019784 | Freshwater Lake | MEQIAEELGVTGERARQLVRLAEKGLQAMPGIKLLEQYL |
| Ga0194119_100122801 | 3300020220 | Freshwater Lake | IAEELNVTGERARQLVRAAEKNIATLPGIELLEQYL |
| Ga0211532_101404164 | 3300020403 | Marine | EACMERIAEELNVTGERARQLVRQAEKSLRGMEDINLLKQYS |
| Ga0211644_104037641 | 3300020416 | Marine | YGIGCEYEACMERIAEELNVTGERARQLVRQAEKSLRGMEDINLLKQYS |
| Ga0208360_10116685 | 3300020551 | Freshwater | IRRFYGIGQEYPQCMDQIAEEMGVTGERARQLVRQAETELAKLPGIELLEQYL |
| Ga0194133_105708671 | 3300021091 | Freshwater Lake | MNYGIGYEYAKPMEQIAEELGVTGERARQLVRLAEKGLQAMPGITLLEQYL |
| Ga0222714_103124231 | 3300021961 | Estuarine Water | IEREYAQCMEQIAEELDVTGERARQLVRAAEKTLSTMQGIELLEQYL |
| Ga0212024_11016522 | 3300022065 | Aqueous | IGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL |
| Ga0212031_10778761 | 3300022176 | Aqueous | YPQCMEQIAEELDITGERARQLVRAGEKTLRSLKGAKILAQYF |
| Ga0181353_11223551 | 3300022179 | Freshwater Lake | YGIDAEYAKCMDQIAEELNVTGERARQLVRGAELALAKLPGIKLLEQYL |
| Ga0214917_104269252 | 3300022752 | Freshwater | QRVALCMNYGIGFEYAKPMEQIAEELGVTGERARQLVRLAEKGLQAMPGIKLLEQYL |
| Ga0255764_104891301 | 3300023081 | Salt Marsh | MVMDQVAEELGVTGERARQLVRQAELALKKVSGIDLLKEYL |
| (restricted) Ga0233411_100388501 | 3300023112 | Seawater | IGIEYPRCMEQIAEELQVTGERARQLVRQAEVEIRKVPGIKLLEQYL |
| (restricted) Ga0255048_101445031 | 3300024518 | Seawater | LFYGIGIEYPQCMEQIAEVLSVTGERARQLVRQAEIEITKVPGIKMLEQYL |
| Ga0208156_10800702 | 3300025082 | Marine | QKAAIEMFYGIGYEYPKPMEQIAIELSVTGERARQLVRQAELGLKKMSGIKLLEQYL |
| Ga0208157_10567081 | 3300025086 | Marine | ITMFYGIGIDFPRCMEQIAEELKVTGERARQLVRQAEKDIIKVPGIKNLLQYL |
| Ga0208433_11334561 | 3300025114 | Marine | AIELSVTGERARQLVRQAELGLKKMSGIKLLEQYL |
| Ga0208790_10713041 | 3300025118 | Marine | AVELDVSAERARQLVRQAECALRKLSGIELLEQYL |
| Ga0209128_10841264 | 3300025131 | Marine | KIAITMFYGIGCEYAACMERIAEELNVTGERARQLVRQAEKSLRGMDDINLLKQYS |
| Ga0209756_12722381 | 3300025141 | Marine | IDFPRCMEQIAEELKVTGERARQLVRQAEKDIIKVPGIKNLLQYL |
| Ga0209337_13305832 | 3300025168 | Marine | AEELNVTGERARQLVRQAEKNLKAMEDINLLKQYS |
| Ga0208149_10931071 | 3300025610 | Aqueous | MFYGIGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGIKLLEQYL |
| Ga0208149_10935962 | 3300025610 | Aqueous | MFYGIGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL |
| Ga0209716_10922673 | 3300025626 | Pelagic Marine | TMFYGIGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL |
| Ga0208643_10710834 | 3300025645 | Aqueous | AEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL |
| Ga0208134_10482555 | 3300025652 | Aqueous | PRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGIKLLEQYL |
| Ga0208428_10414665 | 3300025653 | Aqueous | EQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL |
| Ga0208795_11401113 | 3300025655 | Aqueous | EQIAEELDITGERARQLVRAGEKTLRSLNGAKILAQYF |
| Ga0208019_11589373 | 3300025687 | Aqueous | EKQREAITRFYGIDREYAQCMEQIAEELDVTGERARQLVRAAEKTLSTMQGIELLEQYL |
| Ga0208767_10861174 | 3300025769 | Aqueous | MEHIAEELNVTGERARQLVRQGEKALKGVEGIDKLMQYL |
| Ga0208543_10720823 | 3300025810 | Aqueous | GIGIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL |
| Ga0208542_10984043 | 3300025818 | Aqueous | RCMEQIAEELQVTGERARQLVRQAEKEIRKVPGVKLLEQYL |
| Ga0208547_10815443 | 3300025828 | Aqueous | GIEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGIKLLEQYL |
| Ga0208005_11971681 | 3300025848 | Aqueous | YGIDQEYSQCMDQIAEEMGVTGERARQLVRQAETELAKLPGIQLLEQYL |
| Ga0209666_13921062 | 3300025870 | Marine | PKQAKALTLFYGIGIEYPQCMEQIAEVLSVTGERARQLVRQAEIEITKVPGIKMLEQYL |
| Ga0208644_11702823 | 3300025889 | Aqueous | IEYPRCMEQIAEELQVTGERARQLVRQAEKEIRKVPGIKLLEQYL |
| Ga0208941_10415563 | 3300027077 | Marine | EHIAEELNVTGERARQLVRQAEKALKAVPGIEKLLKYV |
| Ga0209384_100430115 | 3300027522 | Marine | QIAEELKVTGERARQLVRQAEVEIRKVPGIKLLEQYL |
| Ga0208975_10557881 | 3300027659 | Freshwater Lentic | KQREAITRFYGIDREYAQCMEQIAEELDVTGERARQLVRAAEKTLSTMQGIELLEQYL |
| Ga0209704_12674302 | 3300027693 | Freshwater Sediment | AQCMEQIAEELNVTGERARQLVRAAETSIKKVPGIELLEQYL |
| (restricted) Ga0247833_11170213 | 3300027730 | Freshwater | EQIAEELGVTGERARQLVRLAEKGLQAMPGIKLLEQYL |
| Ga0209353_101007726 | 3300027798 | Freshwater Lake | IAEELAVTGERARQLVRQAENALKALPGIKLLEQYK |
| Ga0209668_101367771 | 3300027899 | Freshwater Lake Sediment | EYAKCMDQIAEELNVTGERARQLVRGAELALAKLPGIKLLEQYL |
| Ga0209668_105986941 | 3300027899 | Freshwater Lake Sediment | YGIDREYAQCMEQIAEELNVTGERARQLVRLAESALKAMPGIKLLEQYL |
| Ga0209668_106311281 | 3300027899 | Freshwater Lake Sediment | MDQIAEELNVTGERARQLVRGAELALAKLPGIKLLEQYL |
| Ga0256368_10868241 | 3300028125 | Sea-Ice Brine | MFYGIGIEYPRCMEQIAEELKVTGERARQLVRQAEVEIRKVPGIKLLEQYL |
| Ga0302132_100790077 | 3300031605 | Marine | IAEELKVTGERARQLVRQAEVEIRKVPGIKLLEQYL |
| Ga0315907_107055101 | 3300031758 | Freshwater | PQCMDQIAEEMGVTNERARQLVRGAELDLAKLPGIKLLEQYL |
| Ga0315900_100580871 | 3300031787 | Freshwater | GIDREYAQCMEQIAEEMSVTGERARQLVRAGEKSLAALPGIQTLAQYL |
| Ga0315901_105795833 | 3300031963 | Freshwater | AEELGVTGERARQLVRLAEKGLQAMPGIKLLEQYL |
| Ga0315901_107430373 | 3300031963 | Freshwater | QIAEELDVTGERARQLVRAAEKTLSTMKGIELLEQYL |
| Ga0315901_109500282 | 3300031963 | Freshwater | NQLPAKQCAAIKMFYGIDAEYAKCMDQIAEELNVTGERARQLVRGAELALAKLPGIKLLEQYL |
| Ga0315901_111079282 | 3300031963 | Freshwater | IKMFYGIDSEYPKCMEQIAEELQVTGERARQLVRQAEVALSKLPGIKLLEQYL |
| Ga0315906_104640641 | 3300032050 | Freshwater | PMEQIAEELNITGERARQLVRLGEQSLRSLPGIKLLEQYL |
| Ga0315902_100751957 | 3300032093 | Freshwater | KEREAVIRFYGLGLEYPQCMEQIAEEMDVTGERARQLVRSGEKALASLPGIQMLAQYL |
| Ga0315902_105092953 | 3300032093 | Freshwater | YEQCMEQIAEELNVTGERARQLVRQAEVALSKMPGIKLLEQYR |
| Ga0315902_105644801 | 3300032093 | Freshwater | CMEQIAEELNVTGERARQLVRLAESALRAMPGIKLLEQYL |
| Ga0315903_105694171 | 3300032116 | Freshwater | GIGYEYAKPMEQIAEELGVTGERARQLVRLAEKGLQAMPGIKLLEQYL |
| Ga0335002_0690793_359_478 | 3300034020 | Freshwater | MDQIAEEMGVTNERARQLVRGAELALASLPGIELLEQYL |
| Ga0335005_0583895_473_592 | 3300034022 | Freshwater | MEQIGEEMGITNERARQLVRQAEIDLAKVPGIKLLEQYL |
| Ga0334987_0400776_712_867 | 3300034061 | Freshwater | MNYGIGYEYAKPMEQIAEELNITGERARQLVRLGEQSLRSLPGIKLLEQYL |
| Ga0334987_0730348_439_558 | 3300034061 | Freshwater | MDQIAEEMNVTNERARQLVRQAETALASLPGIELLAQYL |
| Ga0335025_0582899_42_161 | 3300034096 | Freshwater | MDQIAEEMGVTNERARQLVRGAETALTTVPGIELLEQYL |
| Ga0335035_0117735_2_112 | 3300034105 | Freshwater | IAEELDVTGERARQLVRQAELDLAKVPGIKLLAQYL |
| Ga0335036_0755726_1_111 | 3300034106 | Freshwater | IAEELDVTGERARQLVRAAEKTLSTMQGIELLEQYL |
| Ga0335048_0583014_344_463 | 3300034356 | Freshwater | MEQIAEELDVTGERARQLVRQAELDLAKVPGIKLLAQYL |
| ⦗Top⦘ |