| Basic Information | |
|---|---|
| Family ID | F046902 |
| Family Type | Metagenome |
| Number of Sequences | 150 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MNEDTPETVLGPVEERTAPLNVAGAVPQIVADDVTDDLKILLGEFEGPLDLL |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.33 % |
| % of genes from short scaffolds (< 2000 bps) | 95.33 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (64.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 25.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF00579 | tRNA-synt_1b | 84.67 |
| PF02163 | Peptidase_M50 | 8.67 |
| PF09821 | AAA_assoc_C | 0.67 |
| PF00749 | tRNA-synt_1c | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 84.67 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 84.67 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.00 % |
| Unclassified | root | N/A | 26.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0800307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4328 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_10669027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 537 | Open in IMG/M |
| 3300000559|F14TC_100496193 | All Organisms → cellular organisms → Bacteria | 3086 | Open in IMG/M |
| 3300000953|JGI11615J12901_10227431 | Not Available | 864 | Open in IMG/M |
| 3300000956|JGI10216J12902_104624916 | Not Available | 1021 | Open in IMG/M |
| 3300000956|JGI10216J12902_105742696 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300003993|Ga0055468_10040373 | Not Available | 1143 | Open in IMG/M |
| 3300004156|Ga0062589_100491494 | Not Available | 1031 | Open in IMG/M |
| 3300004156|Ga0062589_101300358 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300004157|Ga0062590_101734464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
| 3300004157|Ga0062590_102403301 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300004479|Ga0062595_100905494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300004480|Ga0062592_100563620 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300004480|Ga0062592_102550480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 515 | Open in IMG/M |
| 3300004643|Ga0062591_102593607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300005093|Ga0062594_100300940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1220 | Open in IMG/M |
| 3300005093|Ga0062594_103112018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 519 | Open in IMG/M |
| 3300005184|Ga0066671_10259467 | Not Available | 1074 | Open in IMG/M |
| 3300005280|Ga0065696_1279314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300005293|Ga0065715_10134371 | All Organisms → cellular organisms → Bacteria | 1956 | Open in IMG/M |
| 3300005293|Ga0065715_10830213 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005294|Ga0065705_10829553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300005294|Ga0065705_10845375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 594 | Open in IMG/M |
| 3300005294|Ga0065705_11084550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 526 | Open in IMG/M |
| 3300005295|Ga0065707_10478368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300005295|Ga0065707_10627894 | Not Available | 675 | Open in IMG/M |
| 3300005334|Ga0068869_100775646 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300005344|Ga0070661_101693017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 536 | Open in IMG/M |
| 3300005345|Ga0070692_10455215 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005345|Ga0070692_10798669 | Not Available | 644 | Open in IMG/M |
| 3300005345|Ga0070692_11101309 | Not Available | 561 | Open in IMG/M |
| 3300005354|Ga0070675_101251185 | Not Available | 683 | Open in IMG/M |
| 3300005364|Ga0070673_100436839 | Not Available | 1176 | Open in IMG/M |
| 3300005364|Ga0070673_101748929 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005440|Ga0070705_100218961 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300005457|Ga0070662_100332060 | Not Available | 1242 | Open in IMG/M |
| 3300005468|Ga0070707_100507227 | Not Available | 1168 | Open in IMG/M |
| 3300005545|Ga0070695_101577237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300005547|Ga0070693_101659269 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005549|Ga0070704_100946491 | Not Available | 777 | Open in IMG/M |
| 3300005549|Ga0070704_102061995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300005564|Ga0070664_100577666 | Not Available | 1041 | Open in IMG/M |
| 3300005577|Ga0068857_101187543 | Not Available | 738 | Open in IMG/M |
| 3300005577|Ga0068857_101335337 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300005578|Ga0068854_101475137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300005578|Ga0068854_102141405 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005618|Ga0068864_101008912 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005618|Ga0068864_101984488 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005618|Ga0068864_102312542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 544 | Open in IMG/M |
| 3300005719|Ga0068861_100844479 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300005840|Ga0068870_10646655 | Not Available | 724 | Open in IMG/M |
| 3300005841|Ga0068863_100710077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1000 | Open in IMG/M |
| 3300005841|Ga0068863_102293532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 549 | Open in IMG/M |
| 3300005843|Ga0068860_100218026 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300005883|Ga0075299_1019081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300006804|Ga0079221_10773603 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300006806|Ga0079220_11337625 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300006845|Ga0075421_102617888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 523 | Open in IMG/M |
| 3300006854|Ga0075425_100953985 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300006880|Ga0075429_100230470 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300006880|Ga0075429_100764202 | Not Available | 846 | Open in IMG/M |
| 3300006894|Ga0079215_10662683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 696 | Open in IMG/M |
| 3300006894|Ga0079215_11581783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 520 | Open in IMG/M |
| 3300006904|Ga0075424_101276159 | Not Available | 781 | Open in IMG/M |
| 3300006904|Ga0075424_101296177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 775 | Open in IMG/M |
| 3300007004|Ga0079218_10523789 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300009098|Ga0105245_10888351 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300009100|Ga0075418_10213408 | All Organisms → cellular organisms → Bacteria | 2055 | Open in IMG/M |
| 3300009100|Ga0075418_11853120 | Not Available | 656 | Open in IMG/M |
| 3300009101|Ga0105247_11033696 | Not Available | 644 | Open in IMG/M |
| 3300009101|Ga0105247_11536707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 544 | Open in IMG/M |
| 3300009147|Ga0114129_11479517 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300009147|Ga0114129_11485276 | Not Available | 833 | Open in IMG/M |
| 3300009156|Ga0111538_10348284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1875 | Open in IMG/M |
| 3300009156|Ga0111538_13204958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 570 | Open in IMG/M |
| 3300009156|Ga0111538_13679308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 531 | Open in IMG/M |
| 3300009174|Ga0105241_12045193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300009553|Ga0105249_12888026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 551 | Open in IMG/M |
| 3300009789|Ga0126307_10691362 | Not Available | 823 | Open in IMG/M |
| 3300010036|Ga0126305_10578272 | Not Available | 754 | Open in IMG/M |
| 3300010040|Ga0126308_11382235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 500 | Open in IMG/M |
| 3300010044|Ga0126310_11402889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 569 | Open in IMG/M |
| 3300010045|Ga0126311_11518143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 562 | Open in IMG/M |
| 3300010045|Ga0126311_11929554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 502 | Open in IMG/M |
| 3300010047|Ga0126382_11621618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300010362|Ga0126377_11150523 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300010375|Ga0105239_12800787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300010397|Ga0134124_10641558 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300010397|Ga0134124_11475399 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300010397|Ga0134124_11639932 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010399|Ga0134127_10049432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3474 | Open in IMG/M |
| 3300010399|Ga0134127_12736574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 573 | Open in IMG/M |
| 3300010400|Ga0134122_11169549 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300010400|Ga0134122_12762781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 543 | Open in IMG/M |
| 3300010401|Ga0134121_12454646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 563 | Open in IMG/M |
| 3300010403|Ga0134123_13574241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 504 | Open in IMG/M |
| 3300011119|Ga0105246_11822052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 582 | Open in IMG/M |
| 3300012189|Ga0137388_10376718 | Not Available | 1312 | Open in IMG/M |
| 3300012198|Ga0137364_10246681 | Not Available | 1319 | Open in IMG/M |
| 3300012200|Ga0137382_10345069 | Not Available | 1044 | Open in IMG/M |
| 3300012357|Ga0137384_10943434 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300012582|Ga0137358_10582645 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300012923|Ga0137359_10612054 | Not Available | 955 | Open in IMG/M |
| 3300012948|Ga0126375_10876628 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300012957|Ga0164303_10746451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300013306|Ga0163162_10218239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2037 | Open in IMG/M |
| 3300013307|Ga0157372_13363195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 509 | Open in IMG/M |
| 3300013308|Ga0157375_13511206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 522 | Open in IMG/M |
| 3300014325|Ga0163163_11939589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300014326|Ga0157380_10096049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2456 | Open in IMG/M |
| 3300014745|Ga0157377_10719329 | Not Available | 727 | Open in IMG/M |
| 3300014968|Ga0157379_10187268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1870 | Open in IMG/M |
| 3300015077|Ga0173483_10509510 | Not Available | 643 | Open in IMG/M |
| 3300015373|Ga0132257_102610973 | Not Available | 657 | Open in IMG/M |
| 3300018422|Ga0190265_10107571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2632 | Open in IMG/M |
| 3300018422|Ga0190265_12205996 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300018469|Ga0190270_12886047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 543 | Open in IMG/M |
| 3300019789|Ga0137408_1333087 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300022892|Ga0247753_1050365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 535 | Open in IMG/M |
| 3300025728|Ga0207655_1229573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 536 | Open in IMG/M |
| 3300025900|Ga0207710_10490089 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300025907|Ga0207645_10685260 | Not Available | 696 | Open in IMG/M |
| 3300025920|Ga0207649_11239876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 590 | Open in IMG/M |
| 3300025922|Ga0207646_10428470 | Not Available | 1194 | Open in IMG/M |
| 3300025923|Ga0207681_10243261 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300025923|Ga0207681_11820866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 508 | Open in IMG/M |
| 3300025925|Ga0207650_10313033 | Not Available | 1284 | Open in IMG/M |
| 3300025927|Ga0207687_11145954 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300025939|Ga0207665_11219308 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300025942|Ga0207689_10140075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1992 | Open in IMG/M |
| 3300025942|Ga0207689_11285980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300025981|Ga0207640_11447659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 616 | Open in IMG/M |
| 3300026035|Ga0207703_10473384 | Not Available | 1173 | Open in IMG/M |
| 3300026088|Ga0207641_10614790 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300026088|Ga0207641_11379890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300026095|Ga0207676_11635692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 642 | Open in IMG/M |
| 3300026121|Ga0207683_11328306 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300026142|Ga0207698_10873681 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300027886|Ga0209486_10496935 | Not Available | 757 | Open in IMG/M |
| 3300027909|Ga0209382_11204863 | Not Available | 774 | Open in IMG/M |
| 3300028138|Ga0247684_1062009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 609 | Open in IMG/M |
| 3300028380|Ga0268265_10585746 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300028381|Ga0268264_12322519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 543 | Open in IMG/M |
| 3300031548|Ga0307408_101723532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300031943|Ga0310885_10385630 | Not Available | 743 | Open in IMG/M |
| 3300031944|Ga0310884_10085411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1511 | Open in IMG/M |
| 3300032002|Ga0307416_100399026 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300032017|Ga0310899_10273301 | Not Available | 775 | Open in IMG/M |
| 3300032205|Ga0307472_101935889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 589 | Open in IMG/M |
| 3300033412|Ga0310810_10926160 | Not Available | 760 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 6.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Switchgrass Rhizosphere Bulk Soil | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005280 | Switchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soil | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005883 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
| 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_08003071 | 3300000033 | Soil | MSDETPDVVVESTEQAPVPLNVAGAIPQIVSDDTTDDLKVLLGEFEGPLDLLLHLIRQEX |
| ICChiseqgaiiFebDRAFT_106690272 | 3300000363 | Soil | MNDQTPETITETVEEQPAQLNVAGATPHIVPDDVTDDLKIL |
| F14TC_1004961931 | 3300000559 | Soil | MIDDAPDTPTELVEIPSTPLKVAGAVPQIVSDDVTDDLKILLGEFEGPLDLLLHLIRQEQVSIY |
| JGI11615J12901_102274312 | 3300000953 | Soil | MDEKIPETAEEHVAPLNVAGAVPHIVPDDDTDDLKILLGEFEGPLDLLLHL |
| JGI10216J12902_1046249162 | 3300000956 | Soil | MNEETPETGVETVDERPAQLNVAGASPHIVEDDTTDDLKILLGEFEGPLD |
| JGI10216J12902_1057426961 | 3300000956 | Soil | MNEETPETVVETIDERPAQLNVAGAAPHIVEDDATDDLKILLGEFEGPLD |
| Ga0055468_100403731 | 3300003993 | Natural And Restored Wetlands | MDEDTPETPVETVETRLAPLNVAGATPQIAPDDVTDELNIT |
| Ga0062589_1004914942 | 3300004156 | Soil | MDENTPEVTEERTAPLKVAGAVPHIVSDDQTDDLKILLGE |
| Ga0062589_1013003582 | 3300004156 | Soil | MDDNKTDLVEERAPLNVAGAVPQIVSDDTTDDLKILLGEFEGPLDLLLHLIRQEHVSIY |
| Ga0062590_1017344642 | 3300004157 | Soil | MDDETPETLPQKVEQAATQLNVAGAMPRIVEDDVTDDLKILLGEFEGPLDLLLHLIRQE |
| Ga0062590_1024033012 | 3300004157 | Soil | MNEETLETSVEAREESTPQSVASGAEPEVAAAAQLNVAGAMPQIVPDDVTDDLKILLGEFEGPLDLLLHLIRQEHVSIY |
| Ga0062595_1009054941 | 3300004479 | Soil | MSEETPDISEERAPLNVAGAVPQIVSDDTTDDLKILLGEFEGPLDLLLHLI |
| Ga0062592_1005636201 | 3300004480 | Soil | MDEETTKAAVKTVAERTTPLNVAGAMPHIVSDDVTDDLKILLGEFEGPLDLLLH |
| Ga0062592_1025504801 | 3300004480 | Soil | VTDDNTPETAVETAEERAPLNVAGAMPRIVSDDTTDDLKILLGEFEGPLDL |
| Ga0062591_1025936071 | 3300004643 | Soil | MDDNTPEISEERAPLNVAGAVPQIVADDVTDDLKILLGEFEGPLDLLLHLIRQE |
| Ga0062594_1003009401 | 3300005093 | Soil | MNEETPETVLQPAEERATPLNVAGAMPQIVTDDVTDDLKILLGEFEGPL |
| Ga0062594_1031120181 | 3300005093 | Soil | MNDDTPEAAALERVEERTAPLNVAGAVPHIVADDVTDDLKILLGEFEGPLDLLLH |
| Ga0066671_102594671 | 3300005184 | Soil | MDEETSEVRATPLKVAGAVPQIVADDTTDDLKILLGEFEG |
| Ga0065696_12793142 | 3300005280 | Switchgrass Rhizosphere Bulk Soil | MNEETPEVVETIEERQAPLNVAGATPHIISDDVTDDLKILLGEFEGPLDLLLHLI |
| Ga0065715_101343711 | 3300005293 | Miscanthus Rhizosphere | MDETPETSTELAEAQTTPLKVAGAVPQIVPDDVTDELKILLGEFEGPLDLL |
| Ga0065715_108302132 | 3300005293 | Miscanthus Rhizosphere | MDDNNPDVVEERAPLNVAGAVPHIVAGDNTDDLKILLGEFEGPLDLLLHLIRQEHVSIYD |
| Ga0065705_108295532 | 3300005294 | Switchgrass Rhizosphere | MSEDTPEAALETVAERSGPLNVARAVPHIVSDDVTDDLKILLGEFEGP |
| Ga0065705_108453751 | 3300005294 | Switchgrass Rhizosphere | MTMDETPETSKKSVEGQTTPLNVAGAVPQIVSDDLTDDLKILLGEFEGPLD |
| Ga0065705_110845502 | 3300005294 | Switchgrass Rhizosphere | MDEETSKAEPTAPLNVAGAVPHIVADDNTDDLKILLGEFEGPLDL |
| Ga0065707_104783681 | 3300005295 | Switchgrass Rhizosphere | MDENNPQETSEDRAAPLKVAGAVPQIVTDDDTDDLKILLGEFEGPLDLLLHLIRQ |
| Ga0065707_106278941 | 3300005295 | Switchgrass Rhizosphere | MNEDTPEAPLEERTVPLNVAGAVPQIVSDDVTDDLKILLGEFEGPL |
| Ga0068869_1007756462 | 3300005334 | Miscanthus Rhizosphere | MSDETPEVAIEATEQASVPLNVAGAVPQIVSDDTTDDLKVLLGEFEGPLD |
| Ga0070661_1016930171 | 3300005344 | Corn Rhizosphere | MVTADDTDLMDDNNPDVVEERAPLNVAGAVPHIVSDDNTDDLK |
| Ga0070692_104552151 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEETPKAEPAAQLNVAGAVPHIVSDDNTDDLKILLGEFEGPLDLL |
| Ga0070692_107986692 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEDTPDTIEERPTLLNVAGAVPQIVPDDLTDDLKIHLGEFDGPL |
| Ga0070692_111013092 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEETPETVLQPAEERATPLNVAGAMPQIVTDDVTDDLKIL |
| Ga0070675_1012511852 | 3300005354 | Miscanthus Rhizosphere | MNDNIPEAVETAEERTSLNVAGAVPQIVSDDTTDDLKILLGEFEGPLD |
| Ga0070673_1004368392 | 3300005364 | Switchgrass Rhizosphere | MDENNPQAALEISEERAAPLNVAGAIPQIVPDDDTDDLKILLGEFEGPLDL |
| Ga0070673_1017489292 | 3300005364 | Switchgrass Rhizosphere | MSDNTPETAIEAAEERTPLNVAGAVPQIVSDDTTDDLKILLGEFEGPLDLLLHLIRQE |
| Ga0070705_1002189611 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEETTKLEPGVPLNVAGAIPQIVRDDNTDDLKILLGEFEGPLDLLLHLIRQEHVSIYDI |
| Ga0070662_1003320601 | 3300005457 | Corn Rhizosphere | MDETPETSTELAEAQTTPLNVAGAIPQIVPDDVTDELKILLGEFEGPL |
| Ga0070707_1005072272 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LTEENTPETVVDAAAERPAPLNVAGAVPQIVADDNTDDLKILLG |
| Ga0070695_1015772372 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LDEEIQKTAVKTSETPLKVAGAVPRIVSDDVTDDLKILLGEFEGPLDLLLHLIRQEQVSI |
| Ga0070693_1016592691 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VDEETVAAPKEATTGTAEPTVTQLNVAGAVPRIVPDDVTDDLKILLGEFEGPLDLLLHLIRQEQVSIYD |
| Ga0070704_1009464911 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEETPETIVETVDGQPAPLNVAGATPHIVSDDLTDDLKILLGEFEGP |
| Ga0070704_1020619951 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEETPETVIETRDEVVTPLKVAGASPQIVADDVTDDLKILLGEFEGPLDLLLHLIRQEH |
| Ga0070664_1005776661 | 3300005564 | Corn Rhizosphere | MDEETSKAEPTGPLNVAGAIPQIVSDDNTDDLKILLGEFEGPLDL |
| Ga0068857_1011875432 | 3300005577 | Corn Rhizosphere | MDENNPQTPLNVAGAVPQIVSDDDTDDLKILLGEFE |
| Ga0068857_1013353372 | 3300005577 | Corn Rhizosphere | MDEDTPIEQPVAPLNVAGAVPRIVSDDTTDDLKILLGEFEGPLDLLL |
| Ga0068854_1014751371 | 3300005578 | Corn Rhizosphere | MSEEAPELIAETREETVTPLNVAGAVPQIVPDDATDDLKILLGEFEGPLDLLLHLIRQEQVSI |
| Ga0068854_1021414052 | 3300005578 | Corn Rhizosphere | MDETPETSTELAEAQTTPLNVAGAIPQIVPDDVTDELKILLGEFEGPLDLLLHLIRQ |
| Ga0068864_1010089121 | 3300005618 | Switchgrass Rhizosphere | LKDDFLSETGEERAPLNVAGAVPHIVSDDNTDDLKILLGEFEGPLDLL |
| Ga0068864_1019844881 | 3300005618 | Switchgrass Rhizosphere | MDENTPEDGEERVVLLNVAGAVPHIVADDNTDDLKILLGEFEGPLDLLLHLIRQE |
| Ga0068864_1023125422 | 3300005618 | Switchgrass Rhizosphere | MNEETPERVVETIEEQSAPLNVAGATPQIVADDVTDDLKILLGEFEGPLD |
| Ga0068861_1008444791 | 3300005719 | Switchgrass Rhizosphere | MDEDTPIEQPMAPLNVAGAVPRIVSDDNTDDLKILLGEFEGPLDL |
| Ga0068870_106466552 | 3300005840 | Miscanthus Rhizosphere | MDENNPQETSEDRAAPLNVAGAVPQIVADDESDDLKILLGE |
| Ga0068863_1007100772 | 3300005841 | Switchgrass Rhizosphere | MNDDTPEAAALERVEERTAPLNVAGAVPHIVADDVTDDLKILLGEFEGPLDLLLHLIRQEHVSIYD |
| Ga0068863_1022935322 | 3300005841 | Switchgrass Rhizosphere | MDENTPEVTEERTAPLKVAGAVPHIVSDDQTDDLKILLGEF |
| Ga0068860_1002180261 | 3300005843 | Switchgrass Rhizosphere | MDENRPEVTEERTAPLKVAGAVPHIVSDDQTDDLKILLGEFEGPLDLLLHLIRQEHV |
| Ga0075299_10190812 | 3300005883 | Rice Paddy Soil | LIDDTNPDLVEGRAPLNVAGAVPQIVSDDTTDDLKILLGEFEGPLDLLLHLIRQEHVSIY |
| Ga0079221_107736032 | 3300006804 | Agricultural Soil | MSEEAPELIVETREETVTPLNVAGAVPQIVSDEVTDDLKILLGEFEGPL |
| Ga0079220_113376252 | 3300006806 | Agricultural Soil | MSEETPDTSEERPPLNVAGAVPQIVTDDTTDDLKILL |
| Ga0075421_1026178882 | 3300006845 | Populus Rhizosphere | MDEETPDERPAPLNVAGASPHIVSDDVTDDLKILLGDF |
| Ga0075425_1009539851 | 3300006854 | Populus Rhizosphere | VELIVDEEIQESAVETSEAPLKVAGAVPRIVSDEITDDLKILLGEFEGPLDLLL |
| Ga0075429_1002304703 | 3300006880 | Populus Rhizosphere | VDDETPDIALETTEPAAAQINVAGAVPRIVSDDVTDDLKILLGEFEGPLDLLLHLI |
| Ga0075429_1007642022 | 3300006880 | Populus Rhizosphere | MNEDTPETVLGPVEERTAPLNVAGAVPQIVADDVTDDLKILLGEFEGPLDLL |
| Ga0079215_106626832 | 3300006894 | Agricultural Soil | MNEESPETVLETREESTTSLNVAGAMPQIVADDVTDDLKILLGEFEGPLDLLLHLIRQEHVS |
| Ga0079215_115817832 | 3300006894 | Agricultural Soil | MTENTPEATVEAREEATTPLNVAGAMPQIVSDDVTDDLKILLG |
| Ga0075424_1012761592 | 3300006904 | Populus Rhizosphere | MSEEAPELIAEKREESATPLNVAGAVPQIVTDDVTDDLKILLGEFEGPL |
| Ga0075424_1012961771 | 3300006904 | Populus Rhizosphere | VDEEIQKTAVKTSETPLKVAGAVPRIVSDDVTDDLKILLGEFEGPLDLLLHLIRQEQVSI |
| Ga0079218_105237892 | 3300007004 | Agricultural Soil | MNEETPETVLETVEERTAPLKVAGAVPQIVSDDVTDDLTILLGEFEGPLDLLLHLIRQEHVSIYD |
| Ga0105245_108883511 | 3300009098 | Miscanthus Rhizosphere | MDENKQLEISEERSAPLNVAGAVPQIVPDDDTDDLKILLGEFEGPLD |
| Ga0075418_102134081 | 3300009100 | Populus Rhizosphere | MNEDTPETVLGPVEERTAPLNVAGAVPQIVADDVTDDLKILLGEFEGP |
| Ga0075418_118531202 | 3300009100 | Populus Rhizosphere | MNEETPETVVETVEGQSAPLNVAGATPQIVSDDNTDDL |
| Ga0105247_110336961 | 3300009101 | Switchgrass Rhizosphere | MNEETPETIVETVDGQTAPLNVAGATPHIVSDDLTDDLKILLGEFEGPLDLLL |
| Ga0105247_115367071 | 3300009101 | Switchgrass Rhizosphere | MSEETPDISEERAPLNVAGAVPQIVADDTTDDLKILLGEFEGPLDLLLHLIRQEHVSIYD |
| Ga0114129_114795172 | 3300009147 | Populus Rhizosphere | MDEETSKAEPAAQLNVAGAVPHIVADDNTDDLKILLGEFEGPLDLLLHLIRQEHVSI |
| Ga0114129_114852762 | 3300009147 | Populus Rhizosphere | MTMDETPKTSTESAEGQTTPLNVAGAVPQIVSDDLTDDLKILLGEFEGPLDLLLH |
| Ga0111538_103482841 | 3300009156 | Populus Rhizosphere | MTMDETPKTSTESAEGQTTPLNVAGAVPQIVSDDLTDDLKILLGEFEG |
| Ga0111538_132049582 | 3300009156 | Populus Rhizosphere | MDDVPESTGVEPAEQPNATLNVAGAVLRLAPDDITDDIKIFLGEFEGPLDLLL |
| Ga0111538_136793081 | 3300009156 | Populus Rhizosphere | MNDDTPEVAALERVEERTAPLNVAGAVPHIVADDVTDDLKILLGEF |
| Ga0105241_120451931 | 3300009174 | Corn Rhizosphere | MDENNPQAQLNVAGAVPQIVSDDDTDDLKILFGEF |
| Ga0105249_128880262 | 3300009553 | Switchgrass Rhizosphere | VTEDITPEIAVETTEARAPLNVAGAIPHIVSDDTTDDLKILLGEFEGPL |
| Ga0126307_106913622 | 3300009789 | Serpentine Soil | LIDDNNPDTVEERATLNVAGAMPHIVADDTTDDLKILLGEFEGPLDLLLHLIR |
| Ga0126305_105782721 | 3300010036 | Serpentine Soil | LKKNEDTTEPSAKVVETRTAQLNVAGAVPQIVSDDLTDDLKILLGEFEGPLD |
| Ga0126308_113822351 | 3300010040 | Serpentine Soil | MDEDTLEPRTALLNVAGATPQIVSDDVTDDLKIVLGEF |
| Ga0126310_114028892 | 3300010044 | Serpentine Soil | MNEDTPKTTLETVEQRTAPLNVAGAVPHITANDVTDDLTIRLGEFEGPL |
| Ga0126311_115181431 | 3300010045 | Serpentine Soil | LTDDNIPETAEERAPLNVAGAVPHIVADDNTDELTIRLG |
| Ga0126311_119295542 | 3300010045 | Serpentine Soil | VEENTPKARLETMEERTAPLNVAGAVPQIVSDDTTDDLKILLGEFEGPLDLLLHLIRQEHVS |
| Ga0126382_116216182 | 3300010047 | Tropical Forest Soil | LDEETPKVEPAAPLNVAGAVPQIVPDDNTDDLKILLGEFEGPLDL |
| Ga0126377_111505231 | 3300010362 | Tropical Forest Soil | MSEDTPEMVTETVEERPTPLKVAGAVPQIVPDDVTDDLKILLGEFEGPLDL |
| Ga0105239_128007872 | 3300010375 | Corn Rhizosphere | VTDDNTPETAVAEERAPLNVAGAVPQIVSDDTTDDLKILLGEFE |
| Ga0134124_106415582 | 3300010397 | Terrestrial Soil | MDDNNPQTPLNVAGAVPHIVPDDDSDDLKILLGEFEGPLDLLLHLIRQE |
| Ga0134124_114753991 | 3300010397 | Terrestrial Soil | MSEETPDDRPVPLNVAGAAPQIVADDVTDDLKILLGEFEGPLDLL |
| Ga0134124_116399321 | 3300010397 | Terrestrial Soil | MDENNPQAPLNVAGAVPQIVPDDDTDDLKILLGEF |
| Ga0134127_100494325 | 3300010399 | Terrestrial Soil | MDETPETSKELAEPQTTPLNVAGAIPQIVADDLTDDLKILLGEFE |
| Ga0134127_127365742 | 3300010399 | Terrestrial Soil | MDENNPQEISEERAAPLNVAGAVPQIVADDDTDDLKILLGEFEGPLDLLLHLIRQEHV |
| Ga0134122_111695492 | 3300010400 | Terrestrial Soil | MDDNNPDVVEERAPLNVAGAVPHIVSDDNTDDLKILLGEFEGPLDSLLHLIRQEHVSI* |
| Ga0134122_127627811 | 3300010400 | Terrestrial Soil | MDEETSKVEPTASLNVAGAVPHIVADDNTDDLKILLGEFEGPLDLLLHLIR |
| Ga0134121_124546462 | 3300010401 | Terrestrial Soil | VDEEIQKTAVETSETPLKVAGAVPRIVADDVTDDLKILLGEFEGPLDLLLHLIR |
| Ga0134123_135742412 | 3300010403 | Terrestrial Soil | MMSEEAPELIVETQEESVTPLKVAGAMPHIVPDDVTDDLKILLGEFEGPLDLL |
| Ga0105246_118220522 | 3300011119 | Miscanthus Rhizosphere | MDDNPEISEERTPLNVAGAVPQIVSDDTTDDLKILLGEFEGPLDLLLHLIR |
| Ga0137388_103767183 | 3300012189 | Vadose Zone Soil | MDDTPETTVEPTDQPSAPLKVAGAMPQIVSDDTTDDLKLLLGEFEGPLDL |
| Ga0137364_102466811 | 3300012198 | Vadose Zone Soil | MDDTPETTREATDKAPVQLKVAGAVPQIVSDDMTDDLKILLGEFEG |
| Ga0137382_103450692 | 3300012200 | Vadose Zone Soil | VKMDDTRETATDQVAAPLKVAGAKPHIVSDDVTDDLKILLGEFEGPLDLLLH |
| Ga0137384_109434341 | 3300012357 | Vadose Zone Soil | MDDSPETTVEPTDQPSAPLKVAGAMPQIVSDDTTDDLKLLLGEFEGPLDLLL |
| Ga0137358_105826451 | 3300012582 | Vadose Zone Soil | MDETPETALEPTDQPSAPLKVAGAMPQIVSDDTTDDLKILLGEFEGPLDLLLHLIRQ |
| Ga0137359_106120541 | 3300012923 | Vadose Zone Soil | MDETPETALEPTDQPSAPLKVAGAMPQIVSDDTTDDLKILLGEFEGPLDL |
| Ga0126375_108766281 | 3300012948 | Tropical Forest Soil | MTDDTPETAMDTVEQSSAPLNVAGATPRIVPDDVTDDLKILLGEFEGPLDLLLHLIRQEQVS |
| Ga0164303_107464511 | 3300012957 | Soil | MDENNPQEISQDRVGQLKVAGAVPHIVSDDDTDDLKILLGEFEGPLDLLLHLIRQEHVSIYDI |
| Ga0163162_102182391 | 3300013306 | Switchgrass Rhizosphere | MNEDTPDTVEERPTLLNVAGAVPQIVPDDLTDDLKIHLGEFEGPLDLLLHLI |
| Ga0157372_133631951 | 3300013307 | Corn Rhizosphere | MNDQTPETAAQPAVEEQPAPLNVAGATPQIVSDDVTDDLKILLGEFEG |
| Ga0157375_135112061 | 3300013308 | Miscanthus Rhizosphere | MDDNNPDVVEERAPLNVAGAVPHIVAGDNTDDLKILLGDFEGPL |
| Ga0163163_119395892 | 3300014325 | Switchgrass Rhizosphere | MTMDEETPKLEAVTPLNVAGAVPHIVSDDDTDDLKILLGEFEGPLDLLLHLIRQEHVSI |
| Ga0157380_100960491 | 3300014326 | Switchgrass Rhizosphere | MDDETPETLPQKVEQAATQLNVAGAMPRIVEDDVTDDLKILLGEFEGPLDLLLHL |
| Ga0157377_107193291 | 3300014745 | Miscanthus Rhizosphere | VTDDNTPDTAVETAEERAPLNVAGAVPHIVADDNTDDLKILLGEFEGPLDLLLHLIR |
| Ga0157379_101872681 | 3300014968 | Switchgrass Rhizosphere | MDENTPEVTEERTAPLKVAGAVPHIVSDDQTDDLKILLGEFEGPLDLLLHLIRQEHVS |
| Ga0173483_105095102 | 3300015077 | Soil | MDDNPEISEERTPLNVAGAVPQIVTDDTTDDLKILLG |
| Ga0132257_1026109732 | 3300015373 | Arabidopsis Rhizosphere | MDETPESIAAEPAEQTNATLNVAGAVPRLAPDDITDDIKIFLGEFEGPLDL |
| Ga0190265_101075714 | 3300018422 | Soil | MNEETPETVVEVVEERAAPLKVAGAVPRIVSNDVTDDLTILLGEF |
| Ga0190265_122059962 | 3300018422 | Soil | MNDQTPETVAEPVEKPAPLNVAGATPQIVSDDVTDDLKIRLGEFEGPLDLLLHLIR |
| Ga0190270_128860472 | 3300018469 | Soil | VEDESPETVVKQVTQSSTQLNVAGAMPRIVSDDLTDDLKILLGEFEGPLDLLLHLIRQE |
| Ga0137408_13330871 | 3300019789 | Vadose Zone Soil | MDEIPKAAQERTEQSSTTLSVAGASPEEIVADNLTDDLKIVLGEFEGPLDLLLHL |
| Ga0247753_10503651 | 3300022892 | Soil | MDENTPEVTEERTAPLKVAGAVPHIVSDDQTDDLKILLGEFEGPLDLLLHLIRQEH |
| Ga0207655_12295731 | 3300025728 | Miscanthus Rhizosphere | MDETKPQAVVETSEDRAAPLNVAGAVPHIVADDDTDDLKILLGEFEGPLDLLLHLIRQE |
| Ga0207710_104900891 | 3300025900 | Switchgrass Rhizosphere | MDDNNPQTPLNVAGAVPHIVPDDDSDDLKILLGEFEGPLDL |
| Ga0207645_106852602 | 3300025907 | Miscanthus Rhizosphere | MDDNPEISEERTPLNVAGAVPQIVTDDTTDDLKILLGEFEGPL |
| Ga0207649_112398762 | 3300025920 | Corn Rhizosphere | MVTADDTDLMDDNNPDVVEERAPLNVAGAVPHIVSDDNTDDLKILLGEFE |
| Ga0207646_104284702 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LTEENTPETVVDAAAERPAPLNVAGAVPQIVADDNTDDLKILLGEFEGPLDLLLHLIRQE |
| Ga0207681_102432613 | 3300025923 | Switchgrass Rhizosphere | MDDETPETLPQKVEQAATQLNVAGAMPRIVEDDVTDDLKILLGEFEGPLDLL |
| Ga0207681_118208661 | 3300025923 | Switchgrass Rhizosphere | MDETPETSTELAEAQTTPLNVAGAIPQIVPDDVTDELKILLGEF |
| Ga0207650_103130332 | 3300025925 | Switchgrass Rhizosphere | MNEDTPDTIEERPTLLNVAGAVPQIVPDDLTDDLKIHLGEFEGPLDLLLHLIRQ |
| Ga0207687_111459541 | 3300025927 | Miscanthus Rhizosphere | MDENKPLEISEERSAPLNVAGAVPQIVPDDDTDDLKILLGEFEGPLD |
| Ga0207665_112193081 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEAPELIAETREESVTPLNVAGAVPQIVSDDTTDDLKILLGEFEGPLDLLLHLIRQEQVSI |
| Ga0207689_101400751 | 3300025942 | Miscanthus Rhizosphere | MKEDTPDTVEERTTLLNVAGAVPQIVPDDLTDDLKIHLGEFEGPLDLLLHLIRQEQVS |
| Ga0207689_112859802 | 3300025942 | Miscanthus Rhizosphere | MDENNPPETSEDRAAPLNVAGAIPHIVSDDDTDDLKILLGEFEG |
| Ga0207640_114476591 | 3300025981 | Corn Rhizosphere | MDEETPIEQPVVPLNVAGAVPRIVSDDNTDDLKILLGEFEGPLDLLL |
| Ga0207703_104733841 | 3300026035 | Switchgrass Rhizosphere | MDENTPEVTEERTAPLKVAGAVPHIVSDDQTDDLKILLGEFE |
| Ga0207641_106147903 | 3300026088 | Switchgrass Rhizosphere | VDEDTPETVLETTGQVTAQLNVAGAMPTIVSDDVTDDLKVLLGEFEGPLDLLLH |
| Ga0207641_113798902 | 3300026088 | Switchgrass Rhizosphere | MSEETPDDRPVLLNVAGAAPQIVPDDVTDDLKILLGE |
| Ga0207676_116356921 | 3300026095 | Switchgrass Rhizosphere | MSEEAPELIVETREESATPLNVAGAVPQIVTDDVTDDLKILLGEFEGPL |
| Ga0207683_113283062 | 3300026121 | Miscanthus Rhizosphere | LKDDYLSETGEERAPLNVAGAVPHIVSDDNTDDLKILLGEFE |
| Ga0207698_108736812 | 3300026142 | Corn Rhizosphere | MNEDTPERVMEAAEERATPLKVAGAVPQIVSDDVTDDLKILLG |
| Ga0209486_104969352 | 3300027886 | Agricultural Soil | MSEDTPDERPALLKVAGAAPQIVADDVTDDLKILLGEFEGPL |
| Ga0209382_112048632 | 3300027909 | Populus Rhizosphere | MDEETPDERPAPLNVAGASPHIVSDDVTDDLKILLGDFEGPL |
| Ga0247684_10620091 | 3300028138 | Soil | MNEEPKSEETTAPLNVAGAVPQIVPDDLTDDLKILLGEFEGPLDLLLHLIRHEH |
| Ga0268265_105857462 | 3300028380 | Switchgrass Rhizosphere | MDEDTPIEQPVAPLNVAGAVPRIVSDDTTDDLKILLGEFEGPLDLLLHLIRQ |
| Ga0268264_123225191 | 3300028381 | Switchgrass Rhizosphere | MDENRPEVTEERTAPLKVAGAVPHIVSDDQTDDLKILLGEFEGPLDLLLHLIRQEHVS |
| Ga0307408_1017235321 | 3300031548 | Rhizosphere | MSEDTPDERPALLNVAGAAPQIVADDVTDDLKILLGEFEGPLDLLL |
| Ga0310885_103856301 | 3300031943 | Soil | MTMDETPETSKESAEGQTAPLKVAGAVPQIVSDDLTDDLKILLGEFEGP |
| Ga0310884_100854113 | 3300031944 | Soil | MTMDETPETVKESVEGQTTPLNVAGAVPQIVSDDLTDDLKILLGEFEGPLDLL |
| Ga0307416_1003990263 | 3300032002 | Rhizosphere | MDEDTPVEQPTAPLNVAGAVPHIVSDDNTDDLKILLGEFEGPLDLLLHLIRQEQV |
| Ga0310899_102733011 | 3300032017 | Soil | MTMDETPETAKESVEGQTTPLNVAGAVPQIVSDDLTDDLKILLGEFEGP |
| Ga0307472_1019358892 | 3300032205 | Hardwood Forest Soil | VDEENPETIVKTSEAPLNVAGAVPKIVSDDVTDDLKILLGEFEGPLDLLLH |
| Ga0310810_109261601 | 3300033412 | Soil | MDENNPQTPLNVAGAVPQIVSDDDTDDLKILLGEFEGPLDLLLHLI |
| ⦗Top⦘ |