| Basic Information | |
|---|---|
| Family ID | F046880 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKNVTLDRTTVLQLDADGTDGALDAAADCDVLRNDAALDLCAIAD |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.72 % |
| % of genes near scaffold ends (potentially truncated) | 84.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.67 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.68% β-sheet: 0.00% Coil/Unstructured: 49.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF04519 | Bactofilin | 3.33 |
| PF12697 | Abhydrolase_6 | 3.33 |
| PF04392 | ABC_sub_bind | 2.67 |
| PF01527 | HTH_Tnp_1 | 1.33 |
| PF13750 | Big_3_3 | 0.67 |
| PF11975 | Glyco_hydro_4C | 0.67 |
| PF00589 | Phage_integrase | 0.67 |
| PF00211 | Guanylate_cyc | 0.67 |
| PF12146 | Hydrolase_4 | 0.67 |
| PF13276 | HTH_21 | 0.67 |
| PF06808 | DctM | 0.67 |
| PF01068 | DNA_ligase_A_M | 0.67 |
| PF11154 | DUF2934 | 0.67 |
| PF02371 | Transposase_20 | 0.67 |
| PF00561 | Abhydrolase_1 | 0.67 |
| PF13701 | DDE_Tnp_1_4 | 0.67 |
| PF13191 | AAA_16 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 3.33 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.67 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.67 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.67 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.67 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.33 % |
| Unclassified | root | N/A | 2.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig16405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1339 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10107860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300000956|JGI10216J12902_101807693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300000956|JGI10216J12902_121713902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300004629|Ga0008092_11243078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300005165|Ga0066869_10011059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1234 | Open in IMG/M |
| 3300005332|Ga0066388_100072009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3770 | Open in IMG/M |
| 3300005332|Ga0066388_101481774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1185 | Open in IMG/M |
| 3300005332|Ga0066388_101659799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1128 | Open in IMG/M |
| 3300005332|Ga0066388_102850828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 883 | Open in IMG/M |
| 3300005439|Ga0070711_100472435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1029 | Open in IMG/M |
| 3300005467|Ga0070706_100599820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1023 | Open in IMG/M |
| 3300005468|Ga0070707_100965050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 817 | Open in IMG/M |
| 3300005471|Ga0070698_100024586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6284 | Open in IMG/M |
| 3300005518|Ga0070699_100409592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1226 | Open in IMG/M |
| 3300005536|Ga0070697_101922668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300005553|Ga0066695_10236372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1152 | Open in IMG/M |
| 3300005713|Ga0066905_100342438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1191 | Open in IMG/M |
| 3300005713|Ga0066905_100894620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300005713|Ga0066905_101301843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300005713|Ga0066905_101708318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300005713|Ga0066905_101844973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300005764|Ga0066903_104643959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300005764|Ga0066903_106396969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 614 | Open in IMG/M |
| 3300005764|Ga0066903_106573237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300005764|Ga0066903_107606780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300005764|Ga0066903_107920986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300005764|Ga0066903_108974520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300005937|Ga0081455_10218080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1416 | Open in IMG/M |
| 3300006038|Ga0075365_10667456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300006041|Ga0075023_100423432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300006853|Ga0075420_101225792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300006969|Ga0075419_10778842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300009840|Ga0126313_10723219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 807 | Open in IMG/M |
| 3300010046|Ga0126384_11186751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300010376|Ga0126381_101281555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Chelatococcaceae → Chelatococcus → Chelatococcus daeguensis | 1059 | Open in IMG/M |
| 3300011107|Ga0151490_1334601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300012204|Ga0137374_10071899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3402 | Open in IMG/M |
| 3300012204|Ga0137374_10374798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1140 | Open in IMG/M |
| 3300016270|Ga0182036_10360489 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300016270|Ga0182036_10697573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300016294|Ga0182041_10963573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 770 | Open in IMG/M |
| 3300016319|Ga0182033_10177300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1674 | Open in IMG/M |
| 3300016319|Ga0182033_10789640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 836 | Open in IMG/M |
| 3300016341|Ga0182035_10140612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1838 | Open in IMG/M |
| 3300016341|Ga0182035_10536355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1004 | Open in IMG/M |
| 3300016357|Ga0182032_11051238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300016357|Ga0182032_11410944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300016371|Ga0182034_11197566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300016387|Ga0182040_11401303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300016422|Ga0182039_10961294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300016445|Ga0182038_11002559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 739 | Open in IMG/M |
| 3300016445|Ga0182038_11665549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300017997|Ga0184610_1145565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300018031|Ga0184634_10154011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1033 | Open in IMG/M |
| 3300018071|Ga0184618_10125778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1028 | Open in IMG/M |
| 3300018077|Ga0184633_10526435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300018468|Ga0066662_11711070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300020579|Ga0210407_10965781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300020579|Ga0210407_11349217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300021078|Ga0210381_10153423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300021080|Ga0210382_10340242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300021361|Ga0213872_10254925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
| 3300021439|Ga0213879_10255181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300021479|Ga0210410_10755914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 856 | Open in IMG/M |
| 3300021560|Ga0126371_12879614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300025910|Ga0207684_10448940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1107 | Open in IMG/M |
| 3300025910|Ga0207684_10727082 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 842 | Open in IMG/M |
| 3300025933|Ga0207706_11170462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300026374|Ga0257146_1082834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300028704|Ga0307321_1083697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300028784|Ga0307282_10484492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300028807|Ga0307305_10390241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300028819|Ga0307296_10542296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300028872|Ga0307314_10113954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300030905|Ga0308200_1089675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300031099|Ga0308181_1049128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300031099|Ga0308181_1080640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300031199|Ga0307495_10172347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300031545|Ga0318541_10197265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1113 | Open in IMG/M |
| 3300031545|Ga0318541_10487943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 689 | Open in IMG/M |
| 3300031546|Ga0318538_10804225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300031546|Ga0318538_10830524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300031549|Ga0318571_10306291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300031573|Ga0310915_11085064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300031679|Ga0318561_10429482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300031681|Ga0318572_10274710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 993 | Open in IMG/M |
| 3300031681|Ga0318572_10835434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300031719|Ga0306917_11581998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300031744|Ga0306918_10861332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300031744|Ga0306918_11237183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300031747|Ga0318502_10400624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
| 3300031748|Ga0318492_10705763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300031764|Ga0318535_10463381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300031764|Ga0318535_10488400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300031768|Ga0318509_10784207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300031771|Ga0318546_10509224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 845 | Open in IMG/M |
| 3300031777|Ga0318543_10284111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 739 | Open in IMG/M |
| 3300031777|Ga0318543_10470812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300031778|Ga0318498_10278849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300031781|Ga0318547_10400482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 842 | Open in IMG/M |
| 3300031781|Ga0318547_10810305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300031792|Ga0318529_10253167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 819 | Open in IMG/M |
| 3300031792|Ga0318529_10488926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300031794|Ga0318503_10239537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300031794|Ga0318503_10260136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300031796|Ga0318576_10638171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300031798|Ga0318523_10611246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300031805|Ga0318497_10708298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300031821|Ga0318567_10386998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300031832|Ga0318499_10280846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300031845|Ga0318511_10382429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 643 | Open in IMG/M |
| 3300031879|Ga0306919_10349274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1129 | Open in IMG/M |
| 3300031879|Ga0306919_11104636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300031890|Ga0306925_11733227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300031894|Ga0318522_10359538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300031910|Ga0306923_10598109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1238 | Open in IMG/M |
| 3300031910|Ga0306923_11607198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300031910|Ga0306923_12319979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300031912|Ga0306921_10389844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1626 | Open in IMG/M |
| 3300031912|Ga0306921_10490795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1428 | Open in IMG/M |
| 3300031912|Ga0306921_12095081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300031941|Ga0310912_11402877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300031945|Ga0310913_11102079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300031954|Ga0306926_12464874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300031959|Ga0318530_10231969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300031959|Ga0318530_10425770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300032009|Ga0318563_10726473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300032025|Ga0318507_10444213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300032025|Ga0318507_10549476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300032035|Ga0310911_10393601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 801 | Open in IMG/M |
| 3300032035|Ga0310911_10543926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300032035|Ga0310911_10871553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300032039|Ga0318559_10517500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300032043|Ga0318556_10032089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2450 | Open in IMG/M |
| 3300032051|Ga0318532_10103179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1005 | Open in IMG/M |
| 3300032052|Ga0318506_10102592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1223 | Open in IMG/M |
| 3300032059|Ga0318533_10183434 | Not Available | 1493 | Open in IMG/M |
| 3300032059|Ga0318533_11043932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300032060|Ga0318505_10171799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1009 | Open in IMG/M |
| 3300032065|Ga0318513_10010689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3574 | Open in IMG/M |
| 3300032066|Ga0318514_10361472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300032066|Ga0318514_10684747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300032094|Ga0318540_10259852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 838 | Open in IMG/M |
| 3300032094|Ga0318540_10562779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300033289|Ga0310914_10485805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1117 | Open in IMG/M |
| 3300033290|Ga0318519_10509385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.33% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.33% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.67% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.67% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.67% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.67% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.67% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.67% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0405.00001460 | 2166559005 | Simulated | MKNVTLDRTTVLQLDADGTDGALDAAADCDVLRNDAALDLCAIAD |
| AF_2010_repII_A1DRAFT_101078601 | 3300000597 | Forest Soil | MKNVTLDRTTVLQLDADGTDSALDAAADCHVLRNDVALDLCAIVDLEIQ |
| JGI10216J12902_1018076931 | 3300000956 | Soil | MKNVALDGTTVLELDADSTDGALDMAADRDVLRNDAALDLC |
| JGI10216J12902_1217139022 | 3300000956 | Soil | MKNITLDRTAVLQLDVNGADSALDAAADCDVLRDNDALDLCAIAD |
| Ga0008092_112430781 | 3300004629 | Tropical Rainforest Soil | MKNVTLDRTTVLQLDADGTDRALDAAADCEVLRNDAALDLCAI |
| Ga0066869_100110592 | 3300005165 | Soil | MKNVTLDRTTALQLDANGTDSALDAATDCHVLRNDAALDLRAIADLEI* |
| Ga0066388_1000720091 | 3300005332 | Tropical Forest Soil | MKNITLDRTTVIQLDADGTDSALDAAADCDVLRNNTPLDLCAI |
| Ga0066388_1014817743 | 3300005332 | Tropical Forest Soil | MKNVTLDRTAILQLDAVGTYGALNAAADCDGLRNDVALDLRAIADLEI* |
| Ga0066388_1016597993 | 3300005332 | Tropical Forest Soil | MKNVTLDRATVLQLDADGTDSALDAAADCDVLRNDVALDLCAIADQELRGAQ |
| Ga0066388_1028508282 | 3300005332 | Tropical Forest Soil | MKNVTFDRTTVLQLDADGTDSALDAAADCNALRNDVALDLCAIADQE |
| Ga0070711_1004724351 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIALDRTTVLQLHADSTDGALDAAADRDVLRNDAALDLR |
| Ga0070706_1005998201 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNVTLDRATVLQLDADGTDSALDAAADCHVLRNDAALDVCAVAD |
| Ga0070707_1009650501 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNVTLDRTTVLQLDADGTDSALDAAADCNALRNDVALDLCAIADQ |
| Ga0070698_1000245861 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNVTLDRTTVLQLDADGTDSALDAAADCNALRNDVALDLCAIA |
| Ga0070699_1004095922 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNVTLDRTTVLQLDADGTDSALDAAADCNALRNDVALDLCAIADQEI |
| Ga0070697_1019226681 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNVALNRPTVLQLDADGTDGALDAAADCDVLRNDAALDLCAIAD |
| Ga0066695_102363722 | 3300005553 | Soil | MKNVALDRTTVLQLHADGTDGALDAAADCDVLRNDAALDLCAITD* |
| Ga0066905_1003424381 | 3300005713 | Tropical Forest Soil | MKNIALDRTTVLQLDAIGTDSALDAAADCHVLRNDVALDLCAIA |
| Ga0066905_1008946202 | 3300005713 | Tropical Forest Soil | MKNVSLDRATVLQLDADGTDGAFDVATDRDVLRKHAAIDRCAFADQEI |
| Ga0066905_1013018431 | 3300005713 | Tropical Forest Soil | MKNVTLDRATILQLDADGSDSALDSAADCDALRNDGALDLRAIAN |
| Ga0066905_1017083181 | 3300005713 | Tropical Forest Soil | MKNVALDRATALQSDANGTDSALDAAADCHVLRND |
| Ga0066905_1018449732 | 3300005713 | Tropical Forest Soil | MKNVTFDRTTVLQLDADGTDSALDPAADCHVLRNDAALD |
| Ga0066903_1046439591 | 3300005764 | Tropical Forest Soil | MKNITLDRTTVLQLDAIGTDSALDAAADCNGLRNDVALDLCAI |
| Ga0066903_1063969691 | 3300005764 | Tropical Forest Soil | MENVTLDCSSLLQLDADGTDGALDAAADCYFLRNDVALDLSAI |
| Ga0066903_1065732371 | 3300005764 | Tropical Forest Soil | VRWILNPPRRSFKLRVLVDRQRPMKNVTLDRATALQLDANGTDSALDAAADCHVLRNDAALDLCAIADQEL* |
| Ga0066903_1076067801 | 3300005764 | Tropical Forest Soil | MKNVTIDGTTVLQLDVDGADSAFHPATDRDLLRKDTALDLCAIA |
| Ga0066903_1079209861 | 3300005764 | Tropical Forest Soil | MKNVTLDRTTALQLDANGTDSALDAAADCHVLRNDAALDLCAIA |
| Ga0066903_1089745201 | 3300005764 | Tropical Forest Soil | MKNVTLDRTTVLQLDADGADSALDPAADCNALRNDVALDLC |
| Ga0081455_102180802 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKDVTLDRTTVLQLDADGTDRALDAAADCDVLRNDASLDLCAIAD* |
| Ga0075365_106674562 | 3300006038 | Populus Endosphere | MKNVALDRATALQFDANGTDSALDAAADCHALRNDAALDL |
| Ga0075023_1004234322 | 3300006041 | Watersheds | MKNVTLDRATALQLDANGTDSALDAAADCHVLRNDAALD |
| Ga0075420_1012257921 | 3300006853 | Populus Rhizosphere | MKNVTLDRTTVLQLDANGTDSALDAAADCHVLRNDAALDL |
| Ga0075419_107788421 | 3300006969 | Populus Rhizosphere | MKDVTLDRTTVLQLDSDGTDSALDAAADCDVLRNDVALDLSAIADQEL* |
| Ga0126313_107232192 | 3300009840 | Serpentine Soil | MKNFALDRTTVLQPDADRTDGALDAAADRDVLRIYGALDLRAGWI* |
| Ga0126384_111867513 | 3300010046 | Tropical Forest Soil | MKHITIDSTTVLQLDADGTDSALDAAADCNALRND |
| Ga0126381_1012815551 | 3300010376 | Tropical Forest Soil | MKNVTLDRATVLQLDADGTDSALDAAADCDVLRNDVALDLCAIAD |
| Ga0151490_13346012 | 3300011107 | Soil | MKNVTLDRTTVLQLDADGTDSALDATADCDVLRNDAALDLCAIAD* |
| Ga0137374_100718991 | 3300012204 | Vadose Zone Soil | MKNVALDRTTFLQLDADRTDGALHAAADCDVLRNDAALDLCAIAD* |
| Ga0137374_103747982 | 3300012204 | Vadose Zone Soil | MGARGVRRAPTKNVALDRTTFLQLDADRTDGALHAAGDCDVLRNDAALDLCAIAD* |
| Ga0182036_103604891 | 3300016270 | Soil | MKNVTLDRATVLQLDAYGTDSALDAAADCHVLRNDAALDLCAIADLEI |
| Ga0182036_106975732 | 3300016270 | Soil | MKNVTLDHTTILQLDTVGTDSALDAAADCHILRNDAALDMCAIA |
| Ga0182041_109635731 | 3300016294 | Soil | MKNITLDRTTVLQLDADGTDSALDAAADCHVLRNDAALDLCAIADLEIRGAQF |
| Ga0182033_101773004 | 3300016319 | Soil | MKNVTLDRAAVLQLDANGMDSALDAAADCHVLRNDAALDLCAIADLEI |
| Ga0182033_107896402 | 3300016319 | Soil | MKNITLDRTTVLQLDAHGTDSALDAAADCNALRNDVALDLCAIADQEIRGAQ |
| Ga0182035_101406121 | 3300016341 | Soil | NVTLNRATVLQLDADGTDGALDAAADCHVLRNDAALDLCAIADLEI |
| Ga0182035_105363551 | 3300016341 | Soil | MKDVTLDRTTVLQLDADGTNGALDPAADCDVLRNDASLD |
| Ga0182032_110512381 | 3300016357 | Soil | MKNVTLDHTTVLQLDADSMDGALDAAADCHVLRNDAA |
| Ga0182032_114109441 | 3300016357 | Soil | MKNVTLDHATALQLDANGTDSALDAAADCHVLRNDAALDLCAI |
| Ga0182034_111975661 | 3300016371 | Soil | MKNITLDRTTVLQLDANGTDSALDAATDCHVLRNDAAL |
| Ga0182040_114013031 | 3300016387 | Soil | MKNVTLDRAIVLQLNADGTDSALDAAADCDVLRNDAALEVCA |
| Ga0182039_109612941 | 3300016422 | Soil | MKNITLDRTTVLQLDADGPDSALDAAADCHVLRNDVALDLC |
| Ga0182038_110025591 | 3300016445 | Soil | MKDVTLDRTTVLQLDADGTDRALDAAADCDVLRNDASL |
| Ga0182038_116655492 | 3300016445 | Soil | MKNVSLDRATVLQLDADGTDGAFDVATDRDVLRKHAAIDRCAFADQEIGG |
| Ga0184610_11455651 | 3300017997 | Groundwater Sediment | MKNVSLDRTTVLQLDANGTDSALDAAADCHVLRNDAALDL |
| Ga0184634_101540112 | 3300018031 | Groundwater Sediment | MKNVSLDRTTVLQLDANGTDSALDAAADCHVLRNDAAL |
| Ga0184618_101257782 | 3300018071 | Groundwater Sediment | MKNVTLDRATALQLDANGTDSALDAAADCHVLRNDAALDLCAFADLEIGSAQL |
| Ga0184633_105264351 | 3300018077 | Groundwater Sediment | MKNVTLDRATALQLDANGTDSALDAAADCHVLRNDAALDLCAFA |
| Ga0066662_117110701 | 3300018468 | Grasslands Soil | MKNVALDRTTVLQLHADGTDGALDAAADCDVLRNDAALDLCAITD |
| Ga0210407_109657811 | 3300020579 | Soil | MENVAVDRTTALQFDADGTDGALDAAADGDVLRNDAAL |
| Ga0210407_113492171 | 3300020579 | Soil | MKNVTLDRPTVLQLYADGTDSALDAAADCDVLRNDAALDLCAIAD |
| Ga0210381_101534232 | 3300021078 | Groundwater Sediment | MKNVSLDRTTVLQLDANGTDSALDAAADCHVLRNDAALDLCAFADLEIGSAQL |
| Ga0210382_103402422 | 3300021080 | Groundwater Sediment | MKNVTLDRATALQLDANGTDSALDAAADCHVLRNDAALDLCAFADLEI |
| Ga0213872_102549251 | 3300021361 | Rhizosphere | MKNVTLDHATVLQLDVDRTDSALDAAADCDVVRNNAPLDLRAIA |
| Ga0213879_102551811 | 3300021439 | Bulk Soil | MKNVTLNRATVLQLDANGTDSALDVAADCDALRND |
| Ga0210410_107559141 | 3300021479 | Soil | MKNVTLDRTTVLQLDADGTDSALDAAADCNALRNDVALDLCAI |
| Ga0126371_128796142 | 3300021560 | Tropical Forest Soil | VDRQRPMKNVTLDCATALQLDANGTDSALDAAADCHVLRNDAALDLCAIADQEL |
| Ga0207684_104489403 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNVALDHTTVLQLDADGTDSALDAAADCNALRND |
| Ga0207684_107270821 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VKNVTLDRTTVLQFDADGTDGALDAAADCDVLRNDAALDLCAIAD |
| Ga0207706_111704622 | 3300025933 | Corn Rhizosphere | MKNVSFDCTTVLQLYTHGSDYALNSAADCHVLRNDAAFYLCAIADQELRGV |
| Ga0257146_10828341 | 3300026374 | Soil | MKNVSLDRTTVLQLDANGTDSALDAAADCHVLRNDAALDLCAFADQEIGS |
| Ga0307321_10836972 | 3300028704 | Soil | MKNVTLDRATALQLDANGTDSALDAAADCYVLRNDAALDLG |
| Ga0307282_104844921 | 3300028784 | Soil | MKNVTLDRATALQLDANCTDSALDAAADCHVLRNDAALDLCAFADLEIGSAQLAFN |
| Ga0307305_103902411 | 3300028807 | Soil | MKNVTLDRATALQLDANGTDSALDAAADCHVLRNDA |
| Ga0307296_105422961 | 3300028819 | Soil | MKNVTLDRATALQLDANGTDSALDAAADCHVLRNDAALDLCA |
| Ga0307314_101139542 | 3300028872 | Soil | MKNVTLDRATALQLDANGTDSALDAAADCHILRNDAAL |
| Ga0308200_10896751 | 3300030905 | Soil | MKNVTLDRATALQLDANGTDSALDAAADCHVLRNDAALDLCAFADLEIGSA |
| Ga0308181_10491281 | 3300031099 | Soil | MKNVTLDRATALQLDANGTDSALDAAADCHVLRNDAALDLC |
| Ga0308181_10806401 | 3300031099 | Soil | MKNVTLDRATALQLDANGTDSALDAAADCHVLRNDAALDLCAFAD |
| Ga0307495_101723472 | 3300031199 | Soil | MKNVTLDRATALQLDANGTDSALDAAADCHVLRNDAALDL |
| Ga0318541_101972651 | 3300031545 | Soil | MKNVTFDRATVLQLDASGTDSALDTAADCHVLRNDAALDMCAIADLEIRR |
| Ga0318541_104879431 | 3300031545 | Soil | MKNVTLDRATALQLDANGTDSALDAAADRHVLRNDAALDLCAIADLEIR |
| Ga0318538_108042251 | 3300031546 | Soil | MKNVSLDRATFLQLDADGMDGAFDVATDRDVLRKHAAIDRCAFADQEI |
| Ga0318538_108305241 | 3300031546 | Soil | MKNVTFDRTTVLQLDANGTDGALDAAADCDALSNDVALDVCAIADQE |
| Ga0318571_103062911 | 3300031549 | Soil | MKDVTLDRTTVLQLDADGTDRALDAAADCEVLRNDAALDLCAIAD |
| Ga0310915_110850641 | 3300031573 | Soil | MKNVTLDRATALQLDANGMDSALDAVAGCHVLRNDAALDLCAIADLEI |
| Ga0318561_104294821 | 3300031679 | Soil | MKNVSLDRATFLQLDADGMDGAFDVATDRDVLRKHAA |
| Ga0318574_102773363 | 3300031680 | Soil | PRRSFKLRVLIDRQRSMKNVTFDRTTVLQLDADGTDGALDPASDCDALSNDVALDVCAIADQEI |
| Ga0318572_102747102 | 3300031681 | Soil | MKNVTLNRATVLQLDAKGTDSALDVAADCDALRNDVALDLCAIANQEI |
| Ga0318572_108354341 | 3300031681 | Soil | MKNVSLDRATVLQLDADGTDGAFDVATDRDVLRKHAAIDRCAFADQEIGGPQL |
| Ga0306917_115819981 | 3300031719 | Soil | MKNITLDRTTVLQLDADGTDSALDATADCNALRNDVALDLCAIADQEIRGA |
| Ga0306918_108613322 | 3300031744 | Soil | MKNVTLDHTTVLQLDADSMDGALDAAADCHVLRNDAALDL |
| Ga0306918_112371831 | 3300031744 | Soil | MKNVTLDRATALQLDANGTDSALDAAADRHVLRNDAALD |
| Ga0318502_104006241 | 3300031747 | Soil | MKNVTLDRTTVLQLDADGTDSALDAAADCNALRNDVALDLC |
| Ga0318492_107057631 | 3300031748 | Soil | MKNVTLDRATVLQLDADGTDSALDAAADCHILRND |
| Ga0318535_104633811 | 3300031764 | Soil | MKNVTLDRATALQLDANGTDSALDAAADCHVLRNNAALDLCAIADLEIRGAHLAFD |
| Ga0318535_104884001 | 3300031764 | Soil | MKDVTLDRTTVLQLDADGTDRALDAAADCDVLRNDASLDLCA |
| Ga0318509_107842071 | 3300031768 | Soil | MKNVTLDHTTVLQLDADSMDGALDAAADCHVLRNNTPLD |
| Ga0318546_105092241 | 3300031771 | Soil | MKNVTLDRTTALQLDANGMDSALDAAADCHVLGNDAALDLCAI |
| Ga0318543_102841111 | 3300031777 | Soil | MKNITLDRTTVLQLDADGTDGALDATADRHVLRNDASLDLCPIVDLE |
| Ga0318543_104708122 | 3300031777 | Soil | MKNVTLNRATVLQLDAKGTDSALDVAADCDALRNDVALDLCA |
| Ga0318498_102788492 | 3300031778 | Soil | MKNVTLDRTTVLQLDAIGTDGALDAATDCNGLRNDV |
| Ga0318547_104004821 | 3300031781 | Soil | MKNVTFDRATVLQLDANGTDSALDAAADCHILRNDAALDMCAIADLEIRGAHLA |
| Ga0318547_108103051 | 3300031781 | Soil | MKNVTLDNTTVLQLDADGMDSALDAAADCDVLRNDVALDLCA |
| Ga0318529_102531672 | 3300031792 | Soil | MKNVTLDHTTILQLDTVGTDSALDAAADCHILRNDAALDMCA |
| Ga0318529_104889262 | 3300031792 | Soil | MKNVTFDRTTVLQLDADGTDGALDAAADCDALSNDVALDVCAIADQEI |
| Ga0318503_102395371 | 3300031794 | Soil | MKNVTLDRTTVSQLDADGTDSALDAAADCDVLRNNTP |
| Ga0318503_102601361 | 3300031794 | Soil | MKNVTLDHTTILQLDTVGTDSALDAAADCHILRNDAALDMCAI |
| Ga0318576_106381711 | 3300031796 | Soil | MKNITLDRTTVIQLDADGTDSALDAAADCDVLRNNTPLDLCAIADQKIRGA |
| Ga0318523_106112461 | 3300031798 | Soil | MKDVTLDRTTVLQLDADGTNGALDPAADCDVLRNDAS |
| Ga0318497_107082982 | 3300031805 | Soil | MKNVSLDRATVLQLDADGTDGAFDVATDRDVLRKHAAID |
| Ga0318567_103869983 | 3300031821 | Soil | MKNVTLDRATVLQLDANGTDSALDAAADCDALRND |
| Ga0318499_102808461 | 3300031832 | Soil | MKNVTLDRTTVLQLDANGTDSALDAAADCHRLRNDTALDLCPIVDLE |
| Ga0318511_103824291 | 3300031845 | Soil | MKDVTLDRTTVLQLDADGTNGALDPAADCDVLRNDASLDL |
| Ga0306919_103492741 | 3300031879 | Soil | MKNVTLDHTTILQLDTVGTDSALDAAADCHILRNDAALDMCAIADLEIRGAHL |
| Ga0306919_111046361 | 3300031879 | Soil | MKNVTLDRATALQLDANGTDSALDAAADCHVLRNDAA |
| Ga0306925_117332271 | 3300031890 | Soil | MKNVTLDRTTILQLHAVGTYGALDAAADCNGLRNDAALDVC |
| Ga0318522_103595381 | 3300031894 | Soil | MKNVTFDRTTVLQLDAHGTDGALDPAADCDALSNDV |
| Ga0306923_105981091 | 3300031910 | Soil | MKNVTLDRTTVLQLDANGTDSALDTAADCHVLRNDTALDLC |
| Ga0306923_116071981 | 3300031910 | Soil | MKNVTLDNTTVLQLDADGTDSALDAAADCDVLRNDVALDLCAIADQEL |
| Ga0306923_123199791 | 3300031910 | Soil | MKNVTLDRATALQLDANGTDSALDAAADCHVLRNDAAL |
| Ga0306921_103898443 | 3300031912 | Soil | MKNVTLDRTTVLQLDADGTDGALDATADCDVLRNDGALDLCDMPIRRSEA |
| Ga0306921_104907951 | 3300031912 | Soil | MKNITLDRTTVLQLDADGTDGALDAAADCHVLRNDAALDVC |
| Ga0306921_120950811 | 3300031912 | Soil | MKNVTLDRATALQLDANGMDSALDAAADRHVLRNDAALDLCAITD |
| Ga0310912_102017274 | 3300031941 | Soil | PFKQRVLIDRQRPVKNVTFDHTTVLQFDADGTDCALDAAADCDALRNDAALDLCAIADQE |
| Ga0310912_114028771 | 3300031941 | Soil | MKNVTLDRTTVLQLDADGTDGALDAAADGHVLRNDAALDLCAIVDLE |
| Ga0310913_111020791 | 3300031945 | Soil | MKNVTLDRATALQLDANGTDSALDAAANRHVLRNDAALDLCPIVDLEIRGAHLA |
| Ga0306926_124648741 | 3300031954 | Soil | MKNVTLDHTTILQLDTVGTDSALDAAADCHILRNDAALDMC |
| Ga0318530_102319692 | 3300031959 | Soil | MKNVSLDRATVLQLDADGTDGAFDVATDRDVLRKHAAIDRCAFADQEIG |
| Ga0318530_104257702 | 3300031959 | Soil | MKNVTLDHTTILQLDAVGTYGALDAAADRHVLRHDVALDLCA |
| Ga0318563_107264731 | 3300032009 | Soil | MKNVTLDRTTVLQLDANGTDSALDAAADCHVLRNDTALDLCPIVDLKIR |
| Ga0318507_104442132 | 3300032025 | Soil | MKNVTLDHTTILQLDTVGTDSALDAAADCHILRNDAALD |
| Ga0318507_105494761 | 3300032025 | Soil | MKNVTLDRATALQLDANGMDSALDAAADCHVLRNDAA |
| Ga0310911_103936011 | 3300032035 | Soil | MKNVTLNHTTVLQLDADGSDSALDAAADCHVLRNNISLDLCAIAD |
| Ga0310911_105439261 | 3300032035 | Soil | MKNVTLDRTTVLQLDAIGTDCALDAAADCNGLRNDVALDLCAIADLEI |
| Ga0310911_108715531 | 3300032035 | Soil | MKNVTLDHTTILQLDTVGTDSALDAAADCHILRNDAALDMCAIADLEIR |
| Ga0318559_105175001 | 3300032039 | Soil | MKDVTLDRTTVLQLDADGTNGALDPAADCDVLRNDASLDLCAIADEKIR |
| Ga0318556_100320891 | 3300032043 | Soil | MKDVTLDRTTVLQLDADGTNGALDPAADCDVLRNDASLDLCAIADEKI |
| Ga0318532_101031792 | 3300032051 | Soil | MKNVTLDRATVLQLDANGTDSALDAAADCHVLRNDAALDLSLIWR |
| Ga0318506_101025921 | 3300032052 | Soil | MKNVTLDRATALQLDANGTDSALDAAADCNALRNDVALDLCAIADQEIR |
| Ga0318533_101834341 | 3300032059 | Soil | MKNVTFDRTTVLQLDADGTDGALDPAADCDALSNDVA |
| Ga0318533_110439321 | 3300032059 | Soil | MKNITLDRTTVLQLDADGPDSALDAAADCHVLRNDVALDLCAIADQEIRGAH |
| Ga0318505_101717991 | 3300032060 | Soil | MKNVTLDRATVLQLDANGTDSALDAAADCHVLRNDAALDLCAIADLEI |
| Ga0318513_100106892 | 3300032065 | Soil | MKNVTLDHTTILQLDAVGTYGALDAAADRHVLRHDVALD |
| Ga0318514_103614721 | 3300032066 | Soil | MKNVTLDRTTVLQLDADGTDSALDAAADCNALRNDVAL |
| Ga0318514_106847472 | 3300032066 | Soil | MKDVTLDRTTVLQFDSDGTNGALDPAADCHVLRNDASLD |
| Ga0318540_102598521 | 3300032094 | Soil | MKNITLDRTTVLQLDADGTDGALDATADRHVLRNDASLDLC |
| Ga0318540_105627792 | 3300032094 | Soil | MKNVTLDRTTVLQFDADGTDGALDATADCDVLRNDAALDL |
| Ga0306920_1005862801 | 3300032261 | Soil | FKLRVLIDRQRPMKNVTLNRATVLQLDADRTDGALDAAADCHVLRNDAALDLCAIADLEI |
| Ga0310914_104858053 | 3300033289 | Soil | MKNITLRRTTVLQLDADGPDSALDAAADCHVLRNDVALDLCAIADQEI |
| Ga0318519_105093852 | 3300033290 | Soil | MKNVSLDRPTVLQLDADGTDGALDAAADRDVLRNDAALD |
| ⦗Top⦘ |