Basic Information | |
---|---|
Family ID | F046879 |
Family Type | Metagenome |
Number of Sequences | 150 |
Average Sequence Length | 45 residues |
Representative Sequence | VRLVLTLELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKRWR |
Number of Associated Samples | 45 |
Number of Associated Scaffolds | 150 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 27.52 % |
% of genes near scaffold ends (potentially truncated) | 48.00 % |
% of genes from short scaffolds (< 2000 bps) | 88.00 % |
Associated GOLD sequencing projects | 44 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.63 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (50.667 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (70.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (85.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (87.333 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.17% β-sheet: 0.00% Coil/Unstructured: 45.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 150 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 19.33 |
PF02518 | HATPase_c | 4.67 |
PF00072 | Response_reg | 3.33 |
PF01381 | HTH_3 | 1.33 |
PF13676 | TIR_2 | 1.33 |
PF04185 | Phosphoesterase | 0.67 |
PF07769 | PsiF_repeat | 0.67 |
PF07589 | PEP-CTERM | 0.67 |
PF13414 | TPR_11 | 0.67 |
PF00975 | Thioesterase | 0.67 |
PF01165 | Ribosomal_S21 | 0.67 |
PF09586 | YfhO | 0.67 |
PF00805 | Pentapeptide | 0.67 |
PF16576 | HlyD_D23 | 0.67 |
PF00583 | Acetyltransf_1 | 0.67 |
PF02737 | 3HCDH_N | 0.67 |
PF13489 | Methyltransf_23 | 0.67 |
PF00614 | PLDc | 0.67 |
PF13091 | PLDc_2 | 0.67 |
PF07603 | DUF1566 | 0.67 |
PF00106 | adh_short | 0.67 |
COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 19.33 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.67 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.67 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.67 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.67 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.67 |
COG1502 | Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthase | Lipid transport and metabolism [I] | 0.67 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.67 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.67 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.67 % |
Unclassified | root | N/A | 49.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_101451461 | Not Available | 1612 | Open in IMG/M |
3300004633|Ga0066395_10125534 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
3300004633|Ga0066395_10283707 | Not Available | 900 | Open in IMG/M |
3300005332|Ga0066388_100138653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia caribensis | 2992 | Open in IMG/M |
3300005332|Ga0066388_100546807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 1788 | Open in IMG/M |
3300005332|Ga0066388_102070448 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300005713|Ga0066905_100002471 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 6928 | Open in IMG/M |
3300005713|Ga0066905_100010466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM2793 | 4375 | Open in IMG/M |
3300005713|Ga0066905_101245636 | Not Available | 667 | Open in IMG/M |
3300005713|Ga0066905_101312146 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300005764|Ga0066903_100313545 | Not Available | 2496 | Open in IMG/M |
3300005764|Ga0066903_101226489 | Not Available | 1395 | Open in IMG/M |
3300005764|Ga0066903_101328662 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1345 | Open in IMG/M |
3300005764|Ga0066903_102387612 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1022 | Open in IMG/M |
3300005764|Ga0066903_104048157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 785 | Open in IMG/M |
3300005764|Ga0066903_104288631 | Not Available | 762 | Open in IMG/M |
3300005764|Ga0066903_106000247 | Not Available | 636 | Open in IMG/M |
3300006854|Ga0075425_101538846 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300007076|Ga0075435_100536565 | Not Available | 1012 | Open in IMG/M |
3300009792|Ga0126374_10087558 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1725 | Open in IMG/M |
3300009792|Ga0126374_10103487 | Not Available | 1622 | Open in IMG/M |
3300009792|Ga0126374_10125407 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1510 | Open in IMG/M |
3300009792|Ga0126374_10569214 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 830 | Open in IMG/M |
3300009792|Ga0126374_10633314 | Not Available | 794 | Open in IMG/M |
3300009792|Ga0126374_10741852 | Not Available | 743 | Open in IMG/M |
3300009792|Ga0126374_10804263 | Not Available | 719 | Open in IMG/M |
3300009792|Ga0126374_11151142 | Not Available | 618 | Open in IMG/M |
3300009792|Ga0126374_11534975 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
3300010043|Ga0126380_10510961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense | 925 | Open in IMG/M |
3300010043|Ga0126380_10537121 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 906 | Open in IMG/M |
3300010043|Ga0126380_10576723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → Piscinibacter defluvii | 881 | Open in IMG/M |
3300010043|Ga0126380_10808341 | Not Available | 768 | Open in IMG/M |
3300010043|Ga0126380_10917598 | Not Available | 729 | Open in IMG/M |
3300010043|Ga0126380_11683294 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
3300010046|Ga0126384_10082416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium | 2322 | Open in IMG/M |
3300010046|Ga0126384_10211164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1544 | Open in IMG/M |
3300010046|Ga0126384_10279102 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1364 | Open in IMG/M |
3300010046|Ga0126384_10338427 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1250 | Open in IMG/M |
3300010046|Ga0126384_10391616 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1171 | Open in IMG/M |
3300010046|Ga0126384_10511568 | Not Available | 1037 | Open in IMG/M |
3300010046|Ga0126384_10895494 | Not Available | 801 | Open in IMG/M |
3300010047|Ga0126382_10001496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9629 | Open in IMG/M |
3300010047|Ga0126382_10013801 | Not Available | 3985 | Open in IMG/M |
3300010047|Ga0126382_11767825 | Not Available | 580 | Open in IMG/M |
3300010048|Ga0126373_10652592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1108 | Open in IMG/M |
3300010048|Ga0126373_12210601 | Not Available | 611 | Open in IMG/M |
3300010358|Ga0126370_10148947 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
3300010358|Ga0126370_10246759 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1382 | Open in IMG/M |
3300010358|Ga0126370_10741003 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300010358|Ga0126370_10760751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 859 | Open in IMG/M |
3300010358|Ga0126370_10844369 | Not Available | 821 | Open in IMG/M |
3300010358|Ga0126370_11307928 | Not Available | 680 | Open in IMG/M |
3300010358|Ga0126370_11313564 | Not Available | 678 | Open in IMG/M |
3300010358|Ga0126370_11418104 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 657 | Open in IMG/M |
3300010358|Ga0126370_11840123 | Not Available | 587 | Open in IMG/M |
3300010358|Ga0126370_12445003 | Not Available | 519 | Open in IMG/M |
3300010359|Ga0126376_10023050 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 4100 | Open in IMG/M |
3300010359|Ga0126376_10101900 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2191 | Open in IMG/M |
3300010359|Ga0126376_10423366 | Not Available | 1207 | Open in IMG/M |
3300010359|Ga0126376_10494240 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1131 | Open in IMG/M |
3300010359|Ga0126376_12414239 | Not Available | 573 | Open in IMG/M |
3300010359|Ga0126376_12899078 | Not Available | 529 | Open in IMG/M |
3300010360|Ga0126372_10218528 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
3300010360|Ga0126372_10330463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1356 | Open in IMG/M |
3300010360|Ga0126372_10338742 | Not Available | 1343 | Open in IMG/M |
3300010360|Ga0126372_10823494 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300010360|Ga0126372_11129448 | Not Available | 804 | Open in IMG/M |
3300010360|Ga0126372_12147863 | Not Available | 607 | Open in IMG/M |
3300010360|Ga0126372_12167167 | Not Available | 604 | Open in IMG/M |
3300010360|Ga0126372_12367479 | Not Available | 581 | Open in IMG/M |
3300010361|Ga0126378_10558228 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
3300010361|Ga0126378_10794651 | Not Available | 1056 | Open in IMG/M |
3300010361|Ga0126378_11201757 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 856 | Open in IMG/M |
3300010361|Ga0126378_11506585 | Not Available | 763 | Open in IMG/M |
3300010361|Ga0126378_12294718 | Not Available | 616 | Open in IMG/M |
3300010361|Ga0126378_13403509 | Not Available | 505 | Open in IMG/M |
3300010362|Ga0126377_10664825 | Not Available | 1092 | Open in IMG/M |
3300010362|Ga0126377_10790752 | Not Available | 1007 | Open in IMG/M |
3300010362|Ga0126377_10874623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 960 | Open in IMG/M |
3300010362|Ga0126377_11121572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 856 | Open in IMG/M |
3300010362|Ga0126377_11871920 | Not Available | 676 | Open in IMG/M |
3300010362|Ga0126377_12543260 | Not Available | 587 | Open in IMG/M |
3300010362|Ga0126377_12915724 | Not Available | 552 | Open in IMG/M |
3300010366|Ga0126379_10372371 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
3300010366|Ga0126379_10820528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1030 | Open in IMG/M |
3300010366|Ga0126379_12218927 | Not Available | 650 | Open in IMG/M |
3300010366|Ga0126379_12912303 | Not Available | 573 | Open in IMG/M |
3300010366|Ga0126379_13713457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 511 | Open in IMG/M |
3300010376|Ga0126381_101607718 | Not Available | 939 | Open in IMG/M |
3300010376|Ga0126381_102241465 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300010376|Ga0126381_102510527 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300010376|Ga0126381_102646339 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300010376|Ga0126381_103195863 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 648 | Open in IMG/M |
3300010376|Ga0126381_103671438 | Not Available | 601 | Open in IMG/M |
3300010398|Ga0126383_10445028 | Not Available | 1343 | Open in IMG/M |
3300010398|Ga0126383_10710977 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300010398|Ga0126383_10763509 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300010398|Ga0126383_10943531 | Not Available | 950 | Open in IMG/M |
3300010398|Ga0126383_10983806 | Not Available | 932 | Open in IMG/M |
3300010398|Ga0126383_11924239 | Not Available | 679 | Open in IMG/M |
3300011270|Ga0137391_10351374 | Not Available | 1266 | Open in IMG/M |
3300012948|Ga0126375_10107256 | Not Available | 1670 | Open in IMG/M |
3300012948|Ga0126375_10267475 | Not Available | 1168 | Open in IMG/M |
3300012948|Ga0126375_10269326 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1165 | Open in IMG/M |
3300012948|Ga0126375_10473051 | Not Available | 927 | Open in IMG/M |
3300012948|Ga0126375_10738177 | Not Available | 771 | Open in IMG/M |
3300012948|Ga0126375_11062062 | Not Available | 664 | Open in IMG/M |
3300012971|Ga0126369_10101303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2608 | Open in IMG/M |
3300012971|Ga0126369_10340302 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
3300012971|Ga0126369_10475898 | Not Available | 1303 | Open in IMG/M |
3300012971|Ga0126369_10714129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1080 | Open in IMG/M |
3300012971|Ga0126369_10784615 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300012971|Ga0126369_10807570 | Not Available | 1021 | Open in IMG/M |
3300012971|Ga0126369_11864428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
3300012971|Ga0126369_12518477 | Not Available | 600 | Open in IMG/M |
3300012971|Ga0126369_13517533 | Not Available | 513 | Open in IMG/M |
3300016371|Ga0182034_10574223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense | 949 | Open in IMG/M |
3300021560|Ga0126371_10095752 | All Organisms → cellular organisms → Bacteria | 2946 | Open in IMG/M |
3300021560|Ga0126371_10174705 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2227 | Open in IMG/M |
3300021560|Ga0126371_10183680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2177 | Open in IMG/M |
3300021560|Ga0126371_10234673 | Not Available | 1943 | Open in IMG/M |
3300021560|Ga0126371_10369481 | Not Available | 1572 | Open in IMG/M |
3300021560|Ga0126371_11676498 | Not Available | 760 | Open in IMG/M |
3300021560|Ga0126371_12456709 | Not Available | 630 | Open in IMG/M |
3300021560|Ga0126371_13182001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 555 | Open in IMG/M |
3300027527|Ga0209684_1068300 | Not Available | 553 | Open in IMG/M |
3300027646|Ga0209466_1006716 | All Organisms → cellular organisms → Bacteria | 2432 | Open in IMG/M |
3300027654|Ga0209799_1021132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense | 1427 | Open in IMG/M |
3300027874|Ga0209465_10000513 | All Organisms → cellular organisms → Bacteria | 17891 | Open in IMG/M |
3300027874|Ga0209465_10007237 | All Organisms → cellular organisms → Bacteria | 4881 | Open in IMG/M |
3300027874|Ga0209465_10251287 | Not Available | 885 | Open in IMG/M |
3300027874|Ga0209465_10280372 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 835 | Open in IMG/M |
3300031546|Ga0318538_10140607 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300031564|Ga0318573_10567078 | Not Available | 611 | Open in IMG/M |
3300031573|Ga0310915_10107651 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1891 | Open in IMG/M |
3300031573|Ga0310915_11037520 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
3300031668|Ga0318542_10288765 | Not Available | 838 | Open in IMG/M |
3300031719|Ga0306917_10024947 | All Organisms → cellular organisms → Bacteria | 3754 | Open in IMG/M |
3300031765|Ga0318554_10218980 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1084 | Open in IMG/M |
3300031771|Ga0318546_10991580 | Not Available | 591 | Open in IMG/M |
3300031781|Ga0318547_10716822 | Not Available | 622 | Open in IMG/M |
3300031782|Ga0318552_10513765 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 612 | Open in IMG/M |
3300031896|Ga0318551_10118108 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
3300031942|Ga0310916_10252563 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1486 | Open in IMG/M |
3300031945|Ga0310913_10805237 | Not Available | 662 | Open in IMG/M |
3300031947|Ga0310909_10334374 | Not Available | 1271 | Open in IMG/M |
3300032008|Ga0318562_10788394 | Not Available | 544 | Open in IMG/M |
3300032060|Ga0318505_10098855 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
3300033290|Ga0318519_10185471 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 70.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 15.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.33% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.33% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1014514611 | 3300000955 | Soil | RRAKPSSVPDHVRLVLTLDLRRALAEKLSERAIREERNIEAIIIALLEAAAKRWQ* |
Ga0066395_101255341 | 3300004633 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIEAIIISLIEAAAKKLQ* |
Ga0066395_102837071 | 3300004633 | Tropical Forest Soil | AIPGYVKLLLTLELRRELAEKLRQHAERNIEAIVISLIEAAAKRWR* |
Ga0066388_1001386535 | 3300005332 | Tropical Forest Soil | VPDHVGLVLTLELRRELAEKLSQQAIRSERNIEAIVISLIEAAVKRWQ* |
Ga0066388_1005468074 | 3300005332 | Tropical Forest Soil | VPDHARLVLTLELRRELAEKLSLKAIKSERNIEAIVIALIEAAAKR |
Ga0066388_1020704481 | 3300005332 | Tropical Forest Soil | PDHVRLVLALELRHELAEKLSERAIREKRNIEAIVIASIEAAAQRWQ* |
Ga0066905_1000024715 | 3300005713 | Tropical Forest Soil | VPDHVRLVLTLELRRELAEKLSERAIREERNIEAIIIALLEAAAKRWR* |
Ga0066905_1000104666 | 3300005713 | Tropical Forest Soil | MEIRRELAEKLSQQAIRSERNIEAIVIGLLESTAKRWQ* |
Ga0066905_1012456362 | 3300005713 | Tropical Forest Soil | VRLVLTLELRRELAEKLSERAIREERNIEAIVIALIEAAAKRWR* |
Ga0066905_1013121463 | 3300005713 | Tropical Forest Soil | TLELRRELAEKLSLRAIREERNIEAIVIALIEGAAKRWR* |
Ga0066903_1003135456 | 3300005764 | Tropical Forest Soil | VRLVLTLELRRDLAEKLSLKAIRSERNIEAIIIGLMEAAAKRWR* |
Ga0066903_1012264891 | 3300005764 | Tropical Forest Soil | VIAVLTLELRRVLAEKLSERAIREERNIEAIVIALIEAAAKQWR* |
Ga0066903_1013286622 | 3300005764 | Tropical Forest Soil | VNRRELAEKLSLKAIKSERNIEAIVINLIEAAAKMWR* |
Ga0066903_1023876123 | 3300005764 | Tropical Forest Soil | VPDHVRLVLTLELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKQWR* |
Ga0066903_1040481571 | 3300005764 | Tropical Forest Soil | LRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKQWR* |
Ga0066903_1042886311 | 3300005764 | Tropical Forest Soil | MPDHVRLVLTLELRRELAEKLSEWAIREERNIEAIVIALIEEAAKRWR* |
Ga0066903_1060002471 | 3300005764 | Tropical Forest Soil | KPSAVPDHVRLVLTLELHRELAEKLSERAIRQERSIEAIILALIEAAAKKWQ* |
Ga0075425_1015388463 | 3300006854 | Populus Rhizosphere | FGRLLLTLELRRDLAERLSLQSIKSERNIEAIVIVLIEAAAKRWE* |
Ga0075435_1005365652 | 3300007076 | Populus Rhizosphere | VRLIVTLELRRGLAEKLSERAIREEQNIEAIVVALIDAAAKRRR* |
Ga0126374_100875583 | 3300009792 | Tropical Forest Soil | VPDHVRLVLTLELRRELAEKLSERAIREERNIEAIIIALLETAAKRWR* |
Ga0126374_101034872 | 3300009792 | Tropical Forest Soil | VRLVLTLELSRELAEKLSLKAIKSERNIEAIIIGLIEAAAKQWR* |
Ga0126374_101254074 | 3300009792 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIEAIIIGLIEAAAKRWR* |
Ga0126374_105692143 | 3300009792 | Tropical Forest Soil | VRLVLTLELRRELAEKLSERAIRGERNIEAIVIALIEAAAKQWR* |
Ga0126374_106333142 | 3300009792 | Tropical Forest Soil | VIAVPTLELRRELAEKLSERAIREERNIEAIVVALIEAAAKQWR* |
Ga0126374_107418521 | 3300009792 | Tropical Forest Soil | AIPGNVKLLLTLELRREVVEKLSQQAIRSERYTEAIIIGLIEEAAKRWR* |
Ga0126374_108042631 | 3300009792 | Tropical Forest Soil | LELRRVLAEKLSERAIREERNIEAIVIALIEAAAKQWR* |
Ga0126374_111511421 | 3300009792 | Tropical Forest Soil | VRLILTLELRRELAEKLSLKAIKSERNIEAIVIGLIEAA |
Ga0126374_115349753 | 3300009792 | Tropical Forest Soil | TLELRRELAEKLSLRAIKSERNIEAIVIGLIDEAAKRWR* |
Ga0126380_105109611 | 3300010043 | Tropical Forest Soil | KPSAVPDHVWLVLTLELRRELAEKLSERAIREERNIEAIIIALLETAAKRWR* |
Ga0126380_105371213 | 3300010043 | Tropical Forest Soil | VRLILTLELRRELAEKLSERAIRGERNIEAIVIALIEAAVKQWR* |
Ga0126380_105767232 | 3300010043 | Tropical Forest Soil | SPIPGYVRLLLTLELRRELAEKLSERAIREERNIEAIIIGLIEAAAKRWH* |
Ga0126380_108083411 | 3300010043 | Tropical Forest Soil | VIAVLTLELRRVLAEKLSERAIREERNIEAIVIALIEAAAK* |
Ga0126380_109175981 | 3300010043 | Tropical Forest Soil | VRLLLTLELRRELAEKLSLKAIRSERNIEAIVIALIEAAAKRWR* |
Ga0126380_116832942 | 3300010043 | Tropical Forest Soil | VRLVLTLELRRELAEKLSERAIREERNVEAIIIALLEAAAKRWR* |
Ga0126384_100824164 | 3300010046 | Tropical Forest Soil | VPDHVRLVLTLELRRELAEKLSERTIREERNIEAIIIALLEAAAKRWQ* |
Ga0126384_102111643 | 3300010046 | Tropical Forest Soil | VRLVLTLELRRELAEKLSERAIKSERNIEAIVISLIEEAAKRWR* |
Ga0126384_102791023 | 3300010046 | Tropical Forest Soil | VRLVFTLELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKQWR* |
Ga0126384_103384271 | 3300010046 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIEAIIIGLIEAAAKQGR* |
Ga0126384_103916162 | 3300010046 | Tropical Forest Soil | VPDHVWLVLTLELRRELAEKLSERAIREERNIEAIIIALLETAAKRW* |
Ga0126384_105115681 | 3300010046 | Tropical Forest Soil | MTLELRRELAEKLSQQAIRSGWNIEAIVISVIEEAARRWR* |
Ga0126384_108954942 | 3300010046 | Tropical Forest Soil | LELRRELAEKLSERAIREERNIEAIIIALLEAAAKRW* |
Ga0126382_100014967 | 3300010047 | Tropical Forest Soil | VRLVFTLELRRELAEKLSLKAIKSERNIEAIVIGLVEAAAKQWR* |
Ga0126382_100138015 | 3300010047 | Tropical Forest Soil | VRLVLTLELRRELAEKLSERAIREERNIEAIVIALIEAAAKRRR* |
Ga0126382_117678251 | 3300010047 | Tropical Forest Soil | VRLILTLELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKQRR* |
Ga0126373_106525921 | 3300010048 | Tropical Forest Soil | LELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKRWR* |
Ga0126373_122106011 | 3300010048 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIEAIIIGLIDAAAKQWR* |
Ga0126370_101489473 | 3300010358 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIEAIVIALIEAAAKRW* |
Ga0126370_102467593 | 3300010358 | Tropical Forest Soil | VRLILTLELRRELAEKLSERAIREERNIEAIVIALIEAAAKRWR* |
Ga0126370_107410031 | 3300010358 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIEAIVIGLIDEAAKRWR* |
Ga0126370_107607511 | 3300010358 | Tropical Forest Soil | VPDHVWLVLTLELRRELAEKLSERAIREERNIEAIIIALLETAAKR |
Ga0126370_108443691 | 3300010358 | Tropical Forest Soil | VRLVLTLELRRELAEKLSERAIREERNIEAIIIALLEAAAKRWR* |
Ga0126370_113079282 | 3300010358 | Tropical Forest Soil | VPDHVRLVLTLELRRELAEKLSLKAIKSERNIEAVIIGLSEEAAKRWR* |
Ga0126370_113135641 | 3300010358 | Tropical Forest Soil | TCVRLVLTLELSRELAEKLSLKAIKSERNIEAIIIGLIEAAAKQWR* |
Ga0126370_114181042 | 3300010358 | Tropical Forest Soil | VPDHVRLVLTLELYRELAEKLSERAIRQERSIEAIIIALLEVAA |
Ga0126370_118401232 | 3300010358 | Tropical Forest Soil | VLDHVRLVLTLELRRELAEKLSLKAIKSERNIEVIIIGLIEAAARRWL |
Ga0126370_124450031 | 3300010358 | Tropical Forest Soil | HVRLVLTLELRRELAEKLSERAIREERNIEAIVIGLIEAAAKRWR* |
Ga0126376_100230501 | 3300010359 | Tropical Forest Soil | VPDHVRLVLTLELRRELAEKLSEPAIREERNIEAIIIALLEAAAKRWR* |
Ga0126376_101019004 | 3300010359 | Tropical Forest Soil | VWLVLTLELRRELAEKLSERAIREERNIEAIIIALLETAAKRWR* |
Ga0126376_104233663 | 3300010359 | Tropical Forest Soil | VRLVLTLELRRELAEKLSERAIKSERNLEAIILALIEAAAKKWH* |
Ga0126376_104942403 | 3300010359 | Tropical Forest Soil | VRLILTLELRRELAEEFSPKAIKSERNIEAIIIGLIEAAAKQWR* |
Ga0126376_124142391 | 3300010359 | Tropical Forest Soil | TLELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKQWR* |
Ga0126376_128990781 | 3300010359 | Tropical Forest Soil | PSPMPDHVRLVLTLELRRELAEKLSEWAIREERNIEAIVIALIEEAAKRWR* |
Ga0126372_102185283 | 3300010360 | Tropical Forest Soil | VRLILTLELRRKLAEKLSEWAIREERNIEAIVIGLIEAAAKRWR* |
Ga0126372_103304632 | 3300010360 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKRWQ* |
Ga0126372_103387422 | 3300010360 | Tropical Forest Soil | PSAVPDYVRLVFTLELRRELAEKLSERAIREERNIEAIVISLIEAAAKRW* |
Ga0126372_108234943 | 3300010360 | Tropical Forest Soil | VRLALTLELRRELAEKLSLKAIKSERNIEAIVIGLIDEAAKRWR* |
Ga0126372_111294481 | 3300010360 | Tropical Forest Soil | VVPDYVRLVLTLELRRELAEKLSERAIREERNIEAIVVALIEAAAKQWR* |
Ga0126372_121478633 | 3300010360 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIEAIVIALIEAAAKRWQ* |
Ga0126372_121671672 | 3300010360 | Tropical Forest Soil | MVPDHVRLVLTLELRRELAEKLSLKAIKSERNIEAIVIALIDAAAKQWR* |
Ga0126372_123674793 | 3300010360 | Tropical Forest Soil | RELAEKLSERAIREERNIEAIVIALIEAAAKRWR* |
Ga0126378_105582281 | 3300010361 | Tropical Forest Soil | LELRRELAEKLSERAIKSERNLEAIILALIEAAAKKWH* |
Ga0126378_107946511 | 3300010361 | Tropical Forest Soil | KPSAIPGYVKLLLTLELRRELAEKLSQQAIRSGRTIEAIVISLIEAAAKRWR* |
Ga0126378_112017572 | 3300010361 | Tropical Forest Soil | VRLLLTIELRRDLAEKLSLKAIKSERNIEAIIIGLIEAAAKQWR* |
Ga0126378_115065853 | 3300010361 | Tropical Forest Soil | LVLTLELRRELAEKLSERAIREERNLEAIVIALIDAAVRRWR* |
Ga0126378_122947181 | 3300010361 | Tropical Forest Soil | DHVRLVLTLELRRELAEKLSERAIREERNIEAIIIALLEAAAKRWR* |
Ga0126378_134035091 | 3300010361 | Tropical Forest Soil | RRFRNDVRLFLALELRHELAEKLNERAIREERNIEAIVIALIEAAANRWR* |
Ga0126377_106648252 | 3300010362 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKRWR* |
Ga0126377_107907522 | 3300010362 | Tropical Forest Soil | LPLPAGQSRQLIPGCVRLLLTLELRRELAEKLSAIKSERNIGAIILALIEAAAKKWQ* |
Ga0126377_108746231 | 3300010362 | Tropical Forest Soil | DHVRLVFTLELRRELAEKLSLKAIKSERNVEAIVVALIKAAAKQWR* |
Ga0126377_111215723 | 3300010362 | Tropical Forest Soil | RLVLTLELRRELAEKLSLKAIKSERNIETTIIGLIEEAANRWR* |
Ga0126377_118719202 | 3300010362 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIESERNIEAIVIALIEAAAKRWH* |
Ga0126377_125432601 | 3300010362 | Tropical Forest Soil | MPGHVKLLLTLELRRELAEKLSQQAIRSGWNIEAIIIALIEEAAKR* |
Ga0126377_129157242 | 3300010362 | Tropical Forest Soil | VRLLLTLELRRELAEKLSLKAIRSERNIEAIVIGLIEAAANRWR* |
Ga0126379_103723714 | 3300010366 | Tropical Forest Soil | VLTLEVRRELAETLSLRAIKSGRNLEAIIIALIEAAAKKWQ* |
Ga0126379_108205282 | 3300010366 | Tropical Forest Soil | VRLILTLELRRELAEKLSLKAIKSERNIDAIVIDLIEEAAKQWR* |
Ga0126379_122189271 | 3300010366 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIESIVIGLIEAAAK |
Ga0126379_129123031 | 3300010366 | Tropical Forest Soil | MPGHVKLLLTLELRRELAEKLSQQAIRSGWNIEAIIIAL |
Ga0126379_137134573 | 3300010366 | Tropical Forest Soil | PDHVRLVFTLELRRELAEKLSLKAIKSERNVEAIIIGLIEAAAKQWR* |
Ga0126381_1016077181 | 3300010376 | Tropical Forest Soil | VWLVLTLELRRELAEKLSERAIREERNIEAIIIALLEAAAKRWQ* |
Ga0126381_1019806362 | 3300010376 | Tropical Forest Soil | VRLALTLELRRELAEKLSLRAIKSERNLEAIILALIEAAAKKWH* |
Ga0126381_1022414652 | 3300010376 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIEAIVIALIEAAAKQ |
Ga0126381_1025105272 | 3300010376 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIEAIVIALIEVAAKRWR* |
Ga0126381_1026463391 | 3300010376 | Tropical Forest Soil | AVPDHVRLVLTLELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKQWR* |
Ga0126381_1031958632 | 3300010376 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKQWR* |
Ga0126381_1036714382 | 3300010376 | Tropical Forest Soil | VPDHVRLVLTLELHRELAEKLSERAIRQERNIEAIIIALLEVA |
Ga0126383_104450282 | 3300010398 | Tropical Forest Soil | VRIVLTLELQRALAEKLSLKAIKLERTIEAIVIPLIEDAAK |
Ga0126383_107109773 | 3300010398 | Tropical Forest Soil | VPDHVRLVLTLELRRELAEKLSERAIRQERNIEAIIIALLEAAAKKWQ* |
Ga0126383_107635091 | 3300010398 | Tropical Forest Soil | TLELRRELAEKLSERAIREERNIEAIIISLLEAAAKRWE* |
Ga0126383_109435312 | 3300010398 | Tropical Forest Soil | AKPSPVPDHVRLVLTLELRRELAVKLSEWAIREERNIEAIVITLIEAAAKRWR* |
Ga0126383_109838061 | 3300010398 | Tropical Forest Soil | VRLLLTLELRRELAEKLSLKAIKSERNIEAIVIGLIEA |
Ga0126383_119242391 | 3300010398 | Tropical Forest Soil | VKPSSIPGYVRLVLTLELRRELAEKLSLKAIKSESNIEAIIIGLIEAAAKQWR* |
Ga0137391_103513742 | 3300011270 | Vadose Zone Soil | VLTLEIRRALAEQLSLQAIREGKNIEAILIEVLEAAAKRWR* |
Ga0126375_101072562 | 3300012948 | Tropical Forest Soil | VPDHVRLVLNLELRRDLAEKLSLKAIRSERNIEAIILTLIEAAAKRWE* |
Ga0126375_102674751 | 3300012948 | Tropical Forest Soil | VRLVLTLEVHRELAEKLSERAIREQRNIEAIIIVLLEAAAKRWR* |
Ga0126375_102693262 | 3300012948 | Tropical Forest Soil | VPDHLRLVPTLEVRRELAEKLSERAIREERTIEAIVIALIEAAAKRWR* |
Ga0126375_104730511 | 3300012948 | Tropical Forest Soil | MPGHVKLLLTLELRRELAEKLSQQAIRSRWNIEAIIIALIEEAAK |
Ga0126375_107381772 | 3300012948 | Tropical Forest Soil | AKPSAVPDHVRLVLTLELRRELAEKLSLRAITSEGNIEAIILALIEAAAKKWQ* |
Ga0126375_110620622 | 3300012948 | Tropical Forest Soil | VPDHVWLVLTLELRRELTEKLSERAIREERNIEAIIIALLETAAKRW* |
Ga0126369_101013031 | 3300012971 | Tropical Forest Soil | RAKPSPVPDHVRLVLTLELRRELAEKLSLKAIKSERNIEAIIISLIEAAAKKLQ* |
Ga0126369_103403024 | 3300012971 | Tropical Forest Soil | LTLELRRELAEKLSQQAIRSGRNIETIVIGSIDAAAKKWQ* |
Ga0126369_104758981 | 3300012971 | Tropical Forest Soil | KLLLTLDLRRELAEKLSQQAIRSERNIEAIIIALIEEGAKRWQ* |
Ga0126369_107141291 | 3300012971 | Tropical Forest Soil | RAKPSPVPDHVRLVLTLELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAERWT* |
Ga0126369_107846151 | 3300012971 | Tropical Forest Soil | LLTLELHRELAEKLSLKAIKSERNIEAIILALIEAAARRWR* |
Ga0126369_108075701 | 3300012971 | Tropical Forest Soil | ILTLELRRELAEKLSLKAIKSERNIEAIIIGLIEEAAKRWR* |
Ga0126369_118644283 | 3300012971 | Tropical Forest Soil | AKPSAVPDHVRLVLTLELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKQWR* |
Ga0126369_125184772 | 3300012971 | Tropical Forest Soil | VRLLLTLELRREFAEKLSLEAIKSERNIEAIVIALIDAAAKRWR* |
Ga0126369_135175332 | 3300012971 | Tropical Forest Soil | VRLVLTLELRRELAEKLSERAIREERNIEAIIIALLEAAAKKWQ* |
Ga0182034_105742233 | 3300016371 | Soil | LELRRELAERLSERAIREERNIEAIIIALLETAAKR |
Ga0126371_100957521 | 3300021560 | Tropical Forest Soil | VGYPWPRQTLLTLELRRELAEKLSLKAIKSERNIEAIIIGLIEAAAKQWR |
Ga0126371_101747051 | 3300021560 | Tropical Forest Soil | VRLVLTLELRRELAEKLSERAIREERNIEAIIIALLEAAAKRWR |
Ga0126371_101836802 | 3300021560 | Tropical Forest Soil | VQLVLTLDLRRELAEKLSLKAIKSERNIEAIVIALIEEAAKRSR |
Ga0126371_102346732 | 3300021560 | Tropical Forest Soil | VRLVLTLELRRDLAEKLSLKAIRSERNIEAIIIGLMEAAAKRWR |
Ga0126371_103694812 | 3300021560 | Tropical Forest Soil | VPDHLRIVFTLELQRALAEKLGLKAIKSERNIEAIIIGLIEAAAKQWR |
Ga0126371_116764982 | 3300021560 | Tropical Forest Soil | ELRRELAEKLSLKAIKSERNIEAIVIGLIEVAAKRWR |
Ga0126371_124567091 | 3300021560 | Tropical Forest Soil | VWLVLTLELRRELAEKLSERAIREERNIEAIIIALLETAAKRW |
Ga0126371_131820013 | 3300021560 | Tropical Forest Soil | RLILTLELRRELAEKLSERAIREERNIEAIVIALIEAAAKRWR |
Ga0209684_10683001 | 3300027527 | Tropical Forest Soil | LELRRELAEKLSLKAIRSERNIEAIIIARIETAARQWR |
Ga0209466_10067163 | 3300027646 | Tropical Forest Soil | MEIRRELAEKLSQQAIRSERNIEAIVIGLLESTAKRWQ |
Ga0209799_10211323 | 3300027654 | Tropical Forest Soil | VPDHVWLVLTLELRRELAEKLSERAIREERNIEAIIIALLETAAKRW |
Ga0209465_100005133 | 3300027874 | Tropical Forest Soil | VPDHVWLVLTLELRRELAEKLSERAIREERNIEAIIIALLETAAKRWR |
Ga0209465_100072375 | 3300027874 | Tropical Forest Soil | VRLVLTLELRRELAEKLSLKAIKSERNIEAIIIGLIEAAAKRWR |
Ga0209465_102512872 | 3300027874 | Tropical Forest Soil | VNRRELAEKLSLKAIKSERNIEAIVINLIEAAAKMWR |
Ga0209465_102803721 | 3300027874 | Tropical Forest Soil | VRLILTLELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKQW |
Ga0318538_101406074 | 3300031546 | Soil | VPDHVRLVLTLELRRELAEKLSERAIREERNIEAIIIALLEAAAKRWR |
Ga0318573_105670781 | 3300031564 | Soil | VPDHVWLVLTLELRRELAERLSERAIREERNIEAIIIALLE |
Ga0310915_101076513 | 3300031573 | Soil | VPDHVWLVLTLELRRELAERLSERAIREERNIEAIIIALLETAAKR |
Ga0310915_110375201 | 3300031573 | Soil | SETIARSRPRRLLLTLELRRDLAEKLSLKAIKSERNIEAIVIALIEAAARQWR |
Ga0318542_102887651 | 3300031668 | Soil | LELRRELAEKLSERAIREERNIEAIIIALLEAAAKRWR |
Ga0306917_100249476 | 3300031719 | Soil | VWLVLTLELRRELAERLSERAIREERNIEAIIIALLETAAKR |
Ga0318554_102189803 | 3300031765 | Soil | VPDHVRLVLTLELRRELAEKLSLKAIKSERNIEAIVIALIEAAARQWR |
Ga0318546_109915803 | 3300031771 | Soil | PSPVPDHVRLALTLELRRELAEKLSLKAIKSERNIEAIVSALIEAAAKQWR |
Ga0318547_107168222 | 3300031781 | Soil | RLLLTLELRRELAEKLSLKAIKSERNIEAIVIGLIEAAAKRWQ |
Ga0318552_105137651 | 3300031782 | Soil | CVWSSETIARSRPRRLLLTLELRRDLAEKLSLKAIKSERNIEAIVIALIEAAARQWR |
Ga0318551_101181081 | 3300031896 | Soil | RLVLTLELRRELAEKLSERAIREERNIEAIIIALLEAAAKRWR |
Ga0310916_102525631 | 3300031942 | Soil | VPDHVRLVLTLELRRELAEKLSLKAIKSERNIEAIIIGLIEAAAKQWR |
Ga0310913_108052372 | 3300031945 | Soil | VPDHVRLVLTLELRRELAEKLSLKAIKSERNIEAIIIGLIEAAAKQ |
Ga0310909_103343741 | 3300031947 | Soil | KPSAVPDHVRLVLTLELRRELAEKLSLKAIKSERNIEAIIIGLIEAAAKQWR |
Ga0318562_107883943 | 3300032008 | Soil | RRELAEKLSLKAIKSERNIEAIVSALIEAAAKQWR |
Ga0318505_100988551 | 3300032060 | Soil | LVLTLELRRELAEKLSERAIREERNIEAIIIALLEAAAKRWR |
Ga0318519_101854711 | 3300033290 | Soil | HVWLVLTLELRRELAERLSERAIREERNIEAIIIALLETAAKR |
⦗Top⦘ |