| Basic Information | |
|---|---|
| Family ID | F046868 |
| Family Type | Metagenome |
| Number of Sequences | 150 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LVGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAR |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.68 % |
| % of genes near scaffold ends (potentially truncated) | 97.33 % |
| % of genes from short scaffolds (< 2000 bps) | 82.00 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (62.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (62.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.88% β-sheet: 14.71% Coil/Unstructured: 79.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF13271 | DUF4062 | 14.00 |
| PF05977 | MFS_3 | 10.00 |
| PF00248 | Aldo_ket_red | 4.00 |
| PF13411 | MerR_1 | 4.00 |
| PF13302 | Acetyltransf_3 | 3.33 |
| PF07690 | MFS_1 | 2.67 |
| PF08543 | Phos_pyr_kin | 2.67 |
| PF00415 | RCC1 | 2.00 |
| PF13649 | Methyltransf_25 | 2.00 |
| PF03109 | ABC1 | 2.00 |
| PF03466 | LysR_substrate | 2.00 |
| PF03706 | LPG_synthase_TM | 1.33 |
| PF05960 | DUF885 | 1.33 |
| PF13936 | HTH_38 | 1.33 |
| PF01381 | HTH_3 | 1.33 |
| PF00877 | NLPC_P60 | 1.33 |
| PF13401 | AAA_22 | 1.33 |
| PF01243 | Putative_PNPOx | 1.33 |
| PF02627 | CMD | 0.67 |
| PF00196 | GerE | 0.67 |
| PF00486 | Trans_reg_C | 0.67 |
| PF00111 | Fer2 | 0.67 |
| PF00355 | Rieske | 0.67 |
| PF05988 | DUF899 | 0.67 |
| PF13358 | DDE_3 | 0.67 |
| PF02332 | Phenol_Hydrox | 0.67 |
| PF10935 | DUF2637 | 0.67 |
| PF12697 | Abhydrolase_6 | 0.67 |
| PF01425 | Amidase | 0.67 |
| PF03625 | DUF302 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 10.00 |
| COG5184 | Alpha-tubulin suppressor ATS1 and related RCC1 domain-containing proteins | Cell cycle control, cell division, chromosome partitioning [D] | 4.00 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 2.67 |
| COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 2.67 |
| COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 2.67 |
| COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 2.67 |
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 2.00 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 1.33 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 1.33 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 1.33 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.67 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.67 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.67 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.67 % |
| Unclassified | root | N/A | 23.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005332|Ga0066388_100885893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1473 | Open in IMG/M |
| 3300005436|Ga0070713_100105597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2447 | Open in IMG/M |
| 3300005764|Ga0066903_100105909 | All Organisms → cellular organisms → Bacteria | 3826 | Open in IMG/M |
| 3300005764|Ga0066903_104344902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
| 3300005764|Ga0066903_105065772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
| 3300005764|Ga0066903_106796735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300006914|Ga0075436_101120589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
| 3300009792|Ga0126374_10828811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 710 | Open in IMG/M |
| 3300010046|Ga0126384_11699334 | Not Available | 597 | Open in IMG/M |
| 3300010048|Ga0126373_10713068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1062 | Open in IMG/M |
| 3300010048|Ga0126373_11590497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
| 3300010048|Ga0126373_12340891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 594 | Open in IMG/M |
| 3300010048|Ga0126373_12890277 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010358|Ga0126370_10650170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 918 | Open in IMG/M |
| 3300010359|Ga0126376_12718086 | Not Available | 544 | Open in IMG/M |
| 3300010360|Ga0126372_10587288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1066 | Open in IMG/M |
| 3300010360|Ga0126372_11096124 | Not Available | 814 | Open in IMG/M |
| 3300010360|Ga0126372_11221597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
| 3300010360|Ga0126372_12581935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300010361|Ga0126378_10798299 | Not Available | 1053 | Open in IMG/M |
| 3300010361|Ga0126378_12234975 | Not Available | 624 | Open in IMG/M |
| 3300010361|Ga0126378_13112954 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300010362|Ga0126377_11919843 | Not Available | 668 | Open in IMG/M |
| 3300010366|Ga0126379_11793193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 718 | Open in IMG/M |
| 3300010376|Ga0126381_100048070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5207 | Open in IMG/M |
| 3300010376|Ga0126381_102243928 | Not Available | 785 | Open in IMG/M |
| 3300012948|Ga0126375_10932843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
| 3300012971|Ga0126369_12007360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 666 | Open in IMG/M |
| 3300012971|Ga0126369_12094275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
| 3300016270|Ga0182036_11546692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 558 | Open in IMG/M |
| 3300016294|Ga0182041_10328996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1277 | Open in IMG/M |
| 3300016319|Ga0182033_10501022 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300016341|Ga0182035_11028583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-64-8 | 731 | Open in IMG/M |
| 3300016341|Ga0182035_11422652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 623 | Open in IMG/M |
| 3300016387|Ga0182040_10786747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 783 | Open in IMG/M |
| 3300016422|Ga0182039_10342310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1253 | Open in IMG/M |
| 3300017924|Ga0187820_1036676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1290 | Open in IMG/M |
| 3300017974|Ga0187777_11202059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300021560|Ga0126371_12258745 | Not Available | 657 | Open in IMG/M |
| 3300021560|Ga0126371_13328802 | Not Available | 543 | Open in IMG/M |
| 3300027497|Ga0208199_1010332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 2190 | Open in IMG/M |
| 3300031543|Ga0318516_10741003 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300031546|Ga0318538_10187260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1103 | Open in IMG/M |
| 3300031546|Ga0318538_10391614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 751 | Open in IMG/M |
| 3300031546|Ga0318538_10592542 | Not Available | 601 | Open in IMG/M |
| 3300031549|Ga0318571_10172046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 760 | Open in IMG/M |
| 3300031549|Ga0318571_10181504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 743 | Open in IMG/M |
| 3300031572|Ga0318515_10338482 | Not Available | 807 | Open in IMG/M |
| 3300031573|Ga0310915_10053155 | All Organisms → cellular organisms → Bacteria | 2623 | Open in IMG/M |
| 3300031573|Ga0310915_10807613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 660 | Open in IMG/M |
| 3300031668|Ga0318542_10098211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-7 | 1410 | Open in IMG/M |
| 3300031668|Ga0318542_10119182 | Not Available | 1289 | Open in IMG/M |
| 3300031679|Ga0318561_10281916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 908 | Open in IMG/M |
| 3300031680|Ga0318574_10580702 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031682|Ga0318560_10097091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1521 | Open in IMG/M |
| 3300031682|Ga0318560_10586076 | Not Available | 604 | Open in IMG/M |
| 3300031713|Ga0318496_10078406 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300031719|Ga0306917_10342290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1161 | Open in IMG/M |
| 3300031723|Ga0318493_10156516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1182 | Open in IMG/M |
| 3300031723|Ga0318493_10270901 | Not Available | 911 | Open in IMG/M |
| 3300031723|Ga0318493_10648684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 590 | Open in IMG/M |
| 3300031736|Ga0318501_10191123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1068 | Open in IMG/M |
| 3300031736|Ga0318501_10586375 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300031748|Ga0318492_10404223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 718 | Open in IMG/M |
| 3300031748|Ga0318492_10406296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 716 | Open in IMG/M |
| 3300031748|Ga0318492_10760274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300031751|Ga0318494_10036488 | All Organisms → cellular organisms → Bacteria | 2544 | Open in IMG/M |
| 3300031751|Ga0318494_10908482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 516 | Open in IMG/M |
| 3300031764|Ga0318535_10029963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2171 | Open in IMG/M |
| 3300031765|Ga0318554_10004419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6486 | Open in IMG/M |
| 3300031765|Ga0318554_10268656 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300031765|Ga0318554_10618787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300031765|Ga0318554_10656470 | Not Available | 590 | Open in IMG/M |
| 3300031770|Ga0318521_10252550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1029 | Open in IMG/M |
| 3300031770|Ga0318521_10707043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300031771|Ga0318546_10047316 | All Organisms → cellular organisms → Bacteria | 2659 | Open in IMG/M |
| 3300031777|Ga0318543_10547445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 519 | Open in IMG/M |
| 3300031778|Ga0318498_10446086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 573 | Open in IMG/M |
| 3300031779|Ga0318566_10002470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6336 | Open in IMG/M |
| 3300031779|Ga0318566_10027061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2599 | Open in IMG/M |
| 3300031795|Ga0318557_10272919 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300031798|Ga0318523_10033521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2342 | Open in IMG/M |
| 3300031798|Ga0318523_10210411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 972 | Open in IMG/M |
| 3300031799|Ga0318565_10015810 | All Organisms → cellular organisms → Bacteria | 3232 | Open in IMG/M |
| 3300031805|Ga0318497_10122289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1410 | Open in IMG/M |
| 3300031805|Ga0318497_10365811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 806 | Open in IMG/M |
| 3300031821|Ga0318567_10056050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2049 | Open in IMG/M |
| 3300031821|Ga0318567_10244112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1008 | Open in IMG/M |
| 3300031831|Ga0318564_10002564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6368 | Open in IMG/M |
| 3300031880|Ga0318544_10311104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 611 | Open in IMG/M |
| 3300031890|Ga0306925_10024245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6111 | Open in IMG/M |
| 3300031890|Ga0306925_10346999 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300031890|Ga0306925_10562317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1208 | Open in IMG/M |
| 3300031890|Ga0306925_11889669 | Not Available | 568 | Open in IMG/M |
| 3300031890|Ga0306925_12062442 | Not Available | 536 | Open in IMG/M |
| 3300031890|Ga0306925_12279567 | Not Available | 501 | Open in IMG/M |
| 3300031896|Ga0318551_10036924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2403 | Open in IMG/M |
| 3300031912|Ga0306921_10221713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2216 | Open in IMG/M |
| 3300031912|Ga0306921_11247028 | Not Available | 825 | Open in IMG/M |
| 3300031912|Ga0306921_11491622 | Not Available | 739 | Open in IMG/M |
| 3300031941|Ga0310912_11309157 | Not Available | 549 | Open in IMG/M |
| 3300031942|Ga0310916_11407261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 571 | Open in IMG/M |
| 3300031942|Ga0310916_11416500 | Not Available | 569 | Open in IMG/M |
| 3300031946|Ga0310910_10640780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 842 | Open in IMG/M |
| 3300031947|Ga0310909_10316479 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300031954|Ga0306926_12166255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300031981|Ga0318531_10507726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 546 | Open in IMG/M |
| 3300032009|Ga0318563_10771212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 515 | Open in IMG/M |
| 3300032010|Ga0318569_10372753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 665 | Open in IMG/M |
| 3300032035|Ga0310911_10534839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 680 | Open in IMG/M |
| 3300032039|Ga0318559_10518527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
| 3300032041|Ga0318549_10243524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 809 | Open in IMG/M |
| 3300032042|Ga0318545_10134198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 877 | Open in IMG/M |
| 3300032042|Ga0318545_10201577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 712 | Open in IMG/M |
| 3300032043|Ga0318556_10077597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1653 | Open in IMG/M |
| 3300032043|Ga0318556_10605783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → Microbispora bryophytorum | 571 | Open in IMG/M |
| 3300032044|Ga0318558_10016540 | All Organisms → cellular organisms → Bacteria | 2904 | Open in IMG/M |
| 3300032044|Ga0318558_10075378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1542 | Open in IMG/M |
| 3300032052|Ga0318506_10258063 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300032054|Ga0318570_10031690 | Not Available | 2101 | Open in IMG/M |
| 3300032060|Ga0318505_10186021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 970 | Open in IMG/M |
| 3300032060|Ga0318505_10189898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 960 | Open in IMG/M |
| 3300032063|Ga0318504_10019202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2560 | Open in IMG/M |
| 3300032064|Ga0318510_10185996 | Not Available | 834 | Open in IMG/M |
| 3300032064|Ga0318510_10227209 | Not Available | 761 | Open in IMG/M |
| 3300032065|Ga0318513_10034657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2200 | Open in IMG/M |
| 3300032065|Ga0318513_10369563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
| 3300032066|Ga0318514_10210882 | Not Available | 1018 | Open in IMG/M |
| 3300032067|Ga0318524_10094582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1475 | Open in IMG/M |
| 3300032068|Ga0318553_10034308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 2447 | Open in IMG/M |
| 3300032068|Ga0318553_10190445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1069 | Open in IMG/M |
| 3300032068|Ga0318553_10295213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 847 | Open in IMG/M |
| 3300032068|Ga0318553_10732361 | Not Available | 517 | Open in IMG/M |
| 3300032068|Ga0318553_10780132 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300032076|Ga0306924_10296740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-7 | 1855 | Open in IMG/M |
| 3300032090|Ga0318518_10097122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1466 | Open in IMG/M |
| 3300032090|Ga0318518_10352655 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300032090|Ga0318518_10514530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 613 | Open in IMG/M |
| 3300032090|Ga0318518_10667002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300032094|Ga0318540_10177071 | Not Available | 1025 | Open in IMG/M |
| 3300032261|Ga0306920_100160681 | Not Available | 3350 | Open in IMG/M |
| 3300032261|Ga0306920_101493993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → unclassified Geodermatophilus → Geodermatophilus sp. DSM 45219 | 965 | Open in IMG/M |
| 3300032261|Ga0306920_101508044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 960 | Open in IMG/M |
| 3300032261|Ga0306920_103059416 | Not Available | 630 | Open in IMG/M |
| 3300033289|Ga0310914_10556379 | Not Available | 1036 | Open in IMG/M |
| 3300033289|Ga0310914_11070404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 707 | Open in IMG/M |
| 3300033289|Ga0310914_11232073 | Not Available | 650 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 62.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066388_1008858932 | 3300005332 | Tropical Forest Soil | PGKLADLVAYPLNPLTADLDDLADLTPALTIAGGQATYDPDKRLSP* |
| Ga0070713_1001055971 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KLADLAAYPLDPLAADPDDLAELTPAFTIVGGRATHDPGKRLVR* |
| Ga0066903_1001059091 | 3300005764 | Tropical Forest Soil | APGKLADLVAYRVDPLAADPASLPDLTPAFTIVGGRATHDPDGRLAH* |
| Ga0066903_1043449022 | 3300005764 | Tropical Forest Soil | PGKLADLAGYPVDPMTADPDDLAGLIPEFTVVGGRPVHDPDKRLAR* |
| Ga0066903_1050657721 | 3300005764 | Tropical Forest Soil | GYPADPMTADPDDLAGLIPAFTVVGGRPVHDPDKRLAR* |
| Ga0066903_1067967351 | 3300005764 | Tropical Forest Soil | ADLAAYPLDPLTAGPDELAKLTPVFTIVGGRPVHDPDKRLV* |
| Ga0075436_1011205891 | 3300006914 | Populus Rhizosphere | PIDPLKADVDDLAELKPTFTVVGGKPMYDPDQRLSPA* |
| Ga0126374_108288112 | 3300009792 | Tropical Forest Soil | KLADLVGYAADPLVADPDDLAELTPVFTMVGGRATHDPDKRLAP* |
| Ga0126384_116993341 | 3300010046 | Tropical Forest Soil | LADLVAYPLDPLTASPDDLAELTPAFTIVGGRPVHDPDKRLAR* |
| Ga0126373_107130681 | 3300010048 | Tropical Forest Soil | GYPVDPLAADPEDLAELIPAFTIVGGRPTHDPDKRLAR* |
| Ga0126373_115904972 | 3300010048 | Tropical Forest Soil | ADLVAYPLDPLAADPDDLASLTPVFTIVGGRPSYDRDKRLAR* |
| Ga0126373_123408912 | 3300010048 | Tropical Forest Soil | DLLVADPGDLASLTPVFTIVGGRPSYDRDKRLTR* |
| Ga0126373_128902772 | 3300010048 | Tropical Forest Soil | LAAAPDDLPELVPAFTMVGGRAIHDPSKRLAPGPARAAW* |
| Ga0126370_106501702 | 3300010358 | Tropical Forest Soil | SITPGKLADLAGYPLDPLTADPDDLAELTPAFTIMGGRPTHDPDKRLAR* |
| Ga0126376_127180861 | 3300010359 | Tropical Forest Soil | LVAYSIDPLTASPDDLAGLTPAFTIVGGRPVHDPDKRLVR* |
| Ga0126372_105872883 | 3300010360 | Tropical Forest Soil | ADPLAADPDDLAELTPAFTVVGGRPVHDPDKRLVRRAGNRHH* |
| Ga0126372_110961244 | 3300010360 | Tropical Forest Soil | LADLVAYPVDPLVADPDGLAELTPVFTMVGGKPVHDPDKRLSL* |
| Ga0126372_112215971 | 3300010360 | Tropical Forest Soil | LVAYPLDPLAADPDDLPELTPAFTIVGGRATHDPGKRLAR* |
| Ga0126372_125819351 | 3300010360 | Tropical Forest Soil | KLADLVAYPLDPLAADPDDLPELTPAFTIVGGRATHDPGKRLAR* |
| Ga0126378_107982991 | 3300010361 | Tropical Forest Soil | ADLAGYPADPMTAGPDDLAGLIPAFTVVGGRPAHDPDKRLAR* |
| Ga0126378_122349751 | 3300010361 | Tropical Forest Soil | SIAPGKLADLVAYPADPMAADMDDLADLMPIFTIVDGEPVHDPGQRLTR* |
| Ga0126378_131129541 | 3300010361 | Tropical Forest Soil | PLDPLAADPADLHDLKPAFTMVGGNPTHDPNHLLAR* |
| Ga0126377_119198431 | 3300010362 | Tropical Forest Soil | KLADLVAYPLDPLTASPDDLAELTPAFTIVGGRPVHDPDKRLAR* |
| Ga0126379_117931932 | 3300010366 | Tropical Forest Soil | VAYPLNPLSADLDDLADLTPALTIAGGQATYDPDKRLSP* |
| Ga0126381_1000480707 | 3300010376 | Tropical Forest Soil | LADLVGYAADPLVADPDDLAELTPVFTMVGGRATHDPDKRLAP* |
| Ga0126381_1022439284 | 3300010376 | Tropical Forest Soil | AYPVDPLAADPDDLAELTPVFTMVGGKPVHDPDKRLSL* |
| Ga0126375_109328431 | 3300012948 | Tropical Forest Soil | VTPGKLADLVAYPLDPLAADPDDLPELTPAFTIVGGRATHDPGKRLAR* |
| Ga0126369_120073602 | 3300012971 | Tropical Forest Soil | PGKLADLVAYPLDPLTAGPDDLAKLTPAFTMVGGRPVHDPGGLLDS* |
| Ga0126369_120942752 | 3300012971 | Tropical Forest Soil | APGKLADIVAYPADPLTADVDDLPGLTPAFTIVGGRPVHDPGGRLGPRR* |
| Ga0182036_115466922 | 3300016270 | Soil | LVGYPADPLAVDRDDLAELTPTVTLVGGRATHDPDKRLAGDRARAGE |
| Ga0182041_103289963 | 3300016294 | Soil | AAYPLDPLTAGPDELAKLTPVFTIVGGKPVHDPDKRLVR |
| Ga0182033_105010222 | 3300016319 | Soil | DLVGYPADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR |
| Ga0182035_110285832 | 3300016341 | Soil | GKLADLAGYPADPMTADSDDLAGLIPAFTVVGGRPVHDPDKRLAR |
| Ga0182035_114226522 | 3300016341 | Soil | AYPLDPLVADPGELASLTPVFTIVGGRPSYDRDKRLTR |
| Ga0182040_107867472 | 3300016387 | Soil | GYTVDPLTADPDDLAGLTPAFTIVGGRPVHDPDKRLAR |
| Ga0182039_103423101 | 3300016422 | Soil | VDPLAADPDDLAELTPAFTMAGGQVTHDPDKRLAK |
| Ga0187820_10366762 | 3300017924 | Freshwater Sediment | YPIDPLTADVDDLADLRPVFTMVGGRATHDPDKRLAR |
| Ga0187777_112020591 | 3300017974 | Tropical Peatland | RLGSITTGKLADLAGYPADPLAADPDDLAELTPAFTIMGGRATHDPDKRLAR |
| Ga0126371_122587451 | 3300021560 | Tropical Forest Soil | PVDPLTADPDDLAELTPVFTIVGGRATHDPEKRLAP |
| Ga0126371_133288021 | 3300021560 | Tropical Forest Soil | PADPLTADVDDLPGLTPAFTIVGGRPVHDPGDRLGSPR |
| Ga0208199_10103321 | 3300027497 | Peatlands Soil | AHGKLADLVGYSIDPLAADLYDLADLTPAFTIVGGTGVHDPGRRLGDQVPMAH |
| Ga0318516_107410032 | 3300031543 | Soil | GRLADLVAYALDPLTANPDDLAKLTPVFTIVGGRPVHDPDKRLVR |
| Ga0318541_101891851 | 3300031545 | Soil | PFTADIDRLADMTPAFTIVGGRAMFDPDGRLSPRP |
| Ga0318538_101872601 | 3300031546 | Soil | PVDPLAADPDDLAELTPAFTMVGGRVTHDPDKRLTP |
| Ga0318538_103916142 | 3300031546 | Soil | GYPADPLAADPDDLAGLTPAFTIVGGRATHDPDQRLAR |
| Ga0318538_105925422 | 3300031546 | Soil | YLGDPLAADPDDLAELTPAFTSAGGRVTHDADKRPTR |
| Ga0318571_101720462 | 3300031549 | Soil | KLADLVGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAP |
| Ga0318571_101815042 | 3300031549 | Soil | AGYPADPMTADPDNLADLTPAFTVVGGRPVHDPDKRLAR |
| Ga0318515_103384822 | 3300031572 | Soil | VAYPLDPLTADPGDLPELTPAFTMMGGRATHDPDKRLAG |
| Ga0310915_100531555 | 3300031573 | Soil | VGYPVDPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR |
| Ga0310915_108076131 | 3300031573 | Soil | LTGYPADPMIADLDDLAGLTPEFTVVGGKPVHDPDKRLAR |
| Ga0318542_100982112 | 3300031668 | Soil | YPLDPLTAAPDGLAELTPAFTIVGGRATHDPDKRLAR |
| Ga0318542_101191821 | 3300031668 | Soil | LVGYPLDPLSADPDDLAELTPAFTIAGGRATHDPDKRLAR |
| Ga0318561_102819161 | 3300031679 | Soil | PRDPLAAELDDLADLKPVLTIAGGRATYDPDKRLAR |
| Ga0318574_105807021 | 3300031680 | Soil | DLVGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLARPGVGEQRVGE |
| Ga0318560_100970913 | 3300031682 | Soil | LDPFTADLDDLPDLKPALTIAGGRATHDPDKRLAR |
| Ga0318560_105860762 | 3300031682 | Soil | LVGYPVDPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR |
| Ga0318496_100784061 | 3300031713 | Soil | GYPVDPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR |
| Ga0306917_103422902 | 3300031719 | Soil | ADPLTADVDDLPGLTPAFTIVGGRPVHDPGGRLGPPR |
| Ga0318493_101565162 | 3300031723 | Soil | AGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAP |
| Ga0318493_102709011 | 3300031723 | Soil | GKLADLVGYPADPLAADPDDLAELTPAFTIMGGRATHDPDQRLAP |
| Ga0318493_106486841 | 3300031723 | Soil | MSRVPAEPGKLADLVGYPVDPTAADAAGLADLTPAFTMTGGRVTHDPDQRLAK |
| Ga0318500_101304572 | 3300031724 | Soil | DPFTADIDRLADMTPAFTIVGGRAMFDPDGRLSPRP |
| Ga0318501_101911233 | 3300031736 | Soil | VAYRLDPLTADLDELADLKPELTVVGGRATHDPDKRLAR |
| Ga0318501_105863751 | 3300031736 | Soil | LAADPDDLAELTPAFTIVGGRATHDPDKRLARPGVGEQRVGE |
| Ga0318492_104042232 | 3300031748 | Soil | LGSIAPGKLADLAGYPADPLTADPDDLAGLTPAFTIVGGRATHDPDKRLARGC |
| Ga0318492_104062962 | 3300031748 | Soil | IIPGKLADLVAYPLDPLTADLDDLADLTPALTIGGGQATYDPDKRMSP |
| Ga0318492_107602742 | 3300031748 | Soil | YPADPLAADPDDLAALTPAFTIVGGRATHDPDKRLAR |
| Ga0318494_100364881 | 3300031751 | Soil | ADLVGYPVDPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR |
| Ga0318494_109084822 | 3300031751 | Soil | VGYPADPLAADPDDLAELTPAFTIVGGRVTHDPDKRLAR |
| Ga0318535_100299633 | 3300031764 | Soil | VDPMTADPDDLAGLVPEFTVVGGRPVHDPDKRLAR |
| Ga0318554_100044195 | 3300031765 | Soil | GYPADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR |
| Ga0318554_102686562 | 3300031765 | Soil | ADLVGYPADPLAADPDDLAELTPAFTIVGGRVTHDPDKRLAR |
| Ga0318554_106187871 | 3300031765 | Soil | GKLADLVAYPLDPLTAELDDLADLKPVLTIAGGRATYDPDKRLAR |
| Ga0318554_106564702 | 3300031765 | Soil | LVGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAR |
| Ga0318521_102525501 | 3300031770 | Soil | LVGYPADPLATDPDDLAEMTPAFTIVGGRATYDPDKRLAP |
| Ga0318521_107070431 | 3300031770 | Soil | SITPGKLADIVAYPIDPFTADLDDLAELLPTFTIIDGHGVHDPDGMLSS |
| Ga0318546_100473163 | 3300031771 | Soil | LVGYPVDPLAVDPDDLAELTPAFTMVGGRVTHDPDKRLTP |
| Ga0318543_105474451 | 3300031777 | Soil | VGYPADPLAADPDDLAGLTPAFTIVGGRATHDPDQRLAR |
| Ga0318498_104460862 | 3300031778 | Soil | LVGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLARVGE |
| Ga0318566_100024701 | 3300031779 | Soil | GKLADLVGYPADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR |
| Ga0318566_100270611 | 3300031779 | Soil | GKLADLVGYPVDPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR |
| Ga0318557_102729191 | 3300031795 | Soil | GKLADLVGYPLDPLGADPDDLAGLTPAFTIAGGRATHDPDKRLAR |
| Ga0318523_100335211 | 3300031798 | Soil | VAYPIDPLTADPDDLAELTPAFTIVGGQATHDPDKRLAP |
| Ga0318523_102104111 | 3300031798 | Soil | ITPGKLADLVGYPADPLAADPDDLPQLTPAFTMVGGRPTYDPDKRLAR |
| Ga0318565_100158101 | 3300031799 | Soil | AYPADPLTADPDALAELTPAFTIVGGRATHDPDKRLAP |
| Ga0318497_101222892 | 3300031805 | Soil | AGYPADPMTADPDDLAGLIPAFTLVGGRPVHDPDKRLAR |
| Ga0318497_103658111 | 3300031805 | Soil | PGKLADLAGYPMDPMTADPDDLAGLTPAFTVVGGRPVHDPDKRLAQ |
| Ga0318567_100560503 | 3300031821 | Soil | TPGKLADLAGYPVDPMTADPDDLAGLVPEFTVVGGRPVHDPDKRLAR |
| Ga0318567_102441121 | 3300031821 | Soil | IPGKLADLVAYPLDPLTADLDDLADLTPALTIGGGQATYDPDKRMSP |
| Ga0318564_100025645 | 3300031831 | Soil | ADLVGYPADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR |
| Ga0318544_103111042 | 3300031880 | Soil | PLDPLSADPDDLAELTPAFTIAGGRATHDPDKRLAR |
| Ga0306925_100242451 | 3300031890 | Soil | ADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR |
| Ga0306925_103469993 | 3300031890 | Soil | SGQLADIVAYPADPLTADVDDLPGLTPAFTIVGGRPVHDPGGRLGPPR |
| Ga0306925_105623172 | 3300031890 | Soil | KLADLAGYPVDPMTADPDDLARLTPAFTVVGGRPVHDPDKRLAR |
| Ga0306925_118896691 | 3300031890 | Soil | PLDPLAASPDDLPGLTPAFTMVGGRATHDPDKRLAQ |
| Ga0306925_120624423 | 3300031890 | Soil | YPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLTP |
| Ga0306925_122795672 | 3300031890 | Soil | DLVGYPADPLAADLDDLAELTPAFTIVGGRATYDPDKRLAP |
| Ga0318551_100369241 | 3300031896 | Soil | LADLVGYPVDPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR |
| Ga0306921_102217131 | 3300031912 | Soil | AYRLDPLTADLDELADLKPELTVVGGRATHDPDKRLAR |
| Ga0306921_112470281 | 3300031912 | Soil | DLAGYSADPLAADPDDLAELTPVFTIVGGRATHDPDKRLAR |
| Ga0306921_114916221 | 3300031912 | Soil | SITPGKLADLVAYPLDPLTANPRDLPELTPAFTMMGGRATHDPDKRLAP |
| Ga0310912_113091571 | 3300031941 | Soil | KLADLAGYPADPMTADSDDLAGLIPAFTVVGGRPVHDPDKRLAR |
| Ga0310916_114072611 | 3300031942 | Soil | ADPMTADPDNLADLTPAFTVVGGRPVHDPDKRLAR |
| Ga0310916_114165001 | 3300031942 | Soil | DLVGYPADPLAADPDDLAELTPAFTIVGGRPTYDPDKRLAR |
| Ga0310910_106407801 | 3300031946 | Soil | YPADPLAADPDDLAELTPAFTIVGGRPTYDPDKRLAR |
| Ga0310909_103164793 | 3300031947 | Soil | GKLADLVGYPADPLAADPDDLAELTPAFTIVGGQATYDPDKRLDR |
| Ga0306926_121662552 | 3300031954 | Soil | LVAYPLDPLVADPDDLAELTPAFTMLGGRATHDPGKRLAR |
| Ga0318531_105077261 | 3300031981 | Soil | PGKLADLVGYPADPLAVDLDDLADLTPAFTIVGGRAGHDPDKRLVR |
| Ga0318563_107712121 | 3300032009 | Soil | ADLAGYPADPLTADPDDLAGLTPAFTIVGGRAMHDPGKRLARGC |
| Ga0318569_103727532 | 3300032010 | Soil | AYSLDPFTADLDDLPDLKPALTIAGGRATHDPDKRLAR |
| Ga0310911_105348392 | 3300032035 | Soil | VGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAP |
| Ga0318559_105185271 | 3300032039 | Soil | ADLAAYPIDPLAADLDDLADLTPAFTIVGGRAVHDPGGRLAS |
| Ga0318549_102435241 | 3300032041 | Soil | LADIVAYPAVPLTADVDDLPGLTPAFTIVGGRPVHDPGGRLGPPR |
| Ga0318545_101341981 | 3300032042 | Soil | PGKLADLAGYPADPLTADPDDLAGLTPAFTVVGGRPVHDPDKRLAQ |
| Ga0318545_102015771 | 3300032042 | Soil | PGKLADLVGYPADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR |
| Ga0318556_100775973 | 3300032043 | Soil | DLVAYPLDPLVADPGELASLTPVFTIVGGRPSYDRDKRLTR |
| Ga0318556_106057833 | 3300032043 | Soil | GYPVDPLAADPDDLAELTPAFTMAGGQVTHDPDKRLAK |
| Ga0318558_100165401 | 3300032044 | Soil | DLVGYPVDPLAADPDDLAELTPAFTMAGGQVTHDPDKRLAK |
| Ga0318558_100753782 | 3300032044 | Soil | YPVDPLAADPDDLAELTPAFTMVGGRVTHDPDKRLTP |
| Ga0318506_102580632 | 3300032052 | Soil | TPGKLADLVGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAR |
| Ga0318570_100316902 | 3300032054 | Soil | ADLVGYPVDPLAADPDDLAELTPAFTMAGGQVTHDPDKRLAK |
| Ga0318533_113247802 | 3300032059 | Soil | ADLVAYPADPLTVDVEALAELTPTFTMLGGRATHDPEGRLS |
| Ga0318505_101860212 | 3300032060 | Soil | YPADPLTADVDDLPGLTPAFTIVGGRPVHDPGGRLGPPR |
| Ga0318505_101898981 | 3300032060 | Soil | VAYPLDPLTADPDDLAELTPAFTIMGGRATHDPGKRLAR |
| Ga0318504_100192021 | 3300032063 | Soil | LVGYPADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR |
| Ga0318510_101859961 | 3300032064 | Soil | ADLVAYPLDPLTADPGDLPELTPAFTMMGGRATHDPDKRLAG |
| Ga0318510_102272091 | 3300032064 | Soil | GYPADPLATDPDDLAEMTPAFTIVGGRATYDPDKRLAP |
| Ga0318513_100346571 | 3300032065 | Soil | DLAGYPADPMTADPDNLADLTPAFTVVGGRPVHDPDKRLAR |
| Ga0318513_103695631 | 3300032065 | Soil | ITPGKLADLVGYPVDPLAADPDDLAELTPAFTMVGGRAAHDPGKRLAP |
| Ga0318514_102108822 | 3300032066 | Soil | PGKLADLVGYPVDPLAADPDDLAELTPAFTMAGGQVTHDPDKRLAK |
| Ga0318524_100945821 | 3300032067 | Soil | PGKLADLVGYPADPLAADPEDLAELTPAFTIVGGRATHDPDKRLAR |
| Ga0318553_100343085 | 3300032068 | Soil | VAYPLDPLAADPRDLAELSPVFTMVGGRATHDPRNWLAR |
| Ga0318553_101904451 | 3300032068 | Soil | LVAYSLDPFTADLDDLPDLKPALTIAGGRATHDPDKRLAR |
| Ga0318553_102952131 | 3300032068 | Soil | VDPLAADPDDLAELAPAFTIVGGRPTHDPDKRLAR |
| Ga0318553_107323612 | 3300032068 | Soil | GYPADPLAADPDDLAELTPAFTIVGGRPTYDPDKRLAR |
| Ga0318553_107801321 | 3300032068 | Soil | IDPLTADPDDLAERTPAFTIVGGQATHDPDKRLAP |
| Ga0306924_102967402 | 3300032076 | Soil | ADLAGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAP |
| Ga0318518_100971223 | 3300032090 | Soil | GYPVDPMTADPDDLAGLVPEFTVVGGRPVHDPDKRLAR |
| Ga0318518_103526551 | 3300032090 | Soil | LADLVGYPADPLAVDLDDLADLTPAFTIVGGRAGHDPDKRLVR |
| Ga0318518_105145301 | 3300032090 | Soil | GYPADPLAADPDDLPQLTPAFTMVGGRPTYDPDKRLAR |
| Ga0318518_106670022 | 3300032090 | Soil | TPGKLADLVAYPLDPLVADPDDLAGLTPAFTILGGRATYDPGKRLAR |
| Ga0318540_101770712 | 3300032094 | Soil | LVAYPADPFAVDVDELPQLLPAFTIVGGRVAYDPDGRLS |
| Ga0306920_1001606814 | 3300032261 | Soil | KLADLVGYHLDPLAADPDDLAELTPTFTITGGRAVHDPSGMLGS |
| Ga0306920_1014939931 | 3300032261 | Soil | ADPLAADPDDLAEMTPAFTMMGGRATHDPDKRLAR |
| Ga0306920_1015080441 | 3300032261 | Soil | LDPLAADPRDLAELSPVFTMVGGRATHDPRKWLAR |
| Ga0306920_1030594161 | 3300032261 | Soil | ADLVGYRLDPLAADPDDLAELTPTFTITGGRAVHDPSGMLGSPI |
| Ga0310914_105563792 | 3300033289 | Soil | PGKLADLVAYPADPFAVDVDELPQLLPAFTIVGGRVAYDPDGRLS |
| Ga0310914_110704042 | 3300033289 | Soil | AGYPADPMTADPDDLAGLTPAFTVVGGRPVHDPDKRLAR |
| Ga0310914_112320731 | 3300033289 | Soil | AYPLDPLAADPRDLAELSPVFTMVGGRATHDPRNWLAR |
| ⦗Top⦘ |