Metagenome / Metatranscriptome Family F046792

Overview

Basic Information

• Family ID: F046792
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 150
• Average Sequence Length: 42 residues
• Representative Sequence: MQTELNKSKKIILETRQEHKANKTGFAIFSLSSKKFYIKPFSDK
• Number of Associated Samples: 94
• Number of Associated Scaffolds: 150

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 43.62 %
• % of genes near scaffold ends (potentially truncated): 63.33 %
• % of genes from short scaffolds (< 2000 bps): 99.33 %
• Associated GOLD sequencing projects: 93
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (67.333 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (65.333 % of family members)
• Environment Ontology (ENVO): Unclassified (86.667 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (80.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 48.61%
  β-sheet: 0.00%
  Coil/Unstructured: 51.39%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
All Organisms	root	All Organisms	32.67 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
cellular organisms	root	All Organisms → cellular organisms	32.67 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	32.67 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	32.67 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	32.67 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	32.67 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	32.67 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	32.67 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	32.67 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	32.67 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	32.67 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	32.67 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	32.67 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	32.67 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	32.67 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	32.67 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	32.67 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	32.67 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	32.67 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	32.67 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	32.67 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	32.67 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	32.67 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	32.00 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.67 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.33 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	32.00 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.67 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005331|Ga0070670_102171214	Not Available	512
3300005347|Ga0070668_100466228	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1088
3300005355|Ga0070671_100724393	Not Available	864
3300005445|Ga0070708_101274787	Not Available	687
3300005548|Ga0070665_102521301	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	516
3300005618|Ga0068864_101451300	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	689
3300005843|Ga0068860_101681437	Not Available	657
3300009177|Ga0105248_12897083	Not Available	547
3300009972|Ga0105137_102829	Not Available	746
3300009973|Ga0105136_102853	Not Available	868
3300009973|Ga0105136_110240	Not Available	572
3300009976|Ga0105128_107907	Not Available	687
3300009989|Ga0105131_101020	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1812
3300009990|Ga0105132_105358	Not Available	929
3300009990|Ga0105132_120781	Not Available	646
3300009994|Ga0105126_1050210	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	528
3300009994|Ga0105126_1051388	Not Available	523
3300009995|Ga0105139_1050265	Not Available	732
3300009995|Ga0105139_1115580	Not Available	520
3300010371|Ga0134125_12975133	Not Available	514
3300010396|Ga0134126_11343177	Not Available	791
3300010396|Ga0134126_11769294	Not Available	678
3300010397|Ga0134124_13165575	Not Available	504
3300013306|Ga0163162_12308730	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	618
3300014326|Ga0157380_10597777	Not Available	1091
3300014968|Ga0157379_11032155	Not Available	785
3300014968|Ga0157379_11932749	Not Available	582
3300014968|Ga0157379_12259890	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	541
3300015273|Ga0182102_1008498	Not Available	781
3300015273|Ga0182102_1014128	Not Available	690
3300015278|Ga0182099_1018807	Not Available	732
3300015278|Ga0182099_1066882	Not Available	518
3300015280|Ga0182100_1072291	Not Available	564
3300015280|Ga0182100_1094816	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	511
3300015284|Ga0182101_1051191	Not Available	634
3300015290|Ga0182105_1028834	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	782
3300015290|Ga0182105_1065096	Not Available	603
3300015290|Ga0182105_1066602	Not Available	598
3300015293|Ga0182103_1097693	Not Available	513
3300015297|Ga0182104_1024934	Not Available	853
3300015301|Ga0182184_1035816	Not Available	713
3300015301|Ga0182184_1100856	Not Available	503
3300015309|Ga0182098_1081655	Not Available	591
3300015309|Ga0182098_1105984	Not Available	539
3300015310|Ga0182162_1050609	Not Available	708
3300015311|Ga0182182_1055549	Not Available	667
3300015311|Ga0182182_1062002	Not Available	642
3300015312|Ga0182168_1020938	Not Available	970
3300015312|Ga0182168_1074721	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	636
3300015313|Ga0182164_1096237	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	578
3300015315|Ga0182120_1106103	Not Available	560
3300015316|Ga0182121_1084535	Not Available	629
3300015316|Ga0182121_1132583	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	523
3300015317|Ga0182136_1037007	Not Available	817
3300015319|Ga0182130_1034756	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	812
3300015319|Ga0182130_1096546	Not Available	575
3300015320|Ga0182165_1138816	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	515
3300015324|Ga0182134_1015741	Not Available	1090
3300015324|Ga0182134_1068894	Not Available	675
3300015324|Ga0182134_1070319	Not Available	670
3300015324|Ga0182134_1071749	Not Available	665
3300015325|Ga0182148_1038312	Not Available	811
3300015325|Ga0182148_1082668	Not Available	625
3300015325|Ga0182148_1083234	Not Available	624
3300015326|Ga0182166_1137864	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	513
3300015327|Ga0182114_1038102	Not Available	875
3300015327|Ga0182114_1071403	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	700
3300015327|Ga0182114_1099826	Not Available	615
3300015327|Ga0182114_1120744	Not Available	570
3300015328|Ga0182153_1046931	Not Available	778
3300015328|Ga0182153_1137365	Not Available	525
3300015328|Ga0182153_1138943	Not Available	523
3300015328|Ga0182153_1153830	Not Available	502
3300015329|Ga0182135_1078877	Not Available	655
3300015329|Ga0182135_1106924	Not Available	584
3300015329|Ga0182135_1139997	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	524
3300015331|Ga0182131_1020784	Not Available	1029
3300015333|Ga0182147_1129511	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	563
3300015334|Ga0182132_1038491	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	890
3300015334|Ga0182132_1104348	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	617
3300015334|Ga0182132_1160898	Not Available	514
3300015334|Ga0182132_1162995	Not Available	511
3300015336|Ga0182150_1115192	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	585
3300015337|Ga0182151_1019922	Not Available	1070
3300015337|Ga0182151_1116788	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	581
3300015337|Ga0182151_1140236	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	540
3300015340|Ga0182133_1034302	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	984
3300015340|Ga0182133_1129239	Not Available	598
3300015340|Ga0182133_1136962	Not Available	583
3300015340|Ga0182133_1152219	Not Available	557
3300015348|Ga0182115_1182576	Not Available	673
3300015348|Ga0182115_1227285	Not Available	596
3300015349|Ga0182185_1083834	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	896
3300015349|Ga0182185_1240354	Not Available	551
3300015349|Ga0182185_1263629	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	525
3300015350|Ga0182163_1110132	Not Available	841
3300015350|Ga0182163_1220075	Not Available	595
3300015350|Ga0182163_1243482	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	564
3300015352|Ga0182169_1190332	Not Available	671
3300015353|Ga0182179_1272434	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	548
3300015353|Ga0182179_1284625	Not Available	536
3300015354|Ga0182167_1277482	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	599
3300017412|Ga0182199_1110960	Not Available	640
3300017414|Ga0182195_1191928	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	534
3300017422|Ga0182201_1127606	Not Available	526
3300017439|Ga0182200_1087717	Not Available	628
3300017439|Ga0182200_1111364	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	578
3300017440|Ga0182214_1039284	Not Available	935
3300017440|Ga0182214_1114783	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	582
3300017440|Ga0182214_1152912	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	513
3300017445|Ga0182198_1175494	Not Available	533
3300017446|Ga0182217_1062612	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	865
3300017692|Ga0182210_1116259	Not Available	583
3300017692|Ga0182210_1123419	Not Available	567
3300017792|Ga0163161_11354633	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	620
3300022465|Ga0213505_119126	Not Available	551
3300026088|Ga0207641_12438370	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	522
3300026095|Ga0207676_12283110	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	539
3300028050|Ga0268328_1003170	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1340
3300028050|Ga0268328_1071986	Not Available	502
3300028051|Ga0268344_1006089	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	779
3300028054|Ga0268306_1026434	Not Available	553
3300028058|Ga0268332_1072603	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	520
3300028061|Ga0268314_1045740	Not Available	536
3300028062|Ga0268342_1019820	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	660
3300028064|Ga0268340_1013856	Not Available	930
3300028064|Ga0268340_1032422	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	715
3300028144|Ga0268345_1010545	Not Available	684
3300028150|Ga0268343_1005197	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	792
3300028150|Ga0268343_1008188	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	679
3300028154|Ga0268341_1010981	Not Available	697
3300028154|Ga0268341_1012134	Not Available	676
3300028248|Ga0268312_1019525	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	625
3300028248|Ga0268312_1027693	Not Available	560
3300028262|Ga0268310_1048948	Not Available	515
3300028464|Ga0268302_106251	Not Available	566
3300028475|Ga0268327_1003025	Not Available	937
3300028527|Ga0268335_1015490	Not Available	534
3300028529|Ga0268311_1009098	Not Available	725
3300032467|Ga0214488_1095482	Not Available	647
3300032467|Ga0214488_1136088	Not Available	514
3300032514|Ga0214502_1200336	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	765
3300032589|Ga0214500_1210879	Not Available	548
3300032689|Ga0214497_1134113	Not Available	518
3300032697|Ga0214499_1254958	Not Available	540
3300033526|Ga0314761_1073117	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	762
3300033534|Ga0314757_1070857	Not Available	837
3300033535|Ga0314759_1081500	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1003
3300033535|Ga0314759_1251409	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	560

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	96.67%
Environmental	Environmental	3.33%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	96.67%
Terrestrial	Environmental → Terrestrial	3.33%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	79.33%
Unclassified	Host-Associated → Plants → Unclassified	7.33%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.00%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.00%
Soil	Environmental → Terrestrial → Soil	3.33%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	79.33%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	7.33%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.33%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.67%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.67%
Loam	Environmental → Terrestrial → Soil → Loam	0.67%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	79.33%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	7.33%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.33%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	2.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.67%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.67%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	65.33%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	14.00%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	7.33%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.33%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.67%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated
3300009973	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG	Host-Associated
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017446	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300022465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated
3300028062	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1	Host-Associated
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated
3300028144	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1	Host-Associated
3300028150	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1	Host-Associated
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated
3300028464	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1	Host-Associated
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated
3300028527	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1	Host-Associated
3300028529	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1	Host-Associated
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032514	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032589	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032689	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300033526	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300033534	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300033535	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070670_1021712142	3300005331	Switchgrass Rhizosphere	MQTKLNKSKKIILDTRHENKANKTGFPIFSLSSKKFYIKP
Ga0070668_1004662282	3300005347	Switchgrass Rhizosphere	MQTELNKFKKIIFETRQQHKANKTGFTNFSLSRKKFYNKPHFGQQA*
Ga0070671_1007243931	3300005355	Switchgrass Rhizosphere	MQTKLNKSKKIIMETRQEHKANKTGFAVLPLSSAKFYIKPFSYKA*
Ga0070708_1012747871	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MQTKLNKSKKIIIETRQQHKANKTGFTNFSLSSKKFYIKPYFGQQARN*
Ga0070665_1025213012	3300005548	Switchgrass Rhizosphere	MQTKLNKSKKIILDTRHENKANKTSFTIFSLSSKKFYIKPF
Ga0068864_1014513002	3300005618	Switchgrass Rhizosphere	MQTYLNKTKKIIMETRQEHKANKTSFTIFSLSSKKFYIK
Ga0068860_1016814371	3300005843	Switchgrass Rhizosphere	MQTKLNKSKKIITETRHENKANKIGFTIFSLSSKKFYIKPFSDKV*
Ga0105248_128970831	3300009177	Switchgrass Rhizosphere	KLNKSKKIILDTRHENKANKTCFTIFSLSSKKFYIKPHFGQQARN*
Ga0105137_1028291	3300009972	Switchgrass Associated	IQTELNKSKKIIMGTRQEHKANKTGFAILSLSCTKFCNKPFSDKV*
Ga0105136_1028531	3300009973	Switchgrass Associated	NRKGMQTKLNKSKKIIMETRQEHKANKIGFAILPLSSANSSIKPFSDKV*
Ga0105136_1102401	3300009973	Switchgrass Associated	QTQLNKSKKIIIETRQEHKANKKGFAILPISGAKFYIKPFSDRANKNTLKP*
Ga0105128_1079071	3300009976	Switchgrass Associated	MQTYLHKSKKIIIETRQEHKANKTSFAILSLSIKKFYIKPFSDKA*
Ga0105131_1010201	3300009989	Switchgrass Associated	MQTELNKFKKIIFETRQQHKANKTGFTNFSLSSKKFYNKPHFGQQA*
Ga0105132_1053581	3300009990	Switchgrass Associated	TELNKSKKIILDTRQQHKANKTGFAILPLSSKKFYIKPFSDKS*
Ga0105132_1207811	3300009990	Switchgrass Associated	SKKIILDTRHENKANKIGFAIFSLSCTKFYNKPFSAKV*
Ga0105126_10502101	3300009994	Switchgrass Associated	MQTYLNKSKKIILDTRQEHKANKTSFAILSLSSKKFYIKPFSDKA*
Ga0105126_10513881	3300009994	Switchgrass Associated	MQTKLNKSKNIIIETRQEHKANKTSFAIFSLSSKKFYIKLFLDKAYKNTLKS*
Ga0105139_10502651	3300009995	Switchgrass Associated	KLNKSKKIILDARHENKDNKTSFDILSLSSKKFYNKPFSSKA*
Ga0105139_11155801	3300009995	Switchgrass Associated	MQPKLNKSNKIIMETRQEHKANKTGFAILSLSSNKFYIKPFSDKA*
Ga0134125_129751331	3300010371	Terrestrial Soil	MQTYLNKFNKIILDTKHEKKANKTGFTIFSLSSKKFYIKPHFGEQARN*
Ga0134126_113431771	3300010396	Terrestrial Soil	RGMQTKLNKSKKIILDTRHENKANKTSFAIFSLSSKKFYNKPHFGQQA*
Ga0134126_117692941	3300010396	Terrestrial Soil	LNKSKKIILDTRHENKANKIGFTIFSLSSKKFYIKQFSYKV*
Ga0134124_131655751	3300010397	Terrestrial Soil	MQTELNKSNKIIMETRQEHKANKTGFANFSLSSKKFYIKPYFGQQERN
Ga0163162_123087301	3300013306	Switchgrass Rhizosphere	MQTKLNKSKKIILDTRHENKANKTGFAILSLSNKKV*
Ga0157380_105977771	3300014326	Switchgrass Rhizosphere	MQTKLNKSKKIILDTRQEHKANKTGFTIFSLSCKE
Ga0157379_110321551	3300014968	Switchgrass Rhizosphere	NSNKIILKTRQEHKANKTGFANLPLSSKKFYIKTFSDKV*
Ga0157379_119327491	3300014968	Switchgrass Rhizosphere	NKSRKIIIDTRNEHKANKTSFAILSLSSKKFYTKLFSNIA*
Ga0157379_122598901	3300014968	Switchgrass Rhizosphere	MQTKLNKSKKNILDTRYENKANKTGFAIFSLSSKKFYIKPYFG
Ga0182102_10084982	3300015273	Switchgrass Phyllosphere	MQTYLNKSKKIIIETRQQHKANKTSFAILPLSSKKFYIKPFSDKA*
Ga0182102_10141281	3300015273	Switchgrass Phyllosphere	YINKSKKIILDTRHANKANKTSFTIFSLSNKKFYIKPFSEKA*
Ga0182099_10188071	3300015278	Switchgrass Phyllosphere	MQTKLNKSKKIILDTRHEKKSKKIGFTIVSLSNKKF
Ga0182099_10668821	3300015278	Switchgrass Phyllosphere	LNKTNKIILDTRHENRANKTGFAILSLSYTKFYNKPFSDKA*
Ga0182100_10722911	3300015280	Switchgrass Phyllosphere	MQTKLNKSKKNSLVTRHESKANKTGFAILSLSSKKFYNKPFSDKA*
Ga0182100_10948162	3300015280	Switchgrass Phyllosphere	MQTKLNKSQKIILDTRNENKANKTSFTIFSLSSKKFY
Ga0182101_10511911	3300015284	Switchgrass Phyllosphere	IQTELNKSKTIIIETRHESKVNKTSFAILSLSSKKFYPKPFLVSAYKTTPKLYKQQENI*
Ga0182105_10288341	3300015290	Switchgrass Phyllosphere	MQTKLNKSKKIIMKSRQERKANKTDFTNFSLSSKKFYIKPFSDKV*
Ga0182105_10650961	3300015290	Switchgrass Phyllosphere	NKSKKIILDTRHENKANKTGFTIFSLSRKKFYIKPF*
Ga0182105_10666021	3300015290	Switchgrass Phyllosphere	MQNQLKKSKKIIIETRQEHKANKIGFAILPLSSAKFYIKPFLDKANENTLKP*
Ga0182103_10976931	3300015293	Switchgrass Phyllosphere	SKKITMESRRENKANKTGFTILPLSSKKFYLKLFSDKV*
Ga0182104_10249341	3300015297	Switchgrass Phyllosphere	MQTELNKSKKIILDTRHENKANKTGFAILPLSSKKFYIKLFSDKV*
Ga0182184_10358161	3300015301	Switchgrass Phyllosphere	MQTKLNKSKKIILETKQEHKANKTSFAILSLSSKKFYNKPFSDKV*
Ga0182184_11008561	3300015301	Switchgrass Phyllosphere	LKKSKKIILDTRHEKNPNKIGFTIFSLSSKKFYIKPFLDKA*
Ga0182098_10816551	3300015309	Switchgrass Phyllosphere	KKIILDTRQEYKANKTSFAVLPLSSKKFYIKLFSDKA*
Ga0182098_11059841	3300015309	Switchgrass Phyllosphere	MQTELNKSNKIIIETRQQHKAKKTSFSILPLSSKKFYI
Ga0182162_10506091	3300015310	Switchgrass Phyllosphere	QTKLNKSKKIIFETRQQHKAYKTSFAILSLSGKKF*
Ga0182182_10555491	3300015311	Switchgrass Phyllosphere	KKIIIDTMHENKANKTSFTLLSLSSKNFYIKIFSNKT*
Ga0182182_10620021	3300015311	Switchgrass Phyllosphere	KGMQTYLNKSKKIIMETKQEHKANKTGFAILSLSSKKF*
Ga0182168_10209381	3300015312	Switchgrass Phyllosphere	QTTLNKSNKIITETRHEHKANKIGFTIFSLSSKKFYIKPFSDKV*
Ga0182168_10747211	3300015312	Switchgrass Phyllosphere	MQTKLNKSKKIILDTMHENKANRTGFTILSLSCTK
Ga0182164_10962371	3300015313	Switchgrass Phyllosphere	MQTQLNKSKKIILETRQEHKTNKTGFTNFSLSNKKFYIKPYFGQQARK
Ga0182120_11061031	3300015315	Switchgrass Phyllosphere	MQTYLHKSKKIILDTRHENKANNTGFAILSLSNKKFYIKPFSDKA*
Ga0182121_10845351	3300015316	Switchgrass Phyllosphere	MQTELNKSKKIIIETRQQHKAKKTGFAILQLSNKKF*
Ga0182121_11325831	3300015316	Switchgrass Phyllosphere	MQTELNKSKKIIIETRQQHKANKTGFAILPLSSKKFYIKPF
Ga0182136_10370071	3300015317	Switchgrass Phyllosphere	MQTKLKKSKKIILDTRHEKKANKTGFAILSLSSKK
Ga0182130_10347561	3300015319	Switchgrass Phyllosphere	MQTELNKSKKIIFETRQQHKANKTGFTNFSLSSKKFYNKPHFGQQA*
Ga0182130_10965461	3300015319	Switchgrass Phyllosphere	MQTKLNKSNKIILDTRHENKANKIGFTIFSLSSKKFY
Ga0182165_11388161	3300015320	Switchgrass Phyllosphere	MQTKLKKIKKIIIEIRQEHKANKTGFTIFSLSSKKF
Ga0182134_10157411	3300015324	Switchgrass Phyllosphere	MQTKLNKSKKIILETKQEHKANKTGFAILSLSSKKFYIKPHFGQQA*
Ga0182134_10688941	3300015324	Switchgrass Phyllosphere	MQTYLNKSKKITLDTRNESKANKTDFTIFSLSSKKF
Ga0182134_10703191	3300015324	Switchgrass Phyllosphere	MQTYLNKSKKIILDTRHENKANKTSFTIFSLSNKL
Ga0182134_10717491	3300015324	Switchgrass Phyllosphere	MQTKLNKSKKIIFETRQQHKANKTGFAILSLSSKKF*
Ga0182148_10383121	3300015325	Switchgrass Phyllosphere	KGIQTELNKSKKIIIETRHENKANKTSFAILSLSCKKFHIKPHFGQQA*
Ga0182148_10826681	3300015325	Switchgrass Phyllosphere	KIILENRQEHKANKTSFTIFSLSSKKFYIKPFSDKV*
Ga0182148_10832341	3300015325	Switchgrass Phyllosphere	MQTEVNKSNKIIIETRKQHKAKKIGFAILPLSSKQFYIKSFSDKV*
Ga0182166_11378641	3300015326	Switchgrass Phyllosphere	MQTELNKSKKIIIETRQKHKANKTGFTNFSLSSKKF
Ga0182114_10381021	3300015327	Switchgrass Phyllosphere	MQTQLNKSKKIIFETRQHYKANKIGFAILSLSSKKFYIKLFSDKA*
Ga0182114_10714031	3300015327	Switchgrass Phyllosphere	MQTYLNKSKKIILDTRYENKANNTSFTIFSISSKKLYIKPFSDKA*
Ga0182114_10998261	3300015327	Switchgrass Phyllosphere	GMQTQLNKSKKIILETRQEHKANKTGFSILPLSSTKFYIKLVSAKV*
Ga0182114_11207441	3300015327	Switchgrass Phyllosphere	KSKKIILDTRHENKANKTGFAILSLSCTKFYIKPFSDKA*
Ga0182153_10469312	3300015328	Switchgrass Phyllosphere	LNKTQKFNLDTTYENKSNQTGFDDFSLSKKMFYIKPFLDKA*
Ga0182153_11373651	3300015328	Switchgrass Phyllosphere	KSKKLILDTKHENKANTTGFTIFSLSSKKFYIIPFSEKV*
Ga0182153_11389432	3300015328	Switchgrass Phyllosphere	LNKNKKIIIDTRHEHKANKTGFDILSLSSKKFYIKPFSDRANENTLKP*
Ga0182153_11538301	3300015328	Switchgrass Phyllosphere	KPKKIITETRHENKANKIGFTTFSLSSKKFYTKPHFV*
Ga0182135_10788771	3300015329	Switchgrass Phyllosphere	MQTYPNTSKKIIIGTRHEHKADKIGFTILSLSSQKFCIK
Ga0182135_11069241	3300015329	Switchgrass Phyllosphere	GMQTYLNQSKKIILDTRYENESKETVFDILSLSSKKFYIKPFSDKA*
Ga0182135_11399971	3300015329	Switchgrass Phyllosphere	MQTKLNKSKKITLDNRHEKKANKTGFTILSLSEKSS
Ga0182131_10207841	3300015331	Switchgrass Phyllosphere	MQTQLHKSKKIILETRQEHKANKTGFTNFSLSNKKFYIKPYFGQQARK*
Ga0182147_11295111	3300015333	Switchgrass Phyllosphere	MQTQLNKSKKIIIETRQEHKANKTSFVILPLSNAKFYIKPFSDRANENTLKP*
Ga0182132_10384911	3300015334	Switchgrass Phyllosphere	MQTQLNKFKKIILETRQEHKANKTGFAILPLSSAKFYIKP
Ga0182132_11043481	3300015334	Switchgrass Phyllosphere	MQTKLSKSKKIILDTRHENKANKTGFTIFSIFSKNFYTK
Ga0182132_11608981	3300015334	Switchgrass Phyllosphere	MQTKLNKSKKIILDTRHEKKANKTGFTIFSLSSKKFYIKPFLAKV*
Ga0182132_11629951	3300015334	Switchgrass Phyllosphere	MQTYLNKPKKIILDTRYENKSNQTGFAILSLSSKKFYIKPFLDKA*
Ga0182150_11151921	3300015336	Switchgrass Phyllosphere	MQPKLNKSNTIIMETRQEHKANKTGFAILSLSSKKF
Ga0182151_10199221	3300015337	Switchgrass Phyllosphere	QTELNKSKKIIMETRQEHKANKTSFTIFSLSSKKFYLKLFSDGTNKNTLKP*
Ga0182151_11167881	3300015337	Switchgrass Phyllosphere	MQTKLNKSKKIILETKHENKANKTGFANLPLSSAKFYIKPFSDRTNENTLKP*
Ga0182151_11402361	3300015337	Switchgrass Phyllosphere	MQTELNKSNKIILDTRHEKKANKTGFAIFSLSSKKF
Ga0182133_10343021	3300015340	Switchgrass Phyllosphere	MQTKLNKSNKIILETRQEHKTNKTDFTIFSLSSKKF*
Ga0182133_11292391	3300015340	Switchgrass Phyllosphere	LNKSNKIIIDTRHEHQAKKTSFTILSLSSKKFYIKPFLDRA*
Ga0182133_11369621	3300015340	Switchgrass Phyllosphere	MQTKLNKSKKISLDTRHKKKANKTDFTIFSLSSKKF
Ga0182133_11522191	3300015340	Switchgrass Phyllosphere	MQTKLNKSKKIILDTRHENKANKTGFTIFTLSSKKFYIKPFSDKV*
Ga0182115_11825761	3300015348	Switchgrass Phyllosphere	MQTQLNKSKKIIIETRQEHKANKTSFAILPLSSAKFYIKPFSDGANENTQKP*
Ga0182115_12272851	3300015348	Switchgrass Phyllosphere	RKGMQTQLNKPKEIIIETKQERKTNKTCCAILSLSSVKFYIKLFSDRANKNTLKP*
Ga0182185_10838341	3300015349	Switchgrass Phyllosphere	MQTYINKSKKIILDTRYENKSNQTSFTILSLSSKKFYIKLFSDKAQENKLKL**
Ga0182185_12403541	3300015349	Switchgrass Phyllosphere	MQTKLNKSKKIIMETKQEHKANKTGFAILSLSGNKFYNKPFSAKA*
Ga0182185_12636291	3300015349	Switchgrass Phyllosphere	MQTKLNKSKKIIFETRKQQKSYKTGFDILSLSSKKFYIKPFSAKV*
Ga0182163_11101322	3300015350	Switchgrass Phyllosphere	SKKIIFETRQQHKANKTGFTNFSLSSKKFYIKPYFGQQARN*
Ga0182163_12200751	3300015350	Switchgrass Phyllosphere	ELNKSKKIIIETRHENKANKTSFAILSLSCKKFHIKPHFGQQA*
Ga0182163_12434821	3300015350	Switchgrass Phyllosphere	MQTKLNKSKKIIFDTRHENKANKTGFTIFSLSSKKFYIKPFLAKV*
Ga0182169_11903321	3300015352	Switchgrass Phyllosphere	MTTKLNKSKKIIIDTRHENKAKKTGFTILSLSNKKFYLKTFLDRTKGN
Ga0182179_12724341	3300015353	Switchgrass Phyllosphere	MQTELNKSKKIILDTRLENKFNKTGFSILSLSSKKFYIKPFSDKA*
Ga0182179_12846251	3300015353	Switchgrass Phyllosphere	MKNKLNKSKKIILDTRHENKAKKIGFAFFSLSSKKF
Ga0182167_12774821	3300015354	Switchgrass Phyllosphere	MQTQLNKSKKIILETKQEQKANKTGFTIFSLSSKKFYIKPFSAKA*
Ga0182199_11109601	3300017412	Switchgrass Phyllosphere	LKKSNKIILDTRHENKSNKTSFTIFSLSSKNFYIKPFSDKV
Ga0182195_11919281	3300017414	Switchgrass Phyllosphere	MQTELNKFKKIIFETRQQHKANKTGFTNFSLSRKK
Ga0182201_11276061	3300017422	Switchgrass Phyllosphere	MQTYLNKSKKIIFDTRHENKANKTGFPIFSLPSKKFYIKPFSDKA
Ga0182200_10877171	3300017439	Switchgrass Phyllosphere	MQTKLNKSKKNILETKQEHKANKTGFAILSLSSKKFYIKPFSDKAYENKLKL
Ga0182200_11113642	3300017439	Switchgrass Phyllosphere	MQNQLNKSKKIILETMQEHKAKKTGFAILPLSSAKFYIKLVSAKA
Ga0182214_10392841	3300017440	Switchgrass Phyllosphere	MQTQLNKSKKIILDTKQEHKANKTGFTIFSLSYKECYIKPHFGQQA
Ga0182214_11147831	3300017440	Switchgrass Phyllosphere	MQTKLNKSKKIIKETRQEHKANKTGFAILSLFSKKFY
Ga0182214_11529121	3300017440	Switchgrass Phyllosphere	MQTYLNKSKKIIIDTRYKYKANKIGLIILSLPSKKF
Ga0182198_11754941	3300017445	Switchgrass Phyllosphere	MQTKLNKSKKIILDTRHEKKPNKTGFAILALSSKKFYIKPFSYKA
Ga0182217_10626121	3300017446	Switchgrass Phyllosphere	MQTKLNKSKKIILDTRHENKANKTSFAILSLSSKKFYIKPFSDKA
Ga0182210_11162591	3300017692	Switchgrass Phyllosphere	MKTELNKSKKIFFETRKKHKATKTGFTNFSLSSKKFYIK
Ga0182210_11234191	3300017692	Switchgrass Phyllosphere	MQNKLNKSKKIILETKQERKANKTGFAILSLSSRKF
Ga0182216_12134491	3300017693	Switchgrass Phyllosphere	SKKIIIDTMHENKANKTGFIFLSLSNKKFYIKPFLDRANKNTLKP
Ga0163161_113546331	3300017792	Switchgrass Rhizosphere	MQTELNKSNKIILDTRHENKANKTSFAILSLSCKKFYNKPHFGQQAXNL
Ga0213505_1191261	3300022465	Switchgrass Phyllosphere	MQTKLNKSNKIIMETKQEHKANKTGFAILSLSSKKF
Ga0207641_124383701	3300026088	Switchgrass Rhizosphere	MQTKLNKSKKIIIETRQEHKAKKTSFAIFSLSSKKLYIKP
Ga0207676_122831101	3300026095	Switchgrass Rhizosphere	MQTQLNKSKKIILETRQEHKANKTGFAILPLSSAKFYIKPVSAKV
Ga0268328_10031701	3300028050	Phyllosphere	MQPKLNKSKKIIFETRQQHKANKTGFAILSLSSKKF
Ga0268328_10719861	3300028050	Phyllosphere	MKTKLNKSKKIIIETRKEHKAYKTGFAILTLSSKKFYNKPFSAKA
Ga0268344_10060891	3300028051	Phyllosphere	MQTKLNKYKQIIMETKKEHKANKTGFAILSLSRKKF
Ga0268306_10264342	3300028054	Phyllosphere	MRKGMQTKLNKSNKIILETRQEHKTNKTGFTIFSLSS
Ga0268332_10726031	3300028058	Phyllosphere	MQNYLNKTKKIILDTRHKNKANKTSFTIFSLSSKNFYIKPFS
Ga0268314_10457401	3300028061	Phyllosphere	MQTELNKSKKITMESRHENKANKTGFTILPLSSKKFYLKLFSDKV
Ga0268342_10198201	3300028062	Phyllosphere	MQTELNKFKKIIFETRQQHKANKTGFTNFSLSRKKFYNKPHFG
Ga0268340_10138561	3300028064	Phyllosphere	MQTNLNKSKKIISETRHENKANKIGFTIFSLSSKKFFIKPFSDKA
Ga0268340_10324222	3300028064	Phyllosphere	MQTKLSKSKKIILDTRHENKANKTGFTIFSLSSKKFYIKPFLAKV
Ga0268345_10105451	3300028144	Phyllosphere	MQTELNKSKKIIMETRQEHKANKTSFAILPLSSKKFYIKPFSDKV
Ga0268343_10051971	3300028150	Phyllosphere	MQTELNKSKKIILETRQEHKANKTGFAIFSLSSKKFYIKPFSDK
Ga0268343_10081881	3300028150	Phyllosphere	MQTKLNKSKKIILDTRHENKANKTGFTIFSLSRKKF
Ga0268341_10109811	3300028154	Phyllosphere	MQTKLRKSKKIILDTRHENKANKTGFTIFSLSTKKF
Ga0268341_10121341	3300028154	Phyllosphere	MQTKVNKSKKTIIDTMHENKANKTGFTIFSLSNKK
Ga0268312_10195251	3300028248	Phyllosphere	MQTYLNKSKKIILDTRHENKANKTGFTTFSLSNKKF
Ga0268312_10276932	3300028248	Phyllosphere	FGKGMQTYLNKSPKIILDTRNENKSNKTGFAILSLSSKKFYIKPFSDKA
Ga0268310_10489481	3300028262	Phyllosphere	SKKIILDTRHENKANKTGFAILPLFSKKFYNKPFSDKV
Ga0268302_1062512	3300028464	Phyllosphere	MQTELNKSKKIIMETKQEHKANKTGFAILSLSCTKF
Ga0268327_10030251	3300028475	Phyllosphere	MKTYLNKSNKIILDNRYENKSNQTGFAILSLSSKKF
Ga0268335_10154901	3300028527	Phyllosphere	KKIILENRQEHKANKTSFTIFSLSSKKFYIKPFSDKV
Ga0268311_10090981	3300028529	Phyllosphere	MQTELNKSKKIIMETSQEHKANKTSFAILPLSSKKFYIKPFSDKV
Ga0214488_10954821	3300032467	Switchgrass Phyllosphere	MQTKLNKSKKIILDTRHEKKANKIGFTIFSLSSKKFYIKPFLDKA
Ga0214488_11360881	3300032467	Switchgrass Phyllosphere	MQTKLNKSKKIILDTRHENKANKTGFAIFSLSSKNF
Ga0214502_12003361	3300032514	Switchgrass Phyllosphere	MQTQLNKSKKIIFETRQEHEANKTGFAIFLLSSKKFYTKQP
Ga0214500_12108791	3300032589	Switchgrass Phyllosphere	LNKSKKIILETRHGSKANKIGFTIFSLSSKKFYNKPHFGQQA
Ga0214497_11341131	3300032689	Switchgrass Phyllosphere	MQTKLNKSKKISLDTRHEKKVNKTGFTIFSLSSKKFYIKPF
Ga0214499_12549581	3300032697	Switchgrass Phyllosphere	MQTKLNKSKKIILDTRHENKANKTGFAILSLSSKKF
Ga0314761_10731171	3300033526	Switchgrass Phyllosphere	MQTELNKFKKIIFETRQQHKANKTGFTNFSLSSKKFY
Ga0314757_10708571	3300033534	Switchgrass Phyllosphere	MQTELNKSNKIILDSRHEKKANKSGLAILSLSIKKF
Ga0314759_10815001	3300033535	Switchgrass Phyllosphere	MQTKLNKSKKNILETKQEHKANKTGFAILSLSSKKFYIK
Ga0314759_12514092	3300033535	Switchgrass Phyllosphere	MQTELNKFKKIIFETRQQHKANKTGFTNFSLSRKKDL