| Basic Information | |
|---|---|
| Family ID | F046792 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MQTELNKSKKIILETRQEHKANKTGFAIFSLSSKKFYIKPFSDK |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 43.62 % |
| % of genes near scaffold ends (potentially truncated) | 63.33 % |
| % of genes from short scaffolds (< 2000 bps) | 99.33 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.333 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (65.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (80.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.33 % |
| All Organisms | root | All Organisms | 32.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005331|Ga0070670_102171214 | Not Available | 512 | Open in IMG/M |
| 3300005347|Ga0070668_100466228 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1088 | Open in IMG/M |
| 3300005355|Ga0070671_100724393 | Not Available | 864 | Open in IMG/M |
| 3300005445|Ga0070708_101274787 | Not Available | 687 | Open in IMG/M |
| 3300005548|Ga0070665_102521301 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 516 | Open in IMG/M |
| 3300005618|Ga0068864_101451300 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 689 | Open in IMG/M |
| 3300005843|Ga0068860_101681437 | Not Available | 657 | Open in IMG/M |
| 3300009177|Ga0105248_12897083 | Not Available | 547 | Open in IMG/M |
| 3300009972|Ga0105137_102829 | Not Available | 746 | Open in IMG/M |
| 3300009973|Ga0105136_102853 | Not Available | 868 | Open in IMG/M |
| 3300009973|Ga0105136_110240 | Not Available | 572 | Open in IMG/M |
| 3300009976|Ga0105128_107907 | Not Available | 687 | Open in IMG/M |
| 3300009989|Ga0105131_101020 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1812 | Open in IMG/M |
| 3300009990|Ga0105132_105358 | Not Available | 929 | Open in IMG/M |
| 3300009990|Ga0105132_120781 | Not Available | 646 | Open in IMG/M |
| 3300009994|Ga0105126_1050210 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 528 | Open in IMG/M |
| 3300009994|Ga0105126_1051388 | Not Available | 523 | Open in IMG/M |
| 3300009995|Ga0105139_1050265 | Not Available | 732 | Open in IMG/M |
| 3300009995|Ga0105139_1115580 | Not Available | 520 | Open in IMG/M |
| 3300010371|Ga0134125_12975133 | Not Available | 514 | Open in IMG/M |
| 3300010396|Ga0134126_11343177 | Not Available | 791 | Open in IMG/M |
| 3300010396|Ga0134126_11769294 | Not Available | 678 | Open in IMG/M |
| 3300010397|Ga0134124_13165575 | Not Available | 504 | Open in IMG/M |
| 3300013306|Ga0163162_12308730 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 618 | Open in IMG/M |
| 3300014326|Ga0157380_10597777 | Not Available | 1091 | Open in IMG/M |
| 3300014968|Ga0157379_11032155 | Not Available | 785 | Open in IMG/M |
| 3300014968|Ga0157379_11932749 | Not Available | 582 | Open in IMG/M |
| 3300014968|Ga0157379_12259890 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 541 | Open in IMG/M |
| 3300015273|Ga0182102_1008498 | Not Available | 781 | Open in IMG/M |
| 3300015273|Ga0182102_1014128 | Not Available | 690 | Open in IMG/M |
| 3300015278|Ga0182099_1018807 | Not Available | 732 | Open in IMG/M |
| 3300015278|Ga0182099_1066882 | Not Available | 518 | Open in IMG/M |
| 3300015280|Ga0182100_1072291 | Not Available | 564 | Open in IMG/M |
| 3300015280|Ga0182100_1094816 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 511 | Open in IMG/M |
| 3300015284|Ga0182101_1051191 | Not Available | 634 | Open in IMG/M |
| 3300015290|Ga0182105_1028834 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 782 | Open in IMG/M |
| 3300015290|Ga0182105_1065096 | Not Available | 603 | Open in IMG/M |
| 3300015290|Ga0182105_1066602 | Not Available | 598 | Open in IMG/M |
| 3300015293|Ga0182103_1097693 | Not Available | 513 | Open in IMG/M |
| 3300015297|Ga0182104_1024934 | Not Available | 853 | Open in IMG/M |
| 3300015301|Ga0182184_1035816 | Not Available | 713 | Open in IMG/M |
| 3300015301|Ga0182184_1100856 | Not Available | 503 | Open in IMG/M |
| 3300015309|Ga0182098_1081655 | Not Available | 591 | Open in IMG/M |
| 3300015309|Ga0182098_1105984 | Not Available | 539 | Open in IMG/M |
| 3300015310|Ga0182162_1050609 | Not Available | 708 | Open in IMG/M |
| 3300015311|Ga0182182_1055549 | Not Available | 667 | Open in IMG/M |
| 3300015311|Ga0182182_1062002 | Not Available | 642 | Open in IMG/M |
| 3300015312|Ga0182168_1020938 | Not Available | 970 | Open in IMG/M |
| 3300015312|Ga0182168_1074721 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 636 | Open in IMG/M |
| 3300015313|Ga0182164_1096237 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 578 | Open in IMG/M |
| 3300015315|Ga0182120_1106103 | Not Available | 560 | Open in IMG/M |
| 3300015316|Ga0182121_1084535 | Not Available | 629 | Open in IMG/M |
| 3300015316|Ga0182121_1132583 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 523 | Open in IMG/M |
| 3300015317|Ga0182136_1037007 | Not Available | 817 | Open in IMG/M |
| 3300015319|Ga0182130_1034756 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 812 | Open in IMG/M |
| 3300015319|Ga0182130_1096546 | Not Available | 575 | Open in IMG/M |
| 3300015320|Ga0182165_1138816 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 515 | Open in IMG/M |
| 3300015324|Ga0182134_1015741 | Not Available | 1090 | Open in IMG/M |
| 3300015324|Ga0182134_1068894 | Not Available | 675 | Open in IMG/M |
| 3300015324|Ga0182134_1070319 | Not Available | 670 | Open in IMG/M |
| 3300015324|Ga0182134_1071749 | Not Available | 665 | Open in IMG/M |
| 3300015325|Ga0182148_1038312 | Not Available | 811 | Open in IMG/M |
| 3300015325|Ga0182148_1082668 | Not Available | 625 | Open in IMG/M |
| 3300015325|Ga0182148_1083234 | Not Available | 624 | Open in IMG/M |
| 3300015326|Ga0182166_1137864 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 513 | Open in IMG/M |
| 3300015327|Ga0182114_1038102 | Not Available | 875 | Open in IMG/M |
| 3300015327|Ga0182114_1071403 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 700 | Open in IMG/M |
| 3300015327|Ga0182114_1099826 | Not Available | 615 | Open in IMG/M |
| 3300015327|Ga0182114_1120744 | Not Available | 570 | Open in IMG/M |
| 3300015328|Ga0182153_1046931 | Not Available | 778 | Open in IMG/M |
| 3300015328|Ga0182153_1137365 | Not Available | 525 | Open in IMG/M |
| 3300015328|Ga0182153_1138943 | Not Available | 523 | Open in IMG/M |
| 3300015328|Ga0182153_1153830 | Not Available | 502 | Open in IMG/M |
| 3300015329|Ga0182135_1078877 | Not Available | 655 | Open in IMG/M |
| 3300015329|Ga0182135_1106924 | Not Available | 584 | Open in IMG/M |
| 3300015329|Ga0182135_1139997 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 524 | Open in IMG/M |
| 3300015331|Ga0182131_1020784 | Not Available | 1029 | Open in IMG/M |
| 3300015333|Ga0182147_1129511 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 563 | Open in IMG/M |
| 3300015334|Ga0182132_1038491 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 890 | Open in IMG/M |
| 3300015334|Ga0182132_1104348 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 617 | Open in IMG/M |
| 3300015334|Ga0182132_1160898 | Not Available | 514 | Open in IMG/M |
| 3300015334|Ga0182132_1162995 | Not Available | 511 | Open in IMG/M |
| 3300015336|Ga0182150_1115192 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 585 | Open in IMG/M |
| 3300015337|Ga0182151_1019922 | Not Available | 1070 | Open in IMG/M |
| 3300015337|Ga0182151_1116788 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 581 | Open in IMG/M |
| 3300015337|Ga0182151_1140236 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 540 | Open in IMG/M |
| 3300015340|Ga0182133_1034302 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 984 | Open in IMG/M |
| 3300015340|Ga0182133_1129239 | Not Available | 598 | Open in IMG/M |
| 3300015340|Ga0182133_1136962 | Not Available | 583 | Open in IMG/M |
| 3300015340|Ga0182133_1152219 | Not Available | 557 | Open in IMG/M |
| 3300015348|Ga0182115_1182576 | Not Available | 673 | Open in IMG/M |
| 3300015348|Ga0182115_1227285 | Not Available | 596 | Open in IMG/M |
| 3300015349|Ga0182185_1083834 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 896 | Open in IMG/M |
| 3300015349|Ga0182185_1240354 | Not Available | 551 | Open in IMG/M |
| 3300015349|Ga0182185_1263629 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 525 | Open in IMG/M |
| 3300015350|Ga0182163_1110132 | Not Available | 841 | Open in IMG/M |
| 3300015350|Ga0182163_1220075 | Not Available | 595 | Open in IMG/M |
| 3300015350|Ga0182163_1243482 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 564 | Open in IMG/M |
| 3300015352|Ga0182169_1190332 | Not Available | 671 | Open in IMG/M |
| 3300015353|Ga0182179_1272434 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 548 | Open in IMG/M |
| 3300015353|Ga0182179_1284625 | Not Available | 536 | Open in IMG/M |
| 3300015354|Ga0182167_1277482 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 599 | Open in IMG/M |
| 3300017412|Ga0182199_1110960 | Not Available | 640 | Open in IMG/M |
| 3300017414|Ga0182195_1191928 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 534 | Open in IMG/M |
| 3300017422|Ga0182201_1127606 | Not Available | 526 | Open in IMG/M |
| 3300017439|Ga0182200_1087717 | Not Available | 628 | Open in IMG/M |
| 3300017439|Ga0182200_1111364 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 578 | Open in IMG/M |
| 3300017440|Ga0182214_1039284 | Not Available | 935 | Open in IMG/M |
| 3300017440|Ga0182214_1114783 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 582 | Open in IMG/M |
| 3300017440|Ga0182214_1152912 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 513 | Open in IMG/M |
| 3300017445|Ga0182198_1175494 | Not Available | 533 | Open in IMG/M |
| 3300017446|Ga0182217_1062612 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 865 | Open in IMG/M |
| 3300017692|Ga0182210_1116259 | Not Available | 583 | Open in IMG/M |
| 3300017692|Ga0182210_1123419 | Not Available | 567 | Open in IMG/M |
| 3300017792|Ga0163161_11354633 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 620 | Open in IMG/M |
| 3300022465|Ga0213505_119126 | Not Available | 551 | Open in IMG/M |
| 3300026088|Ga0207641_12438370 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 522 | Open in IMG/M |
| 3300026095|Ga0207676_12283110 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 539 | Open in IMG/M |
| 3300028050|Ga0268328_1003170 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1340 | Open in IMG/M |
| 3300028050|Ga0268328_1071986 | Not Available | 502 | Open in IMG/M |
| 3300028051|Ga0268344_1006089 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 779 | Open in IMG/M |
| 3300028054|Ga0268306_1026434 | Not Available | 553 | Open in IMG/M |
| 3300028058|Ga0268332_1072603 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 520 | Open in IMG/M |
| 3300028061|Ga0268314_1045740 | Not Available | 536 | Open in IMG/M |
| 3300028062|Ga0268342_1019820 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 660 | Open in IMG/M |
| 3300028064|Ga0268340_1013856 | Not Available | 930 | Open in IMG/M |
| 3300028064|Ga0268340_1032422 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 715 | Open in IMG/M |
| 3300028144|Ga0268345_1010545 | Not Available | 684 | Open in IMG/M |
| 3300028150|Ga0268343_1005197 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 792 | Open in IMG/M |
| 3300028150|Ga0268343_1008188 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 679 | Open in IMG/M |
| 3300028154|Ga0268341_1010981 | Not Available | 697 | Open in IMG/M |
| 3300028154|Ga0268341_1012134 | Not Available | 676 | Open in IMG/M |
| 3300028248|Ga0268312_1019525 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 625 | Open in IMG/M |
| 3300028248|Ga0268312_1027693 | Not Available | 560 | Open in IMG/M |
| 3300028262|Ga0268310_1048948 | Not Available | 515 | Open in IMG/M |
| 3300028464|Ga0268302_106251 | Not Available | 566 | Open in IMG/M |
| 3300028475|Ga0268327_1003025 | Not Available | 937 | Open in IMG/M |
| 3300028527|Ga0268335_1015490 | Not Available | 534 | Open in IMG/M |
| 3300028529|Ga0268311_1009098 | Not Available | 725 | Open in IMG/M |
| 3300032467|Ga0214488_1095482 | Not Available | 647 | Open in IMG/M |
| 3300032467|Ga0214488_1136088 | Not Available | 514 | Open in IMG/M |
| 3300032514|Ga0214502_1200336 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 765 | Open in IMG/M |
| 3300032589|Ga0214500_1210879 | Not Available | 548 | Open in IMG/M |
| 3300032689|Ga0214497_1134113 | Not Available | 518 | Open in IMG/M |
| 3300032697|Ga0214499_1254958 | Not Available | 540 | Open in IMG/M |
| 3300033526|Ga0314761_1073117 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 762 | Open in IMG/M |
| 3300033534|Ga0314757_1070857 | Not Available | 837 | Open in IMG/M |
| 3300033535|Ga0314759_1081500 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1003 | Open in IMG/M |
| 3300033535|Ga0314759_1251409 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 560 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 65.33% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 14.00% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 7.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
| 3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
| 3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300022465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028464 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033534 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070670_1021712142 | 3300005331 | Switchgrass Rhizosphere | MQTKLNKSKKIILDTRHENKANKTGFPIFSLSSKKFYIKP |
| Ga0070668_1004662282 | 3300005347 | Switchgrass Rhizosphere | MQTELNKFKKIIFETRQQHKANKTGFTNFSLSRKKFYNKPHFGQQA* |
| Ga0070671_1007243931 | 3300005355 | Switchgrass Rhizosphere | MQTKLNKSKKIIMETRQEHKANKTGFAVLPLSSAKFYIKPFSYKA* |
| Ga0070708_1012747871 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTKLNKSKKIIIETRQQHKANKTGFTNFSLSSKKFYIKPYFGQQARN* |
| Ga0070665_1025213012 | 3300005548 | Switchgrass Rhizosphere | MQTKLNKSKKIILDTRHENKANKTSFTIFSLSSKKFYIKPF |
| Ga0068864_1014513002 | 3300005618 | Switchgrass Rhizosphere | MQTYLNKTKKIIMETRQEHKANKTSFTIFSLSSKKFYIK |
| Ga0068860_1016814371 | 3300005843 | Switchgrass Rhizosphere | MQTKLNKSKKIITETRHENKANKIGFTIFSLSSKKFYIKPFSDKV* |
| Ga0105248_128970831 | 3300009177 | Switchgrass Rhizosphere | KLNKSKKIILDTRHENKANKTCFTIFSLSSKKFYIKPHFGQQARN* |
| Ga0105137_1028291 | 3300009972 | Switchgrass Associated | IQTELNKSKKIIMGTRQEHKANKTGFAILSLSCTKFCNKPFSDKV* |
| Ga0105136_1028531 | 3300009973 | Switchgrass Associated | NRKGMQTKLNKSKKIIMETRQEHKANKIGFAILPLSSANSSIKPFSDKV* |
| Ga0105136_1102401 | 3300009973 | Switchgrass Associated | QTQLNKSKKIIIETRQEHKANKKGFAILPISGAKFYIKPFSDRANKNTLKP* |
| Ga0105128_1079071 | 3300009976 | Switchgrass Associated | MQTYLHKSKKIIIETRQEHKANKTSFAILSLSIKKFYIKPFSDKA* |
| Ga0105131_1010201 | 3300009989 | Switchgrass Associated | MQTELNKFKKIIFETRQQHKANKTGFTNFSLSSKKFYNKPHFGQQA* |
| Ga0105132_1053581 | 3300009990 | Switchgrass Associated | TELNKSKKIILDTRQQHKANKTGFAILPLSSKKFYIKPFSDKS* |
| Ga0105132_1207811 | 3300009990 | Switchgrass Associated | SKKIILDTRHENKANKIGFAIFSLSCTKFYNKPFSAKV* |
| Ga0105126_10502101 | 3300009994 | Switchgrass Associated | MQTYLNKSKKIILDTRQEHKANKTSFAILSLSSKKFYIKPFSDKA* |
| Ga0105126_10513881 | 3300009994 | Switchgrass Associated | MQTKLNKSKNIIIETRQEHKANKTSFAIFSLSSKKFYIKLFLDKAYKNTLKS* |
| Ga0105139_10502651 | 3300009995 | Switchgrass Associated | KLNKSKKIILDARHENKDNKTSFDILSLSSKKFYNKPFSSKA* |
| Ga0105139_11155801 | 3300009995 | Switchgrass Associated | MQPKLNKSNKIIMETRQEHKANKTGFAILSLSSNKFYIKPFSDKA* |
| Ga0134125_129751331 | 3300010371 | Terrestrial Soil | MQTYLNKFNKIILDTKHEKKANKTGFTIFSLSSKKFYIKPHFGEQARN* |
| Ga0134126_113431771 | 3300010396 | Terrestrial Soil | RGMQTKLNKSKKIILDTRHENKANKTSFAIFSLSSKKFYNKPHFGQQA* |
| Ga0134126_117692941 | 3300010396 | Terrestrial Soil | LNKSKKIILDTRHENKANKIGFTIFSLSSKKFYIKQFSYKV* |
| Ga0134124_131655751 | 3300010397 | Terrestrial Soil | MQTELNKSNKIIMETRQEHKANKTGFANFSLSSKKFYIKPYFGQQERN |
| Ga0163162_123087301 | 3300013306 | Switchgrass Rhizosphere | MQTKLNKSKKIILDTRHENKANKTGFAILSLSNKKV* |
| Ga0157380_105977771 | 3300014326 | Switchgrass Rhizosphere | MQTKLNKSKKIILDTRQEHKANKTGFTIFSLSCKE |
| Ga0157379_110321551 | 3300014968 | Switchgrass Rhizosphere | NSNKIILKTRQEHKANKTGFANLPLSSKKFYIKTFSDKV* |
| Ga0157379_119327491 | 3300014968 | Switchgrass Rhizosphere | NKSRKIIIDTRNEHKANKTSFAILSLSSKKFYTKLFSNIA* |
| Ga0157379_122598901 | 3300014968 | Switchgrass Rhizosphere | MQTKLNKSKKNILDTRYENKANKTGFAIFSLSSKKFYIKPYFG |
| Ga0182102_10084982 | 3300015273 | Switchgrass Phyllosphere | MQTYLNKSKKIIIETRQQHKANKTSFAILPLSSKKFYIKPFSDKA* |
| Ga0182102_10141281 | 3300015273 | Switchgrass Phyllosphere | YINKSKKIILDTRHANKANKTSFTIFSLSNKKFYIKPFSEKA* |
| Ga0182099_10188071 | 3300015278 | Switchgrass Phyllosphere | MQTKLNKSKKIILDTRHEKKSKKIGFTIVSLSNKKF |
| Ga0182099_10668821 | 3300015278 | Switchgrass Phyllosphere | LNKTNKIILDTRHENRANKTGFAILSLSYTKFYNKPFSDKA* |
| Ga0182100_10722911 | 3300015280 | Switchgrass Phyllosphere | MQTKLNKSKKNSLVTRHESKANKTGFAILSLSSKKFYNKPFSDKA* |
| Ga0182100_10948162 | 3300015280 | Switchgrass Phyllosphere | MQTKLNKSQKIILDTRNENKANKTSFTIFSLSSKKFY |
| Ga0182101_10511911 | 3300015284 | Switchgrass Phyllosphere | IQTELNKSKTIIIETRHESKVNKTSFAILSLSSKKFYPKPFLVSAYKTTPKLYKQQENI* |
| Ga0182105_10288341 | 3300015290 | Switchgrass Phyllosphere | MQTKLNKSKKIIMKSRQERKANKTDFTNFSLSSKKFYIKPFSDKV* |
| Ga0182105_10650961 | 3300015290 | Switchgrass Phyllosphere | NKSKKIILDTRHENKANKTGFTIFSLSRKKFYIKPF* |
| Ga0182105_10666021 | 3300015290 | Switchgrass Phyllosphere | MQNQLKKSKKIIIETRQEHKANKIGFAILPLSSAKFYIKPFLDKANENTLKP* |
| Ga0182103_10976931 | 3300015293 | Switchgrass Phyllosphere | SKKITMESRRENKANKTGFTILPLSSKKFYLKLFSDKV* |
| Ga0182104_10249341 | 3300015297 | Switchgrass Phyllosphere | MQTELNKSKKIILDTRHENKANKTGFAILPLSSKKFYIKLFSDKV* |
| Ga0182184_10358161 | 3300015301 | Switchgrass Phyllosphere | MQTKLNKSKKIILETKQEHKANKTSFAILSLSSKKFYNKPFSDKV* |
| Ga0182184_11008561 | 3300015301 | Switchgrass Phyllosphere | LKKSKKIILDTRHEKNPNKIGFTIFSLSSKKFYIKPFLDKA* |
| Ga0182098_10816551 | 3300015309 | Switchgrass Phyllosphere | KKIILDTRQEYKANKTSFAVLPLSSKKFYIKLFSDKA* |
| Ga0182098_11059841 | 3300015309 | Switchgrass Phyllosphere | MQTELNKSNKIIIETRQQHKAKKTSFSILPLSSKKFYI |
| Ga0182162_10506091 | 3300015310 | Switchgrass Phyllosphere | QTKLNKSKKIIFETRQQHKAYKTSFAILSLSGKKF* |
| Ga0182182_10555491 | 3300015311 | Switchgrass Phyllosphere | KKIIIDTMHENKANKTSFTLLSLSSKNFYIKIFSNKT* |
| Ga0182182_10620021 | 3300015311 | Switchgrass Phyllosphere | KGMQTYLNKSKKIIMETKQEHKANKTGFAILSLSSKKF* |
| Ga0182168_10209381 | 3300015312 | Switchgrass Phyllosphere | QTTLNKSNKIITETRHEHKANKIGFTIFSLSSKKFYIKPFSDKV* |
| Ga0182168_10747211 | 3300015312 | Switchgrass Phyllosphere | MQTKLNKSKKIILDTMHENKANRTGFTILSLSCTK |
| Ga0182164_10962371 | 3300015313 | Switchgrass Phyllosphere | MQTQLNKSKKIILETRQEHKTNKTGFTNFSLSNKKFYIKPYFGQQARK |
| Ga0182120_11061031 | 3300015315 | Switchgrass Phyllosphere | MQTYLHKSKKIILDTRHENKANNTGFAILSLSNKKFYIKPFSDKA* |
| Ga0182121_10845351 | 3300015316 | Switchgrass Phyllosphere | MQTELNKSKKIIIETRQQHKAKKTGFAILQLSNKKF* |
| Ga0182121_11325831 | 3300015316 | Switchgrass Phyllosphere | MQTELNKSKKIIIETRQQHKANKTGFAILPLSSKKFYIKPF |
| Ga0182136_10370071 | 3300015317 | Switchgrass Phyllosphere | MQTKLKKSKKIILDTRHEKKANKTGFAILSLSSKK |
| Ga0182130_10347561 | 3300015319 | Switchgrass Phyllosphere | MQTELNKSKKIIFETRQQHKANKTGFTNFSLSSKKFYNKPHFGQQA* |
| Ga0182130_10965461 | 3300015319 | Switchgrass Phyllosphere | MQTKLNKSNKIILDTRHENKANKIGFTIFSLSSKKFY |
| Ga0182165_11388161 | 3300015320 | Switchgrass Phyllosphere | MQTKLKKIKKIIIEIRQEHKANKTGFTIFSLSSKKF |
| Ga0182134_10157411 | 3300015324 | Switchgrass Phyllosphere | MQTKLNKSKKIILETKQEHKANKTGFAILSLSSKKFYIKPHFGQQA* |
| Ga0182134_10688941 | 3300015324 | Switchgrass Phyllosphere | MQTYLNKSKKITLDTRNESKANKTDFTIFSLSSKKF |
| Ga0182134_10703191 | 3300015324 | Switchgrass Phyllosphere | MQTYLNKSKKIILDTRHENKANKTSFTIFSLSNKL |
| Ga0182134_10717491 | 3300015324 | Switchgrass Phyllosphere | MQTKLNKSKKIIFETRQQHKANKTGFAILSLSSKKF* |
| Ga0182148_10383121 | 3300015325 | Switchgrass Phyllosphere | KGIQTELNKSKKIIIETRHENKANKTSFAILSLSCKKFHIKPHFGQQA* |
| Ga0182148_10826681 | 3300015325 | Switchgrass Phyllosphere | KIILENRQEHKANKTSFTIFSLSSKKFYIKPFSDKV* |
| Ga0182148_10832341 | 3300015325 | Switchgrass Phyllosphere | MQTEVNKSNKIIIETRKQHKAKKIGFAILPLSSKQFYIKSFSDKV* |
| Ga0182166_11378641 | 3300015326 | Switchgrass Phyllosphere | MQTELNKSKKIIIETRQKHKANKTGFTNFSLSSKKF |
| Ga0182114_10381021 | 3300015327 | Switchgrass Phyllosphere | MQTQLNKSKKIIFETRQHYKANKIGFAILSLSSKKFYIKLFSDKA* |
| Ga0182114_10714031 | 3300015327 | Switchgrass Phyllosphere | MQTYLNKSKKIILDTRYENKANNTSFTIFSISSKKLYIKPFSDKA* |
| Ga0182114_10998261 | 3300015327 | Switchgrass Phyllosphere | GMQTQLNKSKKIILETRQEHKANKTGFSILPLSSTKFYIKLVSAKV* |
| Ga0182114_11207441 | 3300015327 | Switchgrass Phyllosphere | KSKKIILDTRHENKANKTGFAILSLSCTKFYIKPFSDKA* |
| Ga0182153_10469312 | 3300015328 | Switchgrass Phyllosphere | LNKTQKFNLDTTYENKSNQTGFDDFSLSKKMFYIKPFLDKA* |
| Ga0182153_11373651 | 3300015328 | Switchgrass Phyllosphere | KSKKLILDTKHENKANTTGFTIFSLSSKKFYIIPFSEKV* |
| Ga0182153_11389432 | 3300015328 | Switchgrass Phyllosphere | LNKNKKIIIDTRHEHKANKTGFDILSLSSKKFYIKPFSDRANENTLKP* |
| Ga0182153_11538301 | 3300015328 | Switchgrass Phyllosphere | KPKKIITETRHENKANKIGFTTFSLSSKKFYTKPHFV* |
| Ga0182135_10788771 | 3300015329 | Switchgrass Phyllosphere | MQTYPNTSKKIIIGTRHEHKADKIGFTILSLSSQKFCIK |
| Ga0182135_11069241 | 3300015329 | Switchgrass Phyllosphere | GMQTYLNQSKKIILDTRYENESKETVFDILSLSSKKFYIKPFSDKA* |
| Ga0182135_11399971 | 3300015329 | Switchgrass Phyllosphere | MQTKLNKSKKITLDNRHEKKANKTGFTILSLSEKSS |
| Ga0182131_10207841 | 3300015331 | Switchgrass Phyllosphere | MQTQLHKSKKIILETRQEHKANKTGFTNFSLSNKKFYIKPYFGQQARK* |
| Ga0182147_11295111 | 3300015333 | Switchgrass Phyllosphere | MQTQLNKSKKIIIETRQEHKANKTSFVILPLSNAKFYIKPFSDRANENTLKP* |
| Ga0182132_10384911 | 3300015334 | Switchgrass Phyllosphere | MQTQLNKFKKIILETRQEHKANKTGFAILPLSSAKFYIKP |
| Ga0182132_11043481 | 3300015334 | Switchgrass Phyllosphere | MQTKLSKSKKIILDTRHENKANKTGFTIFSIFSKNFYTK |
| Ga0182132_11608981 | 3300015334 | Switchgrass Phyllosphere | MQTKLNKSKKIILDTRHEKKANKTGFTIFSLSSKKFYIKPFLAKV* |
| Ga0182132_11629951 | 3300015334 | Switchgrass Phyllosphere | MQTYLNKPKKIILDTRYENKSNQTGFAILSLSSKKFYIKPFLDKA* |
| Ga0182150_11151921 | 3300015336 | Switchgrass Phyllosphere | MQPKLNKSNTIIMETRQEHKANKTGFAILSLSSKKF |
| Ga0182151_10199221 | 3300015337 | Switchgrass Phyllosphere | QTELNKSKKIIMETRQEHKANKTSFTIFSLSSKKFYLKLFSDGTNKNTLKP* |
| Ga0182151_11167881 | 3300015337 | Switchgrass Phyllosphere | MQTKLNKSKKIILETKHENKANKTGFANLPLSSAKFYIKPFSDRTNENTLKP* |
| Ga0182151_11402361 | 3300015337 | Switchgrass Phyllosphere | MQTELNKSNKIILDTRHEKKANKTGFAIFSLSSKKF |
| Ga0182133_10343021 | 3300015340 | Switchgrass Phyllosphere | MQTKLNKSNKIILETRQEHKTNKTDFTIFSLSSKKF* |
| Ga0182133_11292391 | 3300015340 | Switchgrass Phyllosphere | LNKSNKIIIDTRHEHQAKKTSFTILSLSSKKFYIKPFLDRA* |
| Ga0182133_11369621 | 3300015340 | Switchgrass Phyllosphere | MQTKLNKSKKISLDTRHKKKANKTDFTIFSLSSKKF |
| Ga0182133_11522191 | 3300015340 | Switchgrass Phyllosphere | MQTKLNKSKKIILDTRHENKANKTGFTIFTLSSKKFYIKPFSDKV* |
| Ga0182115_11825761 | 3300015348 | Switchgrass Phyllosphere | MQTQLNKSKKIIIETRQEHKANKTSFAILPLSSAKFYIKPFSDGANENTQKP* |
| Ga0182115_12272851 | 3300015348 | Switchgrass Phyllosphere | RKGMQTQLNKPKEIIIETKQERKTNKTCCAILSLSSVKFYIKLFSDRANKNTLKP* |
| Ga0182185_10838341 | 3300015349 | Switchgrass Phyllosphere | MQTYINKSKKIILDTRYENKSNQTSFTILSLSSKKFYIKLFSDKAQENKLKL** |
| Ga0182185_12403541 | 3300015349 | Switchgrass Phyllosphere | MQTKLNKSKKIIMETKQEHKANKTGFAILSLSGNKFYNKPFSAKA* |
| Ga0182185_12636291 | 3300015349 | Switchgrass Phyllosphere | MQTKLNKSKKIIFETRKQQKSYKTGFDILSLSSKKFYIKPFSAKV* |
| Ga0182163_11101322 | 3300015350 | Switchgrass Phyllosphere | SKKIIFETRQQHKANKTGFTNFSLSSKKFYIKPYFGQQARN* |
| Ga0182163_12200751 | 3300015350 | Switchgrass Phyllosphere | ELNKSKKIIIETRHENKANKTSFAILSLSCKKFHIKPHFGQQA* |
| Ga0182163_12434821 | 3300015350 | Switchgrass Phyllosphere | MQTKLNKSKKIIFDTRHENKANKTGFTIFSLSSKKFYIKPFLAKV* |
| Ga0182169_11903321 | 3300015352 | Switchgrass Phyllosphere | MTTKLNKSKKIIIDTRHENKAKKTGFTILSLSNKKFYLKTFLDRTKGN |
| Ga0182179_12724341 | 3300015353 | Switchgrass Phyllosphere | MQTELNKSKKIILDTRLENKFNKTGFSILSLSSKKFYIKPFSDKA* |
| Ga0182179_12846251 | 3300015353 | Switchgrass Phyllosphere | MKNKLNKSKKIILDTRHENKAKKIGFAFFSLSSKKF |
| Ga0182167_12774821 | 3300015354 | Switchgrass Phyllosphere | MQTQLNKSKKIILETKQEQKANKTGFTIFSLSSKKFYIKPFSAKA* |
| Ga0182199_11109601 | 3300017412 | Switchgrass Phyllosphere | LKKSNKIILDTRHENKSNKTSFTIFSLSSKNFYIKPFSDKV |
| Ga0182195_11919281 | 3300017414 | Switchgrass Phyllosphere | MQTELNKFKKIIFETRQQHKANKTGFTNFSLSRKK |
| Ga0182201_11276061 | 3300017422 | Switchgrass Phyllosphere | MQTYLNKSKKIIFDTRHENKANKTGFPIFSLPSKKFYIKPFSDKA |
| Ga0182200_10877171 | 3300017439 | Switchgrass Phyllosphere | MQTKLNKSKKNILETKQEHKANKTGFAILSLSSKKFYIKPFSDKAYENKLKL |
| Ga0182200_11113642 | 3300017439 | Switchgrass Phyllosphere | MQNQLNKSKKIILETMQEHKAKKTGFAILPLSSAKFYIKLVSAKA |
| Ga0182214_10392841 | 3300017440 | Switchgrass Phyllosphere | MQTQLNKSKKIILDTKQEHKANKTGFTIFSLSYKECYIKPHFGQQA |
| Ga0182214_11147831 | 3300017440 | Switchgrass Phyllosphere | MQTKLNKSKKIIKETRQEHKANKTGFAILSLFSKKFY |
| Ga0182214_11529121 | 3300017440 | Switchgrass Phyllosphere | MQTYLNKSKKIIIDTRYKYKANKIGLIILSLPSKKF |
| Ga0182198_11754941 | 3300017445 | Switchgrass Phyllosphere | MQTKLNKSKKIILDTRHEKKPNKTGFAILALSSKKFYIKPFSYKA |
| Ga0182217_10626121 | 3300017446 | Switchgrass Phyllosphere | MQTKLNKSKKIILDTRHENKANKTSFAILSLSSKKFYIKPFSDKA |
| Ga0182210_11162591 | 3300017692 | Switchgrass Phyllosphere | MKTELNKSKKIFFETRKKHKATKTGFTNFSLSSKKFYIK |
| Ga0182210_11234191 | 3300017692 | Switchgrass Phyllosphere | MQNKLNKSKKIILETKQERKANKTGFAILSLSSRKF |
| Ga0182216_12134491 | 3300017693 | Switchgrass Phyllosphere | SKKIIIDTMHENKANKTGFIFLSLSNKKFYIKPFLDRANKNTLKP |
| Ga0163161_113546331 | 3300017792 | Switchgrass Rhizosphere | MQTELNKSNKIILDTRHENKANKTSFAILSLSCKKFYNKPHFGQQAXNL |
| Ga0213505_1191261 | 3300022465 | Switchgrass Phyllosphere | MQTKLNKSNKIIMETKQEHKANKTGFAILSLSSKKF |
| Ga0207641_124383701 | 3300026088 | Switchgrass Rhizosphere | MQTKLNKSKKIIIETRQEHKAKKTSFAIFSLSSKKLYIKP |
| Ga0207676_122831101 | 3300026095 | Switchgrass Rhizosphere | MQTQLNKSKKIILETRQEHKANKTGFAILPLSSAKFYIKPVSAKV |
| Ga0268328_10031701 | 3300028050 | Phyllosphere | MQPKLNKSKKIIFETRQQHKANKTGFAILSLSSKKF |
| Ga0268328_10719861 | 3300028050 | Phyllosphere | MKTKLNKSKKIIIETRKEHKAYKTGFAILTLSSKKFYNKPFSAKA |
| Ga0268344_10060891 | 3300028051 | Phyllosphere | MQTKLNKYKQIIMETKKEHKANKTGFAILSLSRKKF |
| Ga0268306_10264342 | 3300028054 | Phyllosphere | MRKGMQTKLNKSNKIILETRQEHKTNKTGFTIFSLSS |
| Ga0268332_10726031 | 3300028058 | Phyllosphere | MQNYLNKTKKIILDTRHKNKANKTSFTIFSLSSKNFYIKPFS |
| Ga0268314_10457401 | 3300028061 | Phyllosphere | MQTELNKSKKITMESRHENKANKTGFTILPLSSKKFYLKLFSDKV |
| Ga0268342_10198201 | 3300028062 | Phyllosphere | MQTELNKFKKIIFETRQQHKANKTGFTNFSLSRKKFYNKPHFG |
| Ga0268340_10138561 | 3300028064 | Phyllosphere | MQTNLNKSKKIISETRHENKANKIGFTIFSLSSKKFFIKPFSDKA |
| Ga0268340_10324222 | 3300028064 | Phyllosphere | MQTKLSKSKKIILDTRHENKANKTGFTIFSLSSKKFYIKPFLAKV |
| Ga0268345_10105451 | 3300028144 | Phyllosphere | MQTELNKSKKIIMETRQEHKANKTSFAILPLSSKKFYIKPFSDKV |
| Ga0268343_10051971 | 3300028150 | Phyllosphere | MQTELNKSKKIILETRQEHKANKTGFAIFSLSSKKFYIKPFSDK |
| Ga0268343_10081881 | 3300028150 | Phyllosphere | MQTKLNKSKKIILDTRHENKANKTGFTIFSLSRKKF |
| Ga0268341_10109811 | 3300028154 | Phyllosphere | MQTKLRKSKKIILDTRHENKANKTGFTIFSLSTKKF |
| Ga0268341_10121341 | 3300028154 | Phyllosphere | MQTKVNKSKKTIIDTMHENKANKTGFTIFSLSNKK |
| Ga0268312_10195251 | 3300028248 | Phyllosphere | MQTYLNKSKKIILDTRHENKANKTGFTTFSLSNKKF |
| Ga0268312_10276932 | 3300028248 | Phyllosphere | FGKGMQTYLNKSPKIILDTRNENKSNKTGFAILSLSSKKFYIKPFSDKA |
| Ga0268310_10489481 | 3300028262 | Phyllosphere | SKKIILDTRHENKANKTGFAILPLFSKKFYNKPFSDKV |
| Ga0268302_1062512 | 3300028464 | Phyllosphere | MQTELNKSKKIIMETKQEHKANKTGFAILSLSCTKF |
| Ga0268327_10030251 | 3300028475 | Phyllosphere | MKTYLNKSNKIILDNRYENKSNQTGFAILSLSSKKF |
| Ga0268335_10154901 | 3300028527 | Phyllosphere | KKIILENRQEHKANKTSFTIFSLSSKKFYIKPFSDKV |
| Ga0268311_10090981 | 3300028529 | Phyllosphere | MQTELNKSKKIIMETSQEHKANKTSFAILPLSSKKFYIKPFSDKV |
| Ga0214488_10954821 | 3300032467 | Switchgrass Phyllosphere | MQTKLNKSKKIILDTRHEKKANKIGFTIFSLSSKKFYIKPFLDKA |
| Ga0214488_11360881 | 3300032467 | Switchgrass Phyllosphere | MQTKLNKSKKIILDTRHENKANKTGFAIFSLSSKNF |
| Ga0214502_12003361 | 3300032514 | Switchgrass Phyllosphere | MQTQLNKSKKIIFETRQEHEANKTGFAIFLLSSKKFYTKQP |
| Ga0214500_12108791 | 3300032589 | Switchgrass Phyllosphere | LNKSKKIILETRHGSKANKIGFTIFSLSSKKFYNKPHFGQQA |
| Ga0214497_11341131 | 3300032689 | Switchgrass Phyllosphere | MQTKLNKSKKISLDTRHEKKVNKTGFTIFSLSSKKFYIKPF |
| Ga0214499_12549581 | 3300032697 | Switchgrass Phyllosphere | MQTKLNKSKKIILDTRHENKANKTGFAILSLSSKKF |
| Ga0314761_10731171 | 3300033526 | Switchgrass Phyllosphere | MQTELNKFKKIIFETRQQHKANKTGFTNFSLSSKKFY |
| Ga0314757_10708571 | 3300033534 | Switchgrass Phyllosphere | MQTELNKSNKIILDSRHEKKANKSGLAILSLSIKKF |
| Ga0314759_10815001 | 3300033535 | Switchgrass Phyllosphere | MQTKLNKSKKNILETKQEHKANKTGFAILSLSSKKFYIK |
| Ga0314759_12514092 | 3300033535 | Switchgrass Phyllosphere | MQTELNKFKKIIFETRQQHKANKTGFTNFSLSRKKDL |
| ⦗Top⦘ |