| Basic Information | |
|---|---|
| Family ID | F046671 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 151 |
| Average Sequence Length | 50 residues |
| Representative Sequence | VDDPKVLTAPWTMAPRVVKPSTEPLEESPRCVEADANRLVNNDHHGQR |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.67 % |
| % of genes near scaffold ends (potentially truncated) | 96.03 % |
| % of genes from short scaffolds (< 2000 bps) | 91.39 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.444 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.934 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.126 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.397 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.89% β-sheet: 0.00% Coil/Unstructured: 92.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF06831 | H2TH | 5.96 |
| PF00034 | Cytochrom_C | 5.30 |
| PF01436 | NHL | 3.97 |
| PF01522 | Polysacc_deac_1 | 3.97 |
| PF02838 | Glyco_hydro_20b | 3.97 |
| PF04055 | Radical_SAM | 2.65 |
| PF07519 | Tannase | 2.65 |
| PF00486 | Trans_reg_C | 1.99 |
| PF01075 | Glyco_transf_9 | 1.99 |
| PF07589 | PEP-CTERM | 1.99 |
| PF14534 | DUF4440 | 1.32 |
| PF03952 | Enolase_N | 1.32 |
| PF10518 | TAT_signal | 1.32 |
| PF02518 | HATPase_c | 1.32 |
| PF00111 | Fer2 | 1.32 |
| PF15919 | HicB_lk_antitox | 1.32 |
| PF01741 | MscL | 1.32 |
| PF03681 | Obsolete Pfam Family | 1.32 |
| PF00113 | Enolase_C | 1.32 |
| PF00753 | Lactamase_B | 0.66 |
| PF04389 | Peptidase_M28 | 0.66 |
| PF13393 | tRNA-synt_His | 0.66 |
| PF16656 | Pur_ac_phosph_N | 0.66 |
| PF01590 | GAF | 0.66 |
| PF00144 | Beta-lactamase | 0.66 |
| PF11992 | TgpA_N | 0.66 |
| PF13229 | Beta_helix | 0.66 |
| PF07638 | Sigma70_ECF | 0.66 |
| PF01797 | Y1_Tnp | 0.66 |
| PF13353 | Fer4_12 | 0.66 |
| PF13185 | GAF_2 | 0.66 |
| PF13360 | PQQ_2 | 0.66 |
| PF08669 | GCV_T_C | 0.66 |
| PF13620 | CarboxypepD_reg | 0.66 |
| PF00596 | Aldolase_II | 0.66 |
| PF12796 | Ank_2 | 0.66 |
| PF05015 | HigB-like_toxin | 0.66 |
| PF03781 | FGE-sulfatase | 0.66 |
| PF00310 | GATase_2 | 0.66 |
| PF01546 | Peptidase_M20 | 0.66 |
| PF00534 | Glycos_transf_1 | 0.66 |
| PF13637 | Ank_4 | 0.66 |
| PF00072 | Response_reg | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 5.96 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 3.97 |
| COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 3.97 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 2.65 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.99 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.32 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.66 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.66 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.66 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.66 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.44 % |
| Unclassified | root | N/A | 16.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101345329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300004633|Ga0066395_10023842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2468 | Open in IMG/M |
| 3300005166|Ga0066674_10078310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1519 | Open in IMG/M |
| 3300005174|Ga0066680_10119383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1630 | Open in IMG/M |
| 3300005327|Ga0070658_11411436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300005434|Ga0070709_10610976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300005434|Ga0070709_10789640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300005436|Ga0070713_101666246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300005439|Ga0070711_100382761 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300005450|Ga0066682_10214464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
| 3300005533|Ga0070734_10089808 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300005535|Ga0070684_101857095 | Not Available | 568 | Open in IMG/M |
| 3300005538|Ga0070731_10868114 | Not Available | 598 | Open in IMG/M |
| 3300005564|Ga0070664_100906514 | Not Available | 827 | Open in IMG/M |
| 3300005841|Ga0068863_101988356 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005842|Ga0068858_100046589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4018 | Open in IMG/M |
| 3300006031|Ga0066651_10149033 | Not Available | 1224 | Open in IMG/M |
| 3300006162|Ga0075030_100329414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1219 | Open in IMG/M |
| 3300006163|Ga0070715_10244754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300006172|Ga0075018_10148566 | Not Available | 1079 | Open in IMG/M |
| 3300006175|Ga0070712_101821236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300006354|Ga0075021_10591742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 708 | Open in IMG/M |
| 3300006796|Ga0066665_10807038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300006846|Ga0075430_100076175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2811 | Open in IMG/M |
| 3300006881|Ga0068865_101772345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300006954|Ga0079219_11469355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 614 | Open in IMG/M |
| 3300009012|Ga0066710_104251848 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300009012|Ga0066710_104363427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300009090|Ga0099827_11151917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 674 | Open in IMG/M |
| 3300009098|Ga0105245_12034620 | Not Available | 628 | Open in IMG/M |
| 3300009156|Ga0111538_13301129 | Not Available | 561 | Open in IMG/M |
| 3300009174|Ga0105241_10010504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6792 | Open in IMG/M |
| 3300009174|Ga0105241_10752452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300009176|Ga0105242_10336057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1391 | Open in IMG/M |
| 3300009176|Ga0105242_12221956 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300009177|Ga0105248_10163754 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300009177|Ga0105248_11540157 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300009525|Ga0116220_10503799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300009553|Ga0105249_10653614 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300009553|Ga0105249_11313395 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300010043|Ga0126380_10091234 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300010046|Ga0126384_12421339 | Not Available | 508 | Open in IMG/M |
| 3300010047|Ga0126382_10500087 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300010047|Ga0126382_10527570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 955 | Open in IMG/M |
| 3300010048|Ga0126373_10321344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1551 | Open in IMG/M |
| 3300010325|Ga0134064_10123894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300010339|Ga0074046_10164871 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300010358|Ga0126370_12036859 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010360|Ga0126372_12532588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300010361|Ga0126378_12700847 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010376|Ga0126381_100441614 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300010376|Ga0126381_101233696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1081 | Open in IMG/M |
| 3300010379|Ga0136449_100842041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1507 | Open in IMG/M |
| 3300010379|Ga0136449_102779308 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300010401|Ga0134121_10100556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2425 | Open in IMG/M |
| 3300011120|Ga0150983_10885636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300011269|Ga0137392_10718692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300012211|Ga0137377_10397852 | Not Available | 1315 | Open in IMG/M |
| 3300012212|Ga0150985_115254117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300012390|Ga0134054_1098647 | Not Available | 500 | Open in IMG/M |
| 3300012917|Ga0137395_10401320 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300012930|Ga0137407_11048987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300012931|Ga0153915_11193289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300012960|Ga0164301_10748477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 741 | Open in IMG/M |
| 3300013297|Ga0157378_10365515 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300014325|Ga0163163_10235787 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
| 3300014499|Ga0182012_10352970 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300014638|Ga0181536_10394602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300014969|Ga0157376_11245583 | Not Available | 773 | Open in IMG/M |
| 3300014969|Ga0157376_11974156 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300015241|Ga0137418_10515740 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300016319|Ga0182033_11545569 | Not Available | 599 | Open in IMG/M |
| 3300016371|Ga0182034_11745283 | Not Available | 548 | Open in IMG/M |
| 3300016404|Ga0182037_10478494 | Not Available | 1040 | Open in IMG/M |
| 3300017792|Ga0163161_11594883 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300017959|Ga0187779_10322703 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300018037|Ga0187883_10508327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300018431|Ga0066655_10900574 | Not Available | 605 | Open in IMG/M |
| 3300020027|Ga0193752_1137093 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300020580|Ga0210403_11396051 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300021086|Ga0179596_10301627 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300021170|Ga0210400_10391229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
| 3300021432|Ga0210384_10024735 | All Organisms → cellular organisms → Bacteria | 5691 | Open in IMG/M |
| 3300021432|Ga0210384_11073094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300021432|Ga0210384_11441790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300021432|Ga0210384_11683200 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300021478|Ga0210402_11567594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300021559|Ga0210409_10321223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1393 | Open in IMG/M |
| 3300021560|Ga0126371_10934639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 1010 | Open in IMG/M |
| 3300021858|Ga0213852_1060442 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300025160|Ga0209109_10272902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18 | 815 | Open in IMG/M |
| 3300025905|Ga0207685_10235735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
| 3300025911|Ga0207654_11166743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 561 | Open in IMG/M |
| 3300025914|Ga0207671_11171863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300025916|Ga0207663_10779282 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300025916|Ga0207663_11607969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300025927|Ga0207687_10591857 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300025927|Ga0207687_11414376 | Not Available | 598 | Open in IMG/M |
| 3300025928|Ga0207700_11075965 | Not Available | 719 | Open in IMG/M |
| 3300025934|Ga0207686_11109169 | Not Available | 645 | Open in IMG/M |
| 3300025938|Ga0207704_10067500 | All Organisms → cellular organisms → Bacteria | 2250 | Open in IMG/M |
| 3300025939|Ga0207665_10156760 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300025941|Ga0207711_10310082 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300025941|Ga0207711_11427175 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300025949|Ga0207667_10423739 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300025961|Ga0207712_12006278 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300026095|Ga0207676_11520280 | Not Available | 667 | Open in IMG/M |
| 3300026142|Ga0207698_10256911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1603 | Open in IMG/M |
| 3300026142|Ga0207698_11270199 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300027869|Ga0209579_10685618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300027879|Ga0209169_10177267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300027895|Ga0209624_10780645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300028380|Ga0268265_12369510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300029636|Ga0222749_10396861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300029953|Ga0311343_11046226 | Not Available | 637 | Open in IMG/M |
| 3300029987|Ga0311334_11813045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300029999|Ga0311339_10614294 | Not Available | 1080 | Open in IMG/M |
| 3300030706|Ga0310039_10382074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300030862|Ga0265753_1125988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300031231|Ga0170824_112177320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300031247|Ga0265340_10064982 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300031564|Ga0318573_10105610 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300031679|Ga0318561_10046554 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
| 3300031708|Ga0310686_105531550 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300031716|Ga0310813_11544533 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300031716|Ga0310813_11749153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 583 | Open in IMG/M |
| 3300031720|Ga0307469_11215944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 713 | Open in IMG/M |
| 3300031753|Ga0307477_10505742 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300031754|Ga0307475_11407326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 537 | Open in IMG/M |
| 3300031765|Ga0318554_10139701 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300031771|Ga0318546_11189698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 536 | Open in IMG/M |
| 3300031820|Ga0307473_10658819 | Not Available | 730 | Open in IMG/M |
| 3300031879|Ga0306919_10084412 | All Organisms → cellular organisms → Bacteria | 2197 | Open in IMG/M |
| 3300031910|Ga0306923_10395030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1574 | Open in IMG/M |
| 3300031942|Ga0310916_10290840 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300031996|Ga0308176_10294033 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300032060|Ga0318505_10016586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2790 | Open in IMG/M |
| 3300032076|Ga0306924_12463415 | Not Available | 523 | Open in IMG/M |
| 3300032160|Ga0311301_12147632 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300032180|Ga0307471_102355823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300032180|Ga0307471_102735066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 626 | Open in IMG/M |
| 3300032261|Ga0306920_103048947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300032261|Ga0306920_103148552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 619 | Open in IMG/M |
| 3300032261|Ga0306920_103703482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300032893|Ga0335069_11748297 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300033480|Ga0316620_10577854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1052 | Open in IMG/M |
| 3300034090|Ga0326723_0319092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300034150|Ga0364933_138092 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300034668|Ga0314793_027623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.28% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.99% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.32% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.32% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.66% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.66% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.66% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.66% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.66% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.66% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.66% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.66% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.66% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.66% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.66% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.66% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1013453291 | 3300000364 | Soil | PWVMPPRVIKPSTEPLEESPKCVETDGPKLLNNDHHGQR* |
| Ga0066395_100238421 | 3300004633 | Tropical Forest Soil | VEDPKVLTAPWTMAARLVKQSNEPLEESPRCIETDGPKLLNNDHHGQR* |
| Ga0066674_100783102 | 3300005166 | Soil | YQVTVDDPKLLTGPWTMPVRVVKPSNEPLEESPRCVETDGSRLLNNAIMGSDS* |
| Ga0066680_101193832 | 3300005174 | Soil | RLWRVGENLAYQATVDDPKVLTAPWTMPVRVVKPSTEPLEESPRCLETDGPRLLNNDHHGQR* |
| Ga0070658_114114361 | 3300005327 | Corn Rhizosphere | APWTMPPRTVKPSIEPLEESPRCVEADANRLVNNDHHGQR* |
| Ga0070709_106109761 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | WQAIVEDPKVLAAPWTITPRVVKPSDEPLEESARCVEDDGHRLQNNDHHGQR* |
| Ga0070709_107896401 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | NVLTAPWTMPPHVVKPSTERLEESPACVEDDGNKLLNLDHHGQR* |
| Ga0070713_1016662462 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VEDPKVLTAPWTGAPRVVKPSDDPLEESPKCVEDDARRLLNNDHHGQR* |
| Ga0070711_1003827611 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VEDPKVLASPWTMAPRVIKPSTEPLEESPKCTESDARLLVNNDHHGQR* |
| Ga0066682_102144642 | 3300005450 | Soil | TVDDPKVLTAPWTMPVRIVKPSTEPLEESPRCLETDGPRLLNNDHHGQR* |
| Ga0070734_100898083 | 3300005533 | Surface Soil | DGPNLVWQASVEDPNVLAATWTMPPRVVTPSSDPLEESPPCKDDDGSRLLNSDHHQQR* |
| Ga0070684_1018570951 | 3300005535 | Corn Rhizosphere | AQPWTITPRVVKPTDEPLEESPRCIEDDAHRLQNDDHHGQR* |
| Ga0070731_108681141 | 3300005538 | Surface Soil | NLVWQATVEDPGVLTAPWTMRPKVVKPSTDALEESPRCTEADGQLLLNNDHHQQR* |
| Ga0070664_1009065141 | 3300005564 | Corn Rhizosphere | QATVEDPKVLAQPWTITPRVVKPTDEPLEESPRCIEDDAHRLQNDDHHGQR* |
| Ga0068863_1019883562 | 3300005841 | Switchgrass Rhizosphere | ATVEDPKVLAQPWTITPRVVKPTDEPLEESPRCVENDGHRLQNDDHHGQR* |
| Ga0068858_1000465894 | 3300005842 | Switchgrass Rhizosphere | TVDDPKVLTAPWTMPARLIKPSTEPLEESPHCVEQDGKFLVNDDHHGQR* |
| Ga0066651_101490332 | 3300006031 | Soil | PWTMPVRVVKPTTEALEESPKCIETDGSKLLNNDHHGQR* |
| Ga0075030_1003294141 | 3300006162 | Watersheds | VTERLWRVGENLAYQATVDDPKVLTGPWTAPAQLVKPSTEPLEESPKCIEADAALLQNSDHHGQR* |
| Ga0070715_102447541 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PWTLNPRVVKPSNEPLEESARCVEDDGHRLLNDDHHGQR* |
| Ga0075018_101485661 | 3300006172 | Watersheds | VERFWKVGNNMAYQVTVEDPKMLATPWTTPVRVVKPSTEPLEESPTCREADGSLLLNNDHHVQR* |
| Ga0070712_1018212361 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AIVEDPKVLGAPWTMAPKLVKPSTDPLEESPRCIETDSKLLVNDDHHQQR* |
| Ga0075021_105917421 | 3300006354 | Watersheds | KVLTGPWTAPAQLVKPSTEPLEESPKCIEADAALLQNSDHHGQR* |
| Ga0066665_108070382 | 3300006796 | Soil | AYQATVDDPKVLTVPWTMAARVLRPSNEHLEESPRCVETDGPKLLNSDHHGQR* |
| Ga0075430_1000761751 | 3300006846 | Populus Rhizosphere | PRLIRPSTERLEESPKCVETDGSKLLNNDHHLQR* |
| Ga0068865_1017723452 | 3300006881 | Miscanthus Rhizosphere | ERFWRSGENLAYQATVDDPKVLTAPWTMPARLIKPSTEPLEESPHCVEQDGKFLQNDDHHGQR* |
| Ga0079219_114693552 | 3300006954 | Agricultural Soil | NLVYQVTVEDPKVLTAPWTMAPRVVKPSNELLEESPKCTESDSKLLVNDDHHGQR* |
| Ga0066710_1042518482 | 3300009012 | Grasslands Soil | RFWRTGENLAYQATVDDPKVLTAPWTMAVRVVKPTNEPLEESPRCIETDGPKLLNNDHHGQR |
| Ga0066710_1043634271 | 3300009012 | Grasslands Soil | ERVWRVGENLAYQATVDDPKVHSVPWTKAGRVLRPSNEHLAESPRCVETDGPKLLNSEHLGQR |
| Ga0099827_111519171 | 3300009090 | Vadose Zone Soil | PRVGKPSTDSLEESPRCVEADSKLLVNDDHHGQR* |
| Ga0105245_120346202 | 3300009098 | Miscanthus Rhizosphere | DDPKVLASPWTMAPRVVKPSTEPLEESPKCTESDAKLLVNDDHHGQR* |
| Ga0111538_133011292 | 3300009156 | Populus Rhizosphere | NLVYQATVNDPKVLTAPWTMAPRVVKPSTEPIEESPRCIETDGPQLLNNDHHQQR* |
| Ga0105241_100105041 | 3300009174 | Corn Rhizosphere | EDPKVLARPWTITPRVVKPTTEPLEESARCVEDDGHRLLNDDHHGQR* |
| Ga0105241_107524521 | 3300009174 | Corn Rhizosphere | ATVEDPKVLAQPWTITPRVVKPTDEPLEESPRCIEDDAHRLQNDDHHGQR* |
| Ga0105242_103360571 | 3300009176 | Miscanthus Rhizosphere | QPWTVTPRVVKPTTEPLEESPRCIEDDAHRLSNDDHHGQR* |
| Ga0105242_122219562 | 3300009176 | Miscanthus Rhizosphere | WTMPAREVKPSTEPLEESPHCTEQDGKFLQNDDHHGQR* |
| Ga0105248_101637541 | 3300009177 | Switchgrass Rhizosphere | RSGENLAYQATVDDPKVLTAPWTMPARLIKPSTEPLEESPHCVEQDGKFLVNDDHHGQR* |
| Ga0105248_115401572 | 3300009177 | Switchgrass Rhizosphere | IYQATAEDPNVLTQPWVMAPHVVNPTDEPLEESPACKEQDAHLLINNDHHGQR* |
| Ga0116220_105037991 | 3300009525 | Peatlands Soil | RVWRDGENLAYQAIVEDPGVLTAPWTMAPRLVKPTTLPLEESPACKDEDGAKLLNNDHHGQR* |
| Ga0105249_106536141 | 3300009553 | Switchgrass Rhizosphere | DPKVLAQPWTITPRVVKPTDEPLEESPRCIEDDAHRLQNDDHHGQR* |
| Ga0105249_113133952 | 3300009553 | Switchgrass Rhizosphere | EDPKVLAQPWTITPRVVKPTDEPLEESPRCIEDDAHRLQNDDHHGQR* |
| Ga0126380_100912341 | 3300010043 | Tropical Forest Soil | PKVLTSPWTMAPRVVKPSTEPLEESPKCTEADAKLLVNDDHHGQR* |
| Ga0126384_124213392 | 3300010046 | Tropical Forest Soil | EDPKVLAAPWTMAPRVVKPSTEPLEESPKCTESDSKLLVNDDHHGQR* |
| Ga0126382_105000871 | 3300010047 | Tropical Forest Soil | PWVMPPRVIKPSTEALEESPKCVETDGSKLLNNDHHGQR* |
| Ga0126382_105275702 | 3300010047 | Tropical Forest Soil | TSPWTMAPRVVKPSTEPLEESPKCTEADAHLLVNDDHHGQR* |
| Ga0126373_103213444 | 3300010048 | Tropical Forest Soil | VEDPKVLASPWTAPPRLVKPSTEPLEESPKCVEADGKLLLNNDHHGQR* |
| Ga0134064_101238941 | 3300010325 | Grasslands Soil | ERLWRVGENLAYQVTVADPKVLTAPWTMPVRVVKPSTEPLEESPRCLETDGPRLLNNDHHGQR* |
| Ga0074046_101648711 | 3300010339 | Bog Forest Soil | QGDNLVYQAIVEDPNVLTAPWTMAPRLVKPSTEPLDESPRCVETDGSLLLNSDHHGQR* |
| Ga0126370_120368591 | 3300010358 | Tropical Forest Soil | DPKVLTAPWTEAPRVIKPSNDPLEESPRCVESDGGKLTNNDHHQQR* |
| Ga0126372_125325882 | 3300010360 | Tropical Forest Soil | PWTMAPRVVKPSTEPLEESPKCTEADAKLLVNDDHHGQR* |
| Ga0126378_127008471 | 3300010361 | Tropical Forest Soil | DPKVLTAPWTEAPRVIKPSSDPLEESPRCVETDGSKLTNNDHHQQR* |
| Ga0126381_1004416141 | 3300010376 | Tropical Forest Soil | TERLWRNGENLAYQFTVDDSKVLTAPWTAPPRVIKASNDPLEESPRCVETDGSRLTNNDHHGQR* |
| Ga0126381_1010325741 | 3300010376 | Tropical Forest Soil | ENLVWQATVSDPNVLTRPWIMPARVVKPSTEPLEGSPTCIESDGKLLENNDHHAQR* |
| Ga0126381_1012336961 | 3300010376 | Tropical Forest Soil | EGENLVWQATVSDPNVLTRPWIMPARVVKPSTEPLEGSPTCTESDGKLLQNNDHHAQR* |
| Ga0136449_1008420411 | 3300010379 | Peatlands Soil | TERFWRDGANLAYQVTVEDPNVLTAPWTMAPRLVKPSTEPLEESPRCLESDASKLKNSDHHGNAKAARKPY* |
| Ga0136449_1027793082 | 3300010379 | Peatlands Soil | LTAPWTMAPRLVKPSTEPLDESPRCVETDGSLLLNSDHHGQR* |
| Ga0134121_101005561 | 3300010401 | Terrestrial Soil | SGANLVYQATVSDPKVLAAPWTMAPRVVKPSTEALEESPKCTEADSKLLVNDDHHGQR* |
| Ga0150983_108856362 | 3300011120 | Forest Soil | VTERLWRDGENLVWQATVADPKVLTAPWTMTPRVVKLSNETLEESPKCVEDDGKRLLNNDHHGQR* |
| Ga0137392_107186921 | 3300011269 | Vadose Zone Soil | DPKVLAAPWTMAPRVITPSNDPLEESPRCVEDDGNRLLNSDHHQQR* |
| Ga0137377_103978521 | 3300012211 | Vadose Zone Soil | FWRAGENLVYQVTVEDPKVLTAPWTMAPRVVKPSNEPLEESPACVESDGSRLLNNDHHGQR* |
| Ga0150985_1152541172 | 3300012212 | Avena Fatua Rhizosphere | WKDGENLIYQVTVDDPKVLTAPWTMAPRIVKPSAEPLEESPRCVEADANRLVNNDHHGQR |
| Ga0134054_10986471 | 3300012390 | Grasslands Soil | MPPRWIKPSMEQLEESPKCVETDSSKLLNDDHHGQR* |
| Ga0137395_104013201 | 3300012917 | Vadose Zone Soil | ATVDDPKVLTAPWTMSPRVVKPSNDPLEESPPCIEDDGHRLLNSDHHQQR* |
| Ga0137407_110489871 | 3300012930 | Vadose Zone Soil | VWQATVDDPKVLAALWTMSPRVVKPSSDPLEESPPCIEDDGNRLLNSDHHQQR* |
| Ga0153915_111932891 | 3300012931 | Freshwater Wetlands | MQPHNVKPSTEPLEESPACVEADAKRLLNDDHHQQR* |
| Ga0164301_107484771 | 3300012960 | Soil | MRPKVVKPSNDPLEESPRCVEDDGKLLLNNDHHQQR* |
| Ga0157378_103655154 | 3300013297 | Miscanthus Rhizosphere | VDDPKVLTAPWTMPARLIKPSTEPLEESPHCVEQDGKFLVNDDHHGQR* |
| Ga0163163_102357871 | 3300014325 | Switchgrass Rhizosphere | KVLAQPWTITPRVVKPTDEPLEESPRCIEDDAHRLQNDDHHGQR* |
| Ga0182012_103529701 | 3300014499 | Bog | TRIVKATTLPLEESPACKDEDGAKLLNNDHHGQR* |
| Ga0181536_103946022 | 3300014638 | Bog | GENLIYQVTVDDPKVLTAPWTMAPRVVKPSTEPLEESPRCVEADANRLVNNDHHGQR* |
| Ga0157376_112455831 | 3300014969 | Miscanthus Rhizosphere | TMAPRVVKPSTEALEESPKCTESDAKLLVNDDHHGQR* |
| Ga0157376_119741561 | 3300014969 | Miscanthus Rhizosphere | YQATAEDPNVLTQPWVMAPHVVSPTDEALEESPACKEQDAHLLINNDHHGQR* |
| Ga0137418_105157402 | 3300015241 | Vadose Zone Soil | WTMAPRVVKPSTDPLEESPRCVEEDGKLLQNDDHHGQR* |
| Ga0182033_115455692 | 3300016319 | Soil | TVEDPKVLTTPWTMAPRVVKPSNEPLEESPRCVEADSKLLVNNDHHGQR |
| Ga0182034_117452831 | 3300016371 | Soil | VTVEDPKVLASPWTMAPRLVKPSTEPLEESPKCTEADSKLLVNNDHHGQR |
| Ga0182037_104784941 | 3300016404 | Soil | DPKVLNAPWTMPVRVVKPSNEPLEESPRCVETDGPKLLNNDHHGQR |
| Ga0163161_115948831 | 3300017792 | Switchgrass Rhizosphere | AEDPNVLTQPWVMAPHVVNPTDEPLEESPACKEQDAHLLINNDHHGQR |
| Ga0187779_103227031 | 3300017959 | Tropical Peatland | NLVWQAIVDDPKVLTQPWTITPRVVKPSNEPLEESARCAEDDGHRLQNNDHHGQR |
| Ga0187883_105083272 | 3300018037 | Peatland | VDDPRVLTEPWTEAPRVVKPSDDPLEESPVCVEDDAKRMLNNDHHGQR |
| Ga0066655_109005742 | 3300018431 | Grasslands Soil | NLVHQVTVDDPKVLMAPWTMAPRVVKPSSEPLEESPRCVEADSKLLVNDDHHGQR |
| Ga0193752_11370932 | 3300020027 | Soil | FHSEALKVTERIWRDGKNLIYQATAEDPNVLTQPWVMAPRVVHPTDEPLEESPACKEQDAHLLINNDHHGQR |
| Ga0210403_113960512 | 3300020580 | Soil | IWQASVDDPKVLAASWTMPPRVITPSEDPLEESPPCVEDDGHRLLNSDHHQQR |
| Ga0179596_103016272 | 3300021086 | Vadose Zone Soil | VADPKVLTAPWTMAPRVVKPSTEPLEESPRCVEEDGKLLQNDDHHGQR |
| Ga0210400_103912292 | 3300021170 | Soil | WRDGENLVWQAIVDDPKVLTAAWTMPPRVIRPSDDPLEESPPCVEDDGHRLLNSDHHQQR |
| Ga0210384_100247357 | 3300021432 | Soil | TVEDPNVLTAPWTMRPKVVKPSTEALSESPRCVEDDGKRLLNNDHHGQR |
| Ga0210384_110730941 | 3300021432 | Soil | DPNVLTAPWTMPPHVVKPSTEPLEESPACVEDDGNKLLNLDHHGQR |
| Ga0210384_114417901 | 3300021432 | Soil | MHVTERLWRDGETLVWQATVADPKVLTAPWTMTPRVVKPTNETLEESPKCVEDDGKRLLNNDHHGQR |
| Ga0210384_116832001 | 3300021432 | Soil | LVWQASVEDPNVLAQPWTMPPRVVSPSEDPLEESPPCREDDGHRLLNSDHHQQR |
| Ga0210402_115675941 | 3300021478 | Soil | LTAPWTMTPRVVKPTNETLEESPKCVEDDGKRLLNNDHHGQR |
| Ga0210409_103212231 | 3300021559 | Soil | MRPKVVKPSTEALSESPRCVEDDGKRLLNNDHHGQR |
| Ga0126371_109346392 | 3300021560 | Tropical Forest Soil | LTAPWTMAPRVVKPSSEALEESPRCVEADSKLLVNNDHHGQR |
| Ga0213852_10604421 | 3300021858 | Watersheds | ENLAYQATVDDPKVLTGPWTAPAQLVKPSTEPLEESPKCIEADAALLQNSDHHGQR |
| Ga0209109_102729022 | 3300025160 | Soil | LTAPWVVPPRLLSPSTEPLEESPRCVETDGPKLLNNDHHLQR |
| Ga0207685_102357353 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VWQATVEDPKVLAAPWTLNPRVVKPSNEPLEESARCVEDDGHRLLNDDHHGQR |
| Ga0207654_111667432 | 3300025911 | Corn Rhizosphere | AIVDEPKVLTAPWVMPTRVVKPSLEPLEESPRCVEDDGPRLLNKDHHGQR |
| Ga0207707_110615612 | 3300025912 | Corn Rhizosphere | NLAYQAIVEDPKVLTAPWIMPARLVKPSTDPLEESPKCVEDDGQRLLNNDHHQQR |
| Ga0207671_111718632 | 3300025914 | Corn Rhizosphere | WTVTPRVVKPTTEPLEESPRCIEDDAHRLSNDDHHGQR |
| Ga0207663_107792821 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | WRNGENLVYQFTVDDPGVLTAPWTAPPRVVKPSTEPLEESPRCVEDDGKRLTNTDHHGQR |
| Ga0207663_116079691 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VTERLWRDGESLVWQATVADPKVLTAPWTMTPRVVKPTNETLEESPKCVEDDGKRLLNNDHHGQR |
| Ga0207687_105918572 | 3300025927 | Miscanthus Rhizosphere | QATVEDPKVLAQPWTITPRVVKPTDEPLEESPRCIEDDAHRLQNDDHHGQR |
| Ga0207687_114143762 | 3300025927 | Miscanthus Rhizosphere | PWTITPRVVKPTDEPLEESPRCIEDDAHRLQNDDHHGQR |
| Ga0207700_110759651 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | KVLAAPWTITPRVVKPSDEPLEESARCVEDDGHRLQNNDHHGQR |
| Ga0207686_111091691 | 3300025934 | Miscanthus Rhizosphere | TAPWTMPAREVKPSTEPLEESPHCTEQDGKFLQNDDHHGQR |
| Ga0207704_100675001 | 3300025938 | Miscanthus Rhizosphere | APWTMPARLIKPSTEPLEESPHCVEQDGKFLQNDDHHGQR |
| Ga0207665_101567601 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | APRVVKPSTEPLEESPKCTEADSKLLVNNDHHGQR |
| Ga0207711_103100821 | 3300025941 | Switchgrass Rhizosphere | TVDDPKVLTAPWTMPARLIKPSTEPLEESPHCVEQDGKFLVNDDHHGQR |
| Ga0207711_114271751 | 3300025941 | Switchgrass Rhizosphere | IYQATAEDPNVLTQPWVMAPHVVNPTDEPLEESPACKEQDAHLLINNDHHGQR |
| Ga0207667_104237393 | 3300025949 | Corn Rhizosphere | WLDNGNLVWQAIVEDPKVLAAPWTITPRVVKPSDEPLEESARCVEDDGHRLQNNDHHGQR |
| Ga0207712_120062782 | 3300025961 | Switchgrass Rhizosphere | LAQPWTITPRVVKPTDEPLEESPRCIEDDAHRLQNDDHHGQR |
| Ga0207676_115202801 | 3300026095 | Switchgrass Rhizosphere | LAYQVTVDDPKVLTAPWTMPARLIKPSTEALEESPHCVEQDGKFLQNDDHHGQR |
| Ga0207698_102569111 | 3300026142 | Corn Rhizosphere | HVTERLWKDGSNLAYQAIVDEPKVLTAPWVMPTRVVKPSLEPLEESPRCVEDDGPRLLNKDHHGQR |
| Ga0207698_112701991 | 3300026142 | Corn Rhizosphere | WTITPRVVKPTDEPLEESPRCIEDDAHRLQNDDHHGQR |
| Ga0209579_106856182 | 3300027869 | Surface Soil | TDAMHVTERFWRDGANLVYQVTVADPKVLTAPWTEPPRVVKPSTEPLEESPKCVESDASKLINNDHHGQR |
| Ga0209169_101772672 | 3300027879 | Soil | HVTERLWRDGENLIYQVTVEDPKVLTTPWTMPARVVKPSTEPLLESPRCVEADANRLVNNDHHSQR |
| Ga0209624_107806452 | 3300027895 | Forest Soil | ASVDDPKVLAAPWIMPPRVIMPSTDPLEESPPCVEDDGHRLLNSDHHQQR |
| Ga0268265_123695101 | 3300028380 | Switchgrass Rhizosphere | VLAAPWTMPPRVTKPSPEPLDESPKCVETDGQKLLNNDHHLQR |
| Ga0222749_103968612 | 3300029636 | Soil | VYQYTVDDPKVLTAPWTAPPRVVKPSDEPLEESPKCVETDAAKLVNNDHHGQR |
| Ga0311343_110462261 | 3300029953 | Bog | DEPGVLAAPWTMPTRIVKATTLPLEESPACKDEDGAKLLNNDHHGQR |
| Ga0311334_118130451 | 3300029987 | Fen | LGYQVTVDDPGVLAAPWTTPARIVKATTLPLEESPMCKDEDGAKLLNNDHHGQR |
| Ga0311339_106142941 | 3300029999 | Palsa | GNLIYQVTVDDPKVLTAPWTMAPRVVKPSAEPLEESPRCVEADANRLVNNDHHGQR |
| Ga0310039_103820742 | 3300030706 | Peatlands Soil | TVDDPKVLTAPWTMAARVVKPSTEPLEESPRCVEADANRLVNNDHHGQR |
| Ga0265753_11259882 | 3300030862 | Soil | VDDPKVLTAPWTMAPRVVKPSTEPLEESPRCVEADANRLVNNDHHGQR |
| Ga0170824_1121773202 | 3300031231 | Forest Soil | ERLWLNDGNLVWQATVEDPKVLTAPWTITPRVVKASNEPLEESARCVEDDGHRLQNNDHHGQR |
| Ga0265340_100649821 | 3300031247 | Rhizosphere | NNLVWQAIVDDPKVLAQPWTVTPRVVKPTTEPLEESPRCIEDDAHRLLNDDHHGQR |
| Ga0318573_101056101 | 3300031564 | Soil | YQFTVDDPKVLTAAWTAPPRVIKPSNDPLEESPRCVETDGSRLTNNDHHGQR |
| Ga0318561_100465541 | 3300031679 | Soil | TAPPRVIKPSNDPLEESPRCVETDGSRLTNNDHHGQR |
| Ga0310686_1055315502 | 3300031708 | Soil | APWTMPVRVVKPSSEVLEESPRCVEDDARRLLNNDHHAQR |
| Ga0310813_115445332 | 3300031716 | Soil | APRVIKPSTEPLEESPKCTESDARLLVNNDHHGQR |
| Ga0310813_117491531 | 3300031716 | Soil | TAPWTMRPKVVKPSNDPLEESPRCVEDDGKLLLNNDHHQQR |
| Ga0307469_112159442 | 3300031720 | Hardwood Forest Soil | VDDPKVLTAPWTMAPRIVKPSTEPLEESPRCVEADSKLLVNNDHHGQR |
| Ga0307477_105057421 | 3300031753 | Hardwood Forest Soil | PPRIVKPSTELLEESPKCVEADSKLLVNDDHHGQR |
| Ga0307475_114073262 | 3300031754 | Hardwood Forest Soil | VWQATVEDPNVLTAPWTMRPKVVKPSTEALSESPRCVEDDGKRLLNNDHHGQR |
| Ga0318554_101397011 | 3300031765 | Soil | AWTAPPRVIKPSNDPLEESPRCVETDGSRLTNNDHHGQR |
| Ga0318546_111896981 | 3300031771 | Soil | YQVIVEDPKVLTAPWTMAPRLVKPSTEALEESPRCVEADSKLLVNDDHHGQR |
| Ga0307473_106588191 | 3300031820 | Hardwood Forest Soil | AAPWTMSPRIITPSNDPLEESPRCVEDDGNRLLNSDHHQQR |
| Ga0306919_100844121 | 3300031879 | Soil | FTVDDPKVLTAAWTAPPRVIKPSNDPLEESPRCVETDGSRLTNNDHHGQR |
| Ga0306923_103950303 | 3300031910 | Soil | NLVYQVTVDDPKVLTSPWTMAPRVVKPSTEPLEESPKCTEADAKLLVNDDHHGQR |
| Ga0310916_102908401 | 3300031942 | Soil | VDDPKVLTAAWTAPPRVIKPSNDPLEESPRCVETDGSRLTNNDHHGQR |
| Ga0308176_102940331 | 3300031996 | Soil | NLVWQAIVDDPKVLAQPWTVTPRVVKPTVEPLEESPRCIEDDAHRLLNDDHHGQR |
| Ga0318505_100165861 | 3300032060 | Soil | LTAPWSAPPRVIKPSLDPLEESPRCVETDGSRLTNNDHHGQR |
| Ga0306924_124634152 | 3300032076 | Soil | MAPRVVKPSIEPLEESPKCVEADSKLLVNNDHHGQR |
| Ga0311301_121476321 | 3300032160 | Peatlands Soil | TERLWRYGDNLVYQAIVEDPNVLTAPWTMAPRLVKPSTEPLDESPRCVETDGSLLLNSDHHGQR |
| Ga0307471_1023558231 | 3300032180 | Hardwood Forest Soil | NVLTTAWTMPPRVVKPSTEPLEESPKCVEDDGKRLLNNDHHDQR |
| Ga0307471_1027350661 | 3300032180 | Hardwood Forest Soil | VLTAPWTMAPRVVKPSTEPLEESPKCTEADSKLLVNDDHHGQR |
| Ga0306920_1030489471 | 3300032261 | Soil | VLTTPWIMPPRVVKPSTELLEESPKCVEDDGKRLLNNDHHDQR |
| Ga0306920_1031485521 | 3300032261 | Soil | YQATVEDPKVLTGPWTARAILVQPSTDPLQESPQCTEKDAPLLENSDHHGQR |
| Ga0306920_1037034821 | 3300032261 | Soil | KGYFHTNALHVTERLWRDGENLVWQAIVEDPKVLTAPWIMPPRVVKPSSEPLEESPKCVEDDGKRLLNNDHHDQR |
| Ga0335069_117482972 | 3300032893 | Soil | MPARVVKPSTEPLEESPRCVEQDGKLLQNDDHHGQR |
| Ga0316620_105778541 | 3300033480 | Soil | MAARVVKPSNDPLEESPRCVEDDGHRLLNNDHHRQR |
| Ga0326723_0319092_36_239 | 3300034090 | Peat Soil | MHVTERFWRDGANLVYQVTVADPKVLTAPWTMAPRVVKPSTEALEESPRCVEADSKLLVNDDHHGQR |
| Ga0364933_138092_498_608 | 3300034150 | Sediment | MPARLIKPSTEPLEESPHCVEQDGKLLQNDDHHGQR |
| Ga0314793_027623_26_229 | 3300034668 | Soil | MRITERLWRDGENLVWQVTVDDPNVLTAPWTMAPRMIKRSTQGLEESPACREQDGALLRNDDHHDQR |
| ⦗Top⦘ |