| Basic Information | |
|---|---|
| Family ID | F046622 |
| Family Type | Metagenome |
| Number of Sequences | 151 |
| Average Sequence Length | 44 residues |
| Representative Sequence | PEASKRFVAGARAASLLRMKERMEKAGGMENYDRVVQLFTPG |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.67 % |
| % of genes near scaffold ends (potentially truncated) | 96.69 % |
| % of genes from short scaffolds (< 2000 bps) | 90.07 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.675 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.258 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.139 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.086 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.43% β-sheet: 0.00% Coil/Unstructured: 48.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF04290 | DctQ | 78.15 |
| PF06808 | DctM | 16.56 |
| PF02771 | Acyl-CoA_dh_N | 0.66 |
| PF00106 | adh_short | 0.66 |
| PF00072 | Response_reg | 0.66 |
| PF01970 | TctA | 0.66 |
| PF02738 | MoCoBD_1 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG1784 | TctA family transporter | General function prediction only [R] | 0.66 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.66 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.68 % |
| Unclassified | root | N/A | 1.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001850|RCM37_1040847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 537 | Open in IMG/M |
| 3300002073|JGI24745J21846_1048874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 534 | Open in IMG/M |
| 3300002568|C688J35102_119891357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 805 | Open in IMG/M |
| 3300002568|C688J35102_120395195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1037 | Open in IMG/M |
| 3300002917|JGI25616J43925_10338057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 558 | Open in IMG/M |
| 3300004153|Ga0063455_101709636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
| 3300004157|Ga0062590_102295568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 567 | Open in IMG/M |
| 3300004463|Ga0063356_101963740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
| 3300004463|Ga0063356_105582649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 540 | Open in IMG/M |
| 3300005169|Ga0066810_10177475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 524 | Open in IMG/M |
| 3300005174|Ga0066680_10131469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Salipiger → Salipiger bermudensis | 1556 | Open in IMG/M |
| 3300005180|Ga0066685_10630074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 738 | Open in IMG/M |
| 3300005294|Ga0065705_10088037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 529 | Open in IMG/M |
| 3300005333|Ga0070677_10157701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1062 | Open in IMG/M |
| 3300005334|Ga0068869_101607097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 579 | Open in IMG/M |
| 3300005356|Ga0070674_100755788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 836 | Open in IMG/M |
| 3300005444|Ga0070694_100129142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1824 | Open in IMG/M |
| 3300005454|Ga0066687_10269415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Salipiger → Salipiger bermudensis | 956 | Open in IMG/M |
| 3300005457|Ga0070662_100898468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 756 | Open in IMG/M |
| 3300005537|Ga0070730_10188180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1382 | Open in IMG/M |
| 3300005544|Ga0070686_100598216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 869 | Open in IMG/M |
| 3300005546|Ga0070696_100420128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1049 | Open in IMG/M |
| 3300005546|Ga0070696_101238177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 632 | Open in IMG/M |
| 3300005552|Ga0066701_10816720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 555 | Open in IMG/M |
| 3300005617|Ga0068859_102289640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 596 | Open in IMG/M |
| 3300005829|Ga0074479_10818864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Salipiger → Salipiger bermudensis | 1132 | Open in IMG/M |
| 3300005840|Ga0068870_11247722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 540 | Open in IMG/M |
| 3300006032|Ga0066696_10394676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
| 3300006032|Ga0066696_10960404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 544 | Open in IMG/M |
| 3300006169|Ga0082029_1244393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2376 | Open in IMG/M |
| 3300006173|Ga0070716_100433483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
| 3300006755|Ga0079222_11242979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 672 | Open in IMG/M |
| 3300006794|Ga0066658_10136028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1223 | Open in IMG/M |
| 3300006794|Ga0066658_10577256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 612 | Open in IMG/M |
| 3300006797|Ga0066659_10875216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 749 | Open in IMG/M |
| 3300006800|Ga0066660_10103841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2018 | Open in IMG/M |
| 3300006806|Ga0079220_10404330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Hoeflea → Hoeflea phototrophica | 893 | Open in IMG/M |
| 3300006845|Ga0075421_100557755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1353 | Open in IMG/M |
| 3300006871|Ga0075434_100042545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4503 | Open in IMG/M |
| 3300006871|Ga0075434_101406123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 708 | Open in IMG/M |
| 3300006876|Ga0079217_11565080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 524 | Open in IMG/M |
| 3300006894|Ga0079215_11047654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 605 | Open in IMG/M |
| 3300006904|Ga0075424_100985693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 899 | Open in IMG/M |
| 3300006954|Ga0079219_11056356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 682 | Open in IMG/M |
| 3300006954|Ga0079219_11751654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 578 | Open in IMG/M |
| 3300007004|Ga0079218_13272317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 548 | Open in IMG/M |
| 3300007265|Ga0099794_10144298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1207 | Open in IMG/M |
| 3300007790|Ga0105679_10764680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1007 | Open in IMG/M |
| 3300009087|Ga0105107_10696069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 707 | Open in IMG/M |
| 3300009094|Ga0111539_11731982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 725 | Open in IMG/M |
| 3300009148|Ga0105243_12072210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 604 | Open in IMG/M |
| 3300009156|Ga0111538_14122978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 502 | Open in IMG/M |
| 3300009162|Ga0075423_11809740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 659 | Open in IMG/M |
| 3300009176|Ga0105242_10004003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11452 | Open in IMG/M |
| 3300010044|Ga0126310_11607890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 537 | Open in IMG/M |
| 3300010359|Ga0126376_12853329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 533 | Open in IMG/M |
| 3300010364|Ga0134066_10029387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1287 | Open in IMG/M |
| 3300010364|Ga0134066_10332533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
| 3300010391|Ga0136847_10393199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1155 | Open in IMG/M |
| 3300010403|Ga0134123_10132003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2039 | Open in IMG/M |
| 3300010403|Ga0134123_11905446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 650 | Open in IMG/M |
| 3300011413|Ga0137333_1114962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 623 | Open in IMG/M |
| 3300011432|Ga0137428_1205636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 583 | Open in IMG/M |
| 3300011440|Ga0137433_1165077 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300011444|Ga0137463_1188595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 774 | Open in IMG/M |
| 3300012096|Ga0137389_10333407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1289 | Open in IMG/M |
| 3300012164|Ga0137352_1033319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 992 | Open in IMG/M |
| 3300012189|Ga0137388_11627670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 581 | Open in IMG/M |
| 3300012203|Ga0137399_10185900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1680 | Open in IMG/M |
| 3300012210|Ga0137378_10327714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1424 | Open in IMG/M |
| 3300012232|Ga0137435_1143625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 727 | Open in IMG/M |
| 3300012349|Ga0137387_11026515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 591 | Open in IMG/M |
| 3300012362|Ga0137361_10878743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 814 | Open in IMG/M |
| 3300012469|Ga0150984_112068723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
| 3300012509|Ga0157334_1023346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 700 | Open in IMG/M |
| 3300012519|Ga0157352_1106829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 504 | Open in IMG/M |
| 3300012582|Ga0137358_10526146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 796 | Open in IMG/M |
| 3300012923|Ga0137359_10785026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 826 | Open in IMG/M |
| 3300012925|Ga0137419_11293423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 613 | Open in IMG/M |
| 3300012927|Ga0137416_10807836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300012927|Ga0137416_11607466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 592 | Open in IMG/M |
| 3300012930|Ga0137407_10280713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1518 | Open in IMG/M |
| 3300012944|Ga0137410_10011559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. YR568 | 5983 | Open in IMG/M |
| 3300012944|Ga0137410_10762471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
| 3300012961|Ga0164302_11965059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
| 3300012984|Ga0164309_10155633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1525 | Open in IMG/M |
| 3300013297|Ga0157378_11037469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 855 | Open in IMG/M |
| 3300014488|Ga0182001_10306205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 645 | Open in IMG/M |
| 3300014878|Ga0180065_1164552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 511 | Open in IMG/M |
| 3300015357|Ga0134072_10480845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 507 | Open in IMG/M |
| 3300015358|Ga0134089_10026806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2008 | Open in IMG/M |
| 3300015372|Ga0132256_100118812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2606 | Open in IMG/M |
| 3300018000|Ga0184604_10199233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 685 | Open in IMG/M |
| 3300018059|Ga0184615_10438494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 711 | Open in IMG/M |
| 3300018422|Ga0190265_10090344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2836 | Open in IMG/M |
| 3300018422|Ga0190265_11734628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 734 | Open in IMG/M |
| 3300018429|Ga0190272_12677465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 547 | Open in IMG/M |
| 3300018429|Ga0190272_12788546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 538 | Open in IMG/M |
| 3300018433|Ga0066667_10336241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1193 | Open in IMG/M |
| 3300018481|Ga0190271_12303041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 644 | Open in IMG/M |
| 3300020060|Ga0193717_1169635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 622 | Open in IMG/M |
| 3300020074|Ga0194113_11064960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 536 | Open in IMG/M |
| 3300020202|Ga0196964_10169049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 999 | Open in IMG/M |
| 3300020215|Ga0196963_10261119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 758 | Open in IMG/M |
| 3300020220|Ga0194119_10099335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2309 | Open in IMG/M |
| 3300024182|Ga0247669_1067703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 595 | Open in IMG/M |
| 3300024232|Ga0247664_1077377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 768 | Open in IMG/M |
| 3300025315|Ga0207697_10177128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 934 | Open in IMG/M |
| 3300025936|Ga0207670_11619308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 551 | Open in IMG/M |
| 3300026089|Ga0207648_11316086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 679 | Open in IMG/M |
| 3300026317|Ga0209154_1042073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2061 | Open in IMG/M |
| 3300026328|Ga0209802_1240622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 634 | Open in IMG/M |
| 3300026332|Ga0209803_1023999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2971 | Open in IMG/M |
| 3300026332|Ga0209803_1223416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 665 | Open in IMG/M |
| 3300026550|Ga0209474_10553449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 585 | Open in IMG/M |
| 3300027381|Ga0208983_1034804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 985 | Open in IMG/M |
| 3300027471|Ga0209995_1091253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 524 | Open in IMG/M |
| 3300027543|Ga0209999_1084477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 613 | Open in IMG/M |
| 3300027645|Ga0209117_1198954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 506 | Open in IMG/M |
| 3300027691|Ga0209485_1335942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 508 | Open in IMG/M |
| 3300027748|Ga0209689_1329193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 586 | Open in IMG/M |
| 3300027765|Ga0209073_10441958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 540 | Open in IMG/M |
| 3300027857|Ga0209166_10114093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1498 | Open in IMG/M |
| 3300027903|Ga0209488_11224520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300028536|Ga0137415_10467642 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1067 | Open in IMG/M |
| 3300028809|Ga0247824_10670334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 630 | Open in IMG/M |
| 3300028812|Ga0247825_10419593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
| 3300031538|Ga0310888_10344750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 862 | Open in IMG/M |
| 3300031538|Ga0310888_10416513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 791 | Open in IMG/M |
| 3300031740|Ga0307468_100352320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1098 | Open in IMG/M |
| 3300031740|Ga0307468_100911685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 763 | Open in IMG/M |
| 3300031943|Ga0310885_10496814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 664 | Open in IMG/M |
| 3300032005|Ga0307411_11070323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 725 | Open in IMG/M |
| 3300032013|Ga0310906_11383076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 516 | Open in IMG/M |
| 3300032017|Ga0310899_10734849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 503 | Open in IMG/M |
| 3300032126|Ga0307415_101656426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 616 | Open in IMG/M |
| 3300032144|Ga0315910_10591994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 859 | Open in IMG/M |
| 3300032157|Ga0315912_10964195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 677 | Open in IMG/M |
| 3300032163|Ga0315281_10261740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1903 | Open in IMG/M |
| 3300032174|Ga0307470_10050822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2122 | Open in IMG/M |
| 3300032180|Ga0307471_100524563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1335 | Open in IMG/M |
| 3300032205|Ga0307472_101837879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 603 | Open in IMG/M |
| 3300032211|Ga0310896_10887470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 515 | Open in IMG/M |
| 3300032892|Ga0335081_12626161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 516 | Open in IMG/M |
| 3300033412|Ga0310810_10251249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1945 | Open in IMG/M |
| 3300033433|Ga0326726_12281390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 526 | Open in IMG/M |
| 3300033550|Ga0247829_10625947 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 895 | Open in IMG/M |
| 3300034113|Ga0364937_005927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1706 | Open in IMG/M |
| 3300034354|Ga0364943_0208741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 720 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.96% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.99% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.32% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.32% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.32% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.66% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.66% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.66% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.66% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.66% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.66% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.66% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.66% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM37_10408472 | 3300001850 | Marine Plankton | VAQSAEASRRFIEGARGASLLRMKERMEKAGGMENYDRMVKLHSGS* |
| JGI24745J21846_10488741 | 3300002073 | Corn, Switchgrass And Miscanthus Rhizosphere | IAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD* |
| C688J35102_1198913573 | 3300002568 | Soil | EASKRFIAGARAASLARMKERMEKSGGMENYDKVINLFTPG* |
| C688J35102_1203951953 | 3300002568 | Soil | DASRRFIEGARAASLTRMKERMEKSGGLENFEKIVNLFTPGPLPK* |
| JGI25616J43925_103380571 | 3300002917 | Grasslands Soil | PEASKRFVAGARAASLARMKERMEKSGGMDNYDRVVQLFTPD* |
| Ga0063455_1017096361 | 3300004153 | Soil | LQKRGLKTISQSPEASKRFIAGARAASLARMKERMEKSGGMENYDKVINLFTPG* |
| Ga0062590_1022955681 | 3300004157 | Soil | QSPEASKRFYEGARSASLQRMKERMEKAGGMENFERIVQLFTPGPLPK* |
| Ga0063356_1019637401 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RGIKTVSQSPEASKRFYEGARAASLARMKERMEKSGGTENFERVVQLFTPGPLPK* |
| Ga0063356_1055826491 | 3300004463 | Arabidopsis Thaliana Rhizosphere | KRFYEGARAASLQRMKERMEKAGGMENYEKVIQLFTPGPLPK* |
| Ga0066810_101774752 | 3300005169 | Soil | SKKFVAGARAASLQRMKERMEKAGGMENYDRVVKLFTPE* |
| Ga0066680_101314693 | 3300005174 | Soil | SQSSEASKKFVTGARAASLARMKERMEKSGGTENYDRVVQLLTPE* |
| Ga0066685_106300741 | 3300005180 | Soil | KTVAQSPEASTRFVAGARAASLQRMKERMEKAGGMENYDKVVQLFTPG* |
| Ga0065705_100880372 | 3300005294 | Switchgrass Rhizosphere | TVAQSGDASKRFIAGARAASLQRMKERMEKAGGMENYDQVVKLFTPN* |
| Ga0070677_101577011 | 3300005333 | Miscanthus Rhizosphere | KRGIKTVEQSPDASKRFIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD* |
| Ga0068869_1016070971 | 3300005334 | Miscanthus Rhizosphere | RGIKFLSQSEAASKKFVAGARAASLQRMKERMEKSGGMENYDKVIQLFTPN* |
| Ga0070674_1007557883 | 3300005356 | Miscanthus Rhizosphere | SKRFIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD* |
| Ga0070694_1001291421 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AAQKFVAGARAASLARMKERMEKAGGTDNYDKVVQLFTPN* |
| Ga0066687_102694151 | 3300005454 | Soil | EASKKFVAGARAASLARMKERMEKAGGTENYDKVVQLLTPE* |
| Ga0070662_1008984681 | 3300005457 | Corn Rhizosphere | DASKRFIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD* |
| Ga0070730_101881803 | 3300005537 | Surface Soil | SASLTRMKERMEKSGGMENFEKIINLFTPGPLPK* |
| Ga0070686_1005982161 | 3300005544 | Switchgrass Rhizosphere | QSPEASKRFVEGARAASLQRMQESMEKAGGMENFQKVLQLFTPGPLPK* |
| Ga0070696_1004201283 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | EASKRFVEGARSASLARMKERMEKSGGMENFEKIVNLLTPGPLPK* |
| Ga0070696_1012381772 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | EAAQKFVAGARAASLARMKERMEKAGGTDNYDKVVQLFTPN* |
| Ga0066701_108167201 | 3300005552 | Soil | SEASKKFVAGARAASLARMKERMEKSGGTETYDRVVQLLTPE* |
| Ga0068859_1022896401 | 3300005617 | Switchgrass Rhizosphere | RFIAGARAASLARMKERMEKAGGTENYDKVVQLFTPN* |
| Ga0074479_108188641 | 3300005829 | Sediment (Intertidal) | KRGMKVLSLGPEASKRFIEGARAASLARMKERMEKSGGMENYDRVVKLLSPL* |
| Ga0068870_112477222 | 3300005840 | Miscanthus Rhizosphere | EASKRFVAGARAASLQRMKERMEKSGGMENYDRVVKLFTPE* |
| Ga0066696_103946761 | 3300006032 | Soil | FVAGARAASLARMKERMEKAGGTENYDRVVQLFTPE* |
| Ga0066696_109604041 | 3300006032 | Soil | SPEASKKFVAGARAASLARMKERMEKSGGTENYDRVVQLLTPE* |
| Ga0082029_12443934 | 3300006169 | Termite Nest | GARTASLQRMKERMDKLGGAENFERVVQLFTPGPLPK* |
| Ga0070716_1004334831 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SASLARMKERMEKSGGMENFEKIVNLFTPGPLPK* |
| Ga0079222_112429791 | 3300006755 | Agricultural Soil | QSPEASKRFVEGARSASLARMKERMEKSGGMENFEKIVNLFTPGPLPK* |
| Ga0066658_101360281 | 3300006794 | Soil | ASKKFVAGARAASVARMKERMEKTGGMENYDKVVQLLTPE* |
| Ga0066658_105772561 | 3300006794 | Soil | PEASRKFVAGARAASLARMKVRMEKSGGVENYDKVVQLLTPE* |
| Ga0066659_108752161 | 3300006797 | Soil | IKTLSQSPDASKKFVAGARAASLARMKERMEKSGGMENYDKVVQLLTPE* |
| Ga0066660_101038413 | 3300006800 | Soil | VAGARAASLARMRERMERSGGMDNYDRVVQLFTPD* |
| Ga0066660_114327831 | 3300006800 | Soil | LEKRGIKTVSQSAEASKKFVAGARAASLARMKERMEKSGGTENYDRVVKLLTPE* |
| Ga0079220_104043303 | 3300006806 | Agricultural Soil | ARSASLARMKERMEKSGGLENFERVVQLFTPGPLPK* |
| Ga0075421_1005577553 | 3300006845 | Populus Rhizosphere | AKRGIKTVAQSPDASKRFIAGARAASLQRMKERMEKAGGMENYDQVVKLFTPN* |
| Ga0075434_1000425451 | 3300006871 | Populus Rhizosphere | FVEGARAASLARMKERMEKSGGMENFEKVVNLFTPGPLPK* |
| Ga0075434_1014061233 | 3300006871 | Populus Rhizosphere | FVAGARAASLQRMKERMEKSGGMENYDKVIHLFTPN* |
| Ga0079217_115650801 | 3300006876 | Agricultural Soil | AQSPDAAKRFAEGARSASLARMKERMQKSGGMENFEKVIQLFTPGPLPK* |
| Ga0079215_110476542 | 3300006894 | Agricultural Soil | SASASKRFYEGARSASLARMKERMEKAGGMENYDKVIQLFTPGS* |
| Ga0075424_1009856931 | 3300006904 | Populus Rhizosphere | ASKKFVAGARAASLQRMKERMEKAGGMENYDRVVKLFTPG* |
| Ga0079219_110563562 | 3300006954 | Agricultural Soil | KTVAQSPEASKRFVEGARSASLARMKERMEKAGGMENFEKVVNLFTPGPLPK* |
| Ga0079219_117516542 | 3300006954 | Agricultural Soil | VEGARSASLQRMKERMEKAGGMENFEKIIHLFTPGPLPK* |
| Ga0079218_132723171 | 3300007004 | Agricultural Soil | KTLSQSPEASKKFVAGARTASLQRMRERMEKAGGMENYDKVVKLFTPE* |
| Ga0099794_101442981 | 3300007265 | Vadose Zone Soil | KRFVAGARAASLARMKERMEKSGGMDNYDRVVQLFTPD* |
| Ga0105679_107646803 | 3300007790 | Soil | SPDAAKRFYAGARSASLARMKERMEKAGGVKNYDKVVQLFTPF* |
| Ga0105107_106960692 | 3300009087 | Freshwater Sediment | KKRGIKTLSQSPEASKKFVAGARTASLQRMKERMEKAGGMENYDKVVKLFTPD* |
| Ga0111539_117319823 | 3300009094 | Populus Rhizosphere | KKFVAGARAASLQRMKERMEKSGGMENYDKVIQLFTPN* |
| Ga0105243_120722101 | 3300009148 | Miscanthus Rhizosphere | FIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD* |
| Ga0111538_141229782 | 3300009156 | Populus Rhizosphere | PEAAQKFVAGARAASLARMKERMEKAGGTENYDKVVQLFTPN* |
| Ga0075423_118097401 | 3300009162 | Populus Rhizosphere | VAQSPDASKRFYAGARSASLARMKERMEKSGGMENYDKIVQLFTPF* |
| Ga0105242_1000400313 | 3300009176 | Miscanthus Rhizosphere | IAGARAASLQRMKERMEKAGGMENYDQVVKLFTPN* |
| Ga0126310_116078902 | 3300010044 | Serpentine Soil | VAQSPEASRRFYQGARTASLARMKERMEKAGGMENYDKVVQLFTPD* |
| Ga0126376_128533291 | 3300010359 | Tropical Forest Soil | KKFVAGARAASLQRMKERMEKSGGMENYDKVVHLFSPE* |
| Ga0134066_100293873 | 3300010364 | Grasslands Soil | EASKRFVEGARSASLTRMKERMEKSGGMENFEKVIQLFTPGPLPK* |
| Ga0134066_103325331 | 3300010364 | Grasslands Soil | KFVDGARAASLARMKERMEKAGGMENYERVVQLLSPE* |
| Ga0136847_103931993 | 3300010391 | Freshwater Sediment | SKRFVAGARAASLARMKERMEKSGGMENYDRVVQLLTPG* |
| Ga0134123_101320033 | 3300010403 | Terrestrial Soil | SPEAAQKFVAGARAASLARMKERMEKAGGTENYDKVVQLFTPN* |
| Ga0134123_119054461 | 3300010403 | Terrestrial Soil | RYLPQSEAASKKFVAGARAASLQRMKERMEKAGGMENYDKVVKLFTPG* |
| Ga0137333_11149622 | 3300011413 | Soil | RTISQSPEASKRFYEGARAASLTRMKERMEKAGGMENYEKVIQLFTPGPLPK* |
| Ga0137428_12056362 | 3300011432 | Soil | RFYEGARAASLQRMKERMEKAGGLENYEKIIQLFTPGPLPK* |
| Ga0137433_11650772 | 3300011440 | Soil | IKTVSQSPEASKRFYEGARAASLQRMKERMEKAGGMENYDKVVKLFTPG* |
| Ga0137463_11885953 | 3300011444 | Soil | SKKFVAGARAASLQRMKERMEKSGGTENYDKVVKLFTPE* |
| Ga0137389_103334073 | 3300012096 | Vadose Zone Soil | KRFYEGARSASLTRMKERMEKSSGTENYDRVVKLLTPE* |
| Ga0137352_10333193 | 3300012164 | Soil | FYEGARAASLTRMKERMEKAGGMENYEKVIQLFTPGPLPK* |
| Ga0137388_116276701 | 3300012189 | Vadose Zone Soil | KTSSQSPEASKRFVAGARAASLARMKERMEKSGGMENYDRVVQLFTPD* |
| Ga0137399_101859003 | 3300012203 | Vadose Zone Soil | EGARSASLARMKERMEKAGGMENFEKIVQLFTPGPLPK* |
| Ga0137378_103277141 | 3300012210 | Vadose Zone Soil | LAQRGIKTLAQSPDASRRFVAGARAASLARMKERTEKAGGMENYERVVQLFTPG* |
| Ga0137435_11436252 | 3300012232 | Soil | VSQSAEASKKFVAGARAASLQRMKERMEKSGGTENYDKVVKLFTPE* |
| Ga0137387_110265152 | 3300012349 | Vadose Zone Soil | KFVAGARAASLARMKERMEKSGGTENYDRVVKLLTPE* |
| Ga0137361_108787431 | 3300012362 | Vadose Zone Soil | VSQSAEASKKFDAGARAASLQRMKERMGEAGGTENYDRVVQLFTPE* |
| Ga0150984_1120687231 | 3300012469 | Avena Fatua Rhizosphere | KKFVAGARAASLQRMKERMEKSGGTENYDRVVKLFTPE* |
| Ga0157334_10233461 | 3300012509 | Soil | AQSGDAAKRFIAGARAASLQRMKERMEKAGGMENYDQVVKLFTPN* |
| Ga0157352_11068292 | 3300012519 | Unplanted Soil | GDASRRFIAGARAASLQRMKERMDKAGGMENYDQVVKLFTPN* |
| Ga0137358_105261463 | 3300012582 | Vadose Zone Soil | SPEASKRFVEGARSASLARMKERMEKAGGMEHFEKIVQLFTPGPLPK* |
| Ga0137359_107850263 | 3300012923 | Vadose Zone Soil | SPEASKRFVAGARAASLARMKERMEKSGGMDNYDRVVQLFTPD* |
| Ga0137419_112934232 | 3300012925 | Vadose Zone Soil | SSEASKKFVAGARAASLARMKERMEKSGSTENYDRVVQLLTPE* |
| Ga0137416_108078361 | 3300012927 | Vadose Zone Soil | SPDASKRFVAGARAASLARMKERTEKAGGMENYDRIVQLFTPG* |
| Ga0137416_116074661 | 3300012927 | Vadose Zone Soil | QSPDASKRFVAGARAASLARMKERMEKAGGMENYERVVQLFTPG* |
| Ga0137407_102807133 | 3300012930 | Vadose Zone Soil | PEASKRFVAGARAASLLRMKERMEKAGGMENYDRVVQLFTPG* |
| Ga0137410_100115598 | 3300012944 | Vadose Zone Soil | AEASKKFVAGARAASLQRMKERMEKSGSAENYDRVVKLFTPE* |
| Ga0137410_107624713 | 3300012944 | Vadose Zone Soil | GARAASLQRMKERMEKAGGMEHFEKIVQLFTPGPLPK* |
| Ga0164302_119650592 | 3300012961 | Soil | EGARSASLARMKERMEKSGGMENFEKIVNLFTPGPLPK* |
| Ga0164309_101556331 | 3300012984 | Soil | KRFIAGARAASLARMKERMEKSGGTENYDKMVKLFTPD* |
| Ga0157378_110374693 | 3300013297 | Miscanthus Rhizosphere | IDGARAASLARSKERMEKSGGTENYDKMVKLFTPD* |
| Ga0182001_103062051 | 3300014488 | Soil | QSPEASKRFVEGARSASLQRMKDRMQKSGGTENFEKVVQLFTPGPLPK* |
| Ga0180065_11645522 | 3300014878 | Soil | QSDAASKKFVAGARAASLQRMKERMEKSGGMENYDKVIKLFTPG* |
| Ga0134072_104808452 | 3300015357 | Grasslands Soil | FVAGARAASLARMKERMEKSGGMENYDKVVQLFTPE* |
| Ga0134089_100268063 | 3300015358 | Grasslands Soil | AQRGIKTLAQSPEASRRFVAGARAASLARMKERTEKAGGMENYERVVQLFTPG* |
| Ga0132256_1001188124 | 3300015372 | Arabidopsis Rhizosphere | ARAASLARMKERMEKSGGMENFEKVIKLFTPGPLPK* |
| Ga0184604_101992332 | 3300018000 | Groundwater Sediment | QAPQASRKFVAGARAASLQRMKERMEKAGGMENYDKVIQLFTPG |
| Ga0184615_104384941 | 3300018059 | Groundwater Sediment | RGIKTLKQGPEASKKFVAGARTASLQRMKERMEKAGGMENYDKVVKLFTPE |
| Ga0190265_100903441 | 3300018422 | Soil | QSPDASKRFVQGARAASLARMKERMEKAGGMENYDKVVQLFTPG |
| Ga0190265_117346283 | 3300018422 | Soil | QSPEASKRVCEGARAASLQRMKERMEKAGGLENFEKIVQLFTPGPLPK |
| Ga0190272_126774652 | 3300018429 | Soil | KTLSQSPEASKKFVAGARTASLQRMRERMEKAGGMENYDKVVKLFTPE |
| Ga0190272_127885461 | 3300018429 | Soil | PEASKKFIAGARAASLQRMKERMEKAGGMENYDKVVKLFTPD |
| Ga0066667_103362411 | 3300018433 | Grasslands Soil | QSPDASRRFVAGARAASLARMKERTEKAGGMENYERIVQLFTPG |
| Ga0190271_123030411 | 3300018481 | Soil | KFVAGARAASLQRMKDRMEKSGGMENYDKVVKLFTPE |
| Ga0193717_11696351 | 3300020060 | Soil | SDAASKKFVDGARAASLQRMKERMEKSGGMENYDKVIKLFTPG |
| Ga0194113_110649601 | 3300020074 | Freshwater Lake | TVNQAADASRRFSSGARAASLARMKERMEKAGGMENYDRVVQLFTPN |
| Ga0196964_101690491 | 3300020202 | Soil | RAASLQRMKERMQKAGGTDNFEKVVQLFTPGPLPK |
| Ga0196963_102611192 | 3300020215 | Soil | EEASKRFVEGARAASLQRMKDRMQKAGGMENFEKVVQLFTPGPLPK |
| Ga0194119_100993351 | 3300020220 | Freshwater Lake | KTVNQSADASRRFSSGARAASLARMKERMEKAGGMENYDRVVQLFTPN |
| Ga0247801_10300902 | 3300023064 | Soil | QEEFAKRGIKSVAQLPDASKRFIVGARAVSLQRMKERIEKAGGMENYDKVVKLFTPD |
| Ga0247669_10677031 | 3300024182 | Soil | SKRFIEGARAASLQRMKERMEKAGGMENFEKVVNLFTPGPLPK |
| Ga0247664_10773773 | 3300024232 | Soil | TVAQSGDASKRFIAGARAASLQRMKERMEKAGGMENYDKIVQLFTPG |
| Ga0207697_101771281 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | IAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD |
| Ga0207670_116193082 | 3300025936 | Switchgrass Rhizosphere | GARAASLQRMKERMEKAGGMENFEKVVQLFTPGPLPK |
| Ga0207648_113160861 | 3300026089 | Miscanthus Rhizosphere | RFIAGARAASLQRMKERMEKAGGMENFEKIINLFTPGPLPK |
| Ga0209154_10420734 | 3300026317 | Soil | AQSPEASRRFVAGARAASLARMKERTEKVGGMENYERVVQLFTPG |
| Ga0209802_12406222 | 3300026328 | Soil | RRGIKTLSQSSEASKKFVTGARAASLARMKERMEKSGGTENYDRVVQLLTPE |
| Ga0209803_10239995 | 3300026332 | Soil | RGIKTLAQSPDASRRFVAGARAASLARMKERTEKAGGMENYDRIVQLFTPG |
| Ga0209803_12234161 | 3300026332 | Soil | SPEASRRFVAGARAASLARMKERMEKAGGMENYERVVQLFTPG |
| Ga0209474_105534492 | 3300026550 | Soil | VAGARAASLARMKERVEKAGGMENYDRVVQLLSPE |
| Ga0208983_10348041 | 3300027381 | Forest Soil | LSQSPEASKRFVAGARAASLARMKERMEKSGGMDNYDRVVQLFTPD |
| Ga0209995_10912531 | 3300027471 | Arabidopsis Thaliana Rhizosphere | PQSDEASKRFVEGARAASLQRMKERIEKAGGMENFQKVVQLLTPGPLPK |
| Ga0209999_10844772 | 3300027543 | Arabidopsis Thaliana Rhizosphere | EGARAASLARMKERMEKSGGMENYEKVIQLFTPGPLPK |
| Ga0209117_11989541 | 3300027645 | Forest Soil | SPDASKRFYEGARAASLARMKERMEKSGGMENFEKVIQLFTPGPLPK |
| Ga0209485_13359422 | 3300027691 | Agricultural Soil | YEGARSASLARMKERMEKAGGMENYDKVIQLFTPGS |
| Ga0209689_13291931 | 3300027748 | Soil | EASKRFVAGARTASLARMKERMEKAGGTENYDKVVQLFTPE |
| Ga0209073_104419582 | 3300027765 | Agricultural Soil | TVAQSPEASKRFVEGARSASLQRMKERMEKAGGMENFEKIIHLFTPGPLPK |
| Ga0209166_101140931 | 3300027857 | Surface Soil | RFVEGARSASLTRMKERMEKSGGMENFEKIINLFTPGPLPK |
| Ga0209488_112245202 | 3300027903 | Vadose Zone Soil | GIKTLSQSPEASKRFVAGARAASLARMKERTEKAGGMENYDRVVQLFTPG |
| Ga0137415_104676423 | 3300028536 | Vadose Zone Soil | ASKRFVAGARAASLARMKERTEKAGGMENYDRVVQLFTPG |
| Ga0247824_106703341 | 3300028809 | Soil | VAQSPEASKRFIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD |
| Ga0247825_104195933 | 3300028812 | Soil | LKTVAQSPEASKRFYEGARSASLARMKERMEKAGGMENYDKVIQLFTPGK |
| Ga0310888_103447501 | 3300031538 | Soil | QSDEASKRFVAGARAASLQRMKERMEKAGGMENYDKVVKLFTPG |
| Ga0310888_104165131 | 3300031538 | Soil | VAQSGDASKRFIDGARAASLQRMKERMEKAGGMENYDQVVKLFTPN |
| Ga0307468_1003523203 | 3300031740 | Hardwood Forest Soil | TVSQSPEASKRFVEGARAASLARMKERMEKAGGMENFEKIVQLFTPGPLPK |
| Ga0307468_1009116853 | 3300031740 | Hardwood Forest Soil | DAASKKFVAGARAASLQRMKERMEKSGGMDNYDQVVKLFTPG |
| Ga0310885_104968142 | 3300031943 | Soil | RQASLTRMKERMEKAGGMENFEKIINLFTPGPLPK |
| Ga0307411_110703231 | 3300032005 | Rhizosphere | KRGIKTLSQSPEASKKFVAGARTASLQRMRERMEKAGGMENYDKVVKLFTPD |
| Ga0310906_113830762 | 3300032013 | Soil | VEGARQASLTRMKERMEKAGGMENFEKIINLFTPGPLPK |
| Ga0310899_107348491 | 3300032017 | Soil | IKTIAQSPEASKRFVEGARQASLTRMKERMEKAGGMENFEKIINLFTPGPLPK |
| Ga0307415_1016564262 | 3300032126 | Rhizosphere | SEAASKKFVDGARAASLQRMKERMEKAGGMENYDKVVKLFTPD |
| Ga0315910_105919943 | 3300032144 | Soil | KKFVAGARAASLQRMKDRMEKSGGMENYEKVVKIFTPG |
| Ga0315912_109641951 | 3300032157 | Soil | DAASKKFVAGARAASLQRMKERMEKSGGMENYDQVVKLFTPG |
| Ga0315281_102617403 | 3300032163 | Sediment | SADASKRFVAGARAASLQRMKERMEKAGGTENYDKVVQLLSPD |
| Ga0307470_100508224 | 3300032174 | Hardwood Forest Soil | ARAASLARMKERMEKAGGMENFEKIVQLFTPGPLPK |
| Ga0307471_1005245631 | 3300032180 | Hardwood Forest Soil | FVAGARAASLARMKERMEKSGGMENYDRVVQLFTPD |
| Ga0307472_1018378791 | 3300032205 | Hardwood Forest Soil | IKTLEQSAGAAKRFTDGARAASLQRMKERMEKSGGMENYDKVIQLFTPN |
| Ga0310896_108874702 | 3300032211 | Soil | RFVEGARQASLTRMKERMEKAGGMENFEKIINLFTPGPLPK |
| Ga0335081_126261611 | 3300032892 | Soil | GMKTLSQSPDASKKFIAGARAASLQRMKERMEKAGGMENYDKVVQLFSPG |
| Ga0310810_102512491 | 3300033412 | Soil | IKSVAQSPDASKRFIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD |
| Ga0326726_122813901 | 3300033433 | Peat Soil | SKRFIAGARAASLARMKERMEKAGGTENYDRVIKLFTPE |
| Ga0247829_106259472 | 3300033550 | Soil | VAQSPDASKRFYAGARSASLARMKERMEKAGGLENYDKVVTLFTPF |
| Ga0364937_005927_1560_1700 | 3300034113 | Sediment | MAQSADAAKRFNAGARSASLARMKERMEKAGGTENFDRVVQLFTPG |
| Ga0364943_0208741_571_711 | 3300034354 | Sediment | MAQSADAAKKFNAGARSASLARMKERLEKAGGTENYDRVVQLFTPG |
| ⦗Top⦘ |