Metagenome / Metatranscriptome Family F046616

Overview

Basic Information

• Family ID: F046616
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 151
• Average Sequence Length: 39 residues
• Representative Sequence: TAALLAGKVPLEQGETVVAVVSGGNVAPETAVAILAGR
• Number of Associated Samples: 146
• Number of Associated Scaffolds: 151

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 0.67 %
• % of genes near scaffold ends (potentially truncated): 98.01 %
• % of genes from short scaffolds (< 2000 bps): 95.36 %
• Associated GOLD sequencing projects: 143
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (98.675 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.218 % of family members)
• Environment Ontology (ENVO): Unclassified (27.815 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (49.007 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Fibrous
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 18.18%
  β-sheet: 0.00%
  Coil/Unstructured: 81.82%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 151 Family Scaffolds
PF01197	Ribosomal_L31	65.56
PF07136	DUF1385	27.81
PF03462	PCRF	3.97
PF02566	OsmC	0.66
PF13184	KH_5	0.66
PF04828	GFA	0.66
PF01300	Sua5_yciO_yrdC	0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 151 Family Scaffolds
COG0254	Ribosomal protein L31	Translation, ribosomal structure and biogenesis [J]	65.56
COG3872	Uncharacterized conserved protein YqhQ, DUF1385 family	Function unknown [S]	27.81
COG0216	Protein chain release factor RF1	Translation, ribosomal structure and biogenesis [J]	3.97
COG1186	Protein chain release factor PrfB	Translation, ribosomal structure and biogenesis [J]	3.97
COG1764	Organic hydroperoxide reductase OsmC/OhrA	Defense mechanisms [V]	0.66
COG1765	Uncharacterized OsmC-related protein	General function prediction only [R]	0.66
COG3791	Uncharacterized conserved protein	Function unknown [S]	0.66

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	98.68 %
Unclassified	root	N/A	1.32 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	98.68 %
Unclassified	root	N/A	1.32 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	98.68 %
Unclassified	root	N/A	1.32 %

Level 4

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	50.33 %
Unclassified	root	N/A	1.32 %

Level 5

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	50.33 %
Unclassified	root	N/A	1.32 %

Level 6

Name	Rank	Taxonomy	Distribution
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	25.17 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3.97 %
Unclassified	root	N/A	1.32 %

Level 7

Name	Rank	Taxonomy	Distribution
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	18.54 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	3.97 %
Thermoleophilales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales	3.31 %
Unclassified	root	N/A	1.32 %

Level 8

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3.97 %
Thermoleophilaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae	3.31 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	2.65 %
Unclassified	root	N/A	1.32 %

Level 9

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3.97 %
unclassified Thermoleophilaceae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae	3.31 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	2.65 %
Unclassified	root	N/A	1.32 %

Level 10

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3.97 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	3.31 %
Solirubrobacter pauli	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli	1.32 %
Unclassified	root	N/A	1.32 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000651|AP72_2010_repI_A10DRAFT_1040787	All Organisms → cellular organisms → Bacteria	604
3300000858|JGI10213J12805_10147896	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	515
3300000891|JGI10214J12806_11653693	All Organisms → cellular organisms → Bacteria	697
3300001205|C688J13580_1043596	All Organisms → cellular organisms → Bacteria	594
3300001536|A1565W1_10524268	All Organisms → cellular organisms → Bacteria	701
3300002244|JGI24742J22300_10063733	All Organisms → cellular organisms → Bacteria	680
3300002568|C688J35102_120873822	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1943
3300004013|Ga0055465_10011007	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1829
3300004157|Ga0062590_100740596	All Organisms → cellular organisms → Bacteria	893
3300004480|Ga0062592_101965264	All Organisms → cellular organisms → Bacteria	577
3300005179|Ga0066684_10144444	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1504
3300005438|Ga0070701_11006027	All Organisms → cellular organisms → Bacteria	582
3300005445|Ga0070708_101993632	All Organisms → cellular organisms → Bacteria	538
3300005468|Ga0070707_100405343	All Organisms → cellular organisms → Bacteria	1324
3300005549|Ga0070704_100156918	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1796
3300005554|Ga0066661_10582738	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	666
3300005559|Ga0066700_10858124	All Organisms → cellular organisms → Bacteria	607
3300005568|Ga0066703_10206392	All Organisms → cellular organisms → Bacteria	1193
3300005575|Ga0066702_10979742	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	506
3300005576|Ga0066708_10909185	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	549
3300005577|Ga0068857_101128280	All Organisms → cellular organisms → Bacteria	758
3300005713|Ga0066905_102089695	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	527
3300005886|Ga0075286_1038457	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	648
3300005937|Ga0081455_10772166	All Organisms → cellular organisms → Bacteria	605
3300005937|Ga0081455_11026013	All Organisms → cellular organisms → Bacteria	510
3300006034|Ga0066656_10520443	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	775
3300006046|Ga0066652_101928221	All Organisms → cellular organisms → Bacteria	529
3300006050|Ga0075028_100058800	All Organisms → cellular organisms → Bacteria	1870
3300006169|Ga0082029_1587340	All Organisms → cellular organisms → Bacteria	591
3300006175|Ga0070712_101574003	All Organisms → cellular organisms → Bacteria	575
3300006353|Ga0075370_10578955	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	680
3300006579|Ga0074054_12084190	All Organisms → cellular organisms → Bacteria	862
3300006581|Ga0074048_10007703	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2447
3300006755|Ga0079222_10803487	All Organisms → cellular organisms → Bacteria	768
3300006791|Ga0066653_10750822	All Organisms → cellular organisms → Bacteria	509
3300006800|Ga0066660_10743938	All Organisms → cellular organisms → Bacteria	801
3300006847|Ga0075431_100888874	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	861
3300006847|Ga0075431_101854475	All Organisms → cellular organisms → Bacteria	559
3300006853|Ga0075420_101743541	All Organisms → cellular organisms → Bacteria	533
3300006871|Ga0075434_101428442	All Organisms → cellular organisms → Bacteria	702
3300007076|Ga0075435_101552208	All Organisms → cellular organisms → Bacteria	581
3300009089|Ga0099828_11641472	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	566
3300009090|Ga0099827_10277565	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1414
3300009098|Ga0105245_10468361	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1271
3300009162|Ga0075423_12085913	All Organisms → cellular organisms → Bacteria	615
3300009177|Ga0105248_12809575	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	555
3300009553|Ga0105249_10876987	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	964
3300009817|Ga0105062_1067732	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	673
3300010039|Ga0126309_11161174	All Organisms → cellular organisms → Bacteria	528
3300010123|Ga0127479_1151391	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	591
3300010301|Ga0134070_10283047	All Organisms → cellular organisms → Bacteria	628
3300010322|Ga0134084_10144516	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	795
3300010325|Ga0134064_10152940	All Organisms → cellular organisms → Bacteria	799
3300010360|Ga0126372_12097930	All Organisms → cellular organisms → Bacteria	613
3300010373|Ga0134128_12746851	All Organisms → cellular organisms → Bacteria	543
3300010403|Ga0134123_12122828	All Organisms → cellular organisms → Bacteria	622
3300011399|Ga0137466_1024336	All Organisms → cellular organisms → Bacteria	829
3300011987|Ga0120164_1034064	All Organisms → cellular organisms → Bacteria	771
3300012186|Ga0136620_10327045	All Organisms → cellular organisms → Bacteria	661
3300012189|Ga0137388_10249516	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1615
3300012199|Ga0137383_10607121	All Organisms → cellular organisms → Bacteria	800
3300012200|Ga0137382_10836996	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	663
3300012201|Ga0137365_11126759	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	564
3300012202|Ga0137363_10687473	All Organisms → cellular organisms → Bacteria	866
3300012207|Ga0137381_10495889	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1066
3300012349|Ga0137387_10361916	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1051
3300012354|Ga0137366_10590857	All Organisms → cellular organisms → Bacteria	797
3300012358|Ga0137368_10465872	All Organisms → cellular organisms → Bacteria	819
3300012359|Ga0137385_10537043	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	987
3300012469|Ga0150984_115834262	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1211
3300012483|Ga0157337_1005134	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	862
3300012498|Ga0157345_1015593	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	721
3300012882|Ga0157304_1029237	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	750
3300012897|Ga0157285_10225746	All Organisms → cellular organisms → Bacteria	602
3300012907|Ga0157283_10285310	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	566
3300012909|Ga0157290_10017442	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1514
3300012911|Ga0157301_10458723	All Organisms → cellular organisms → Bacteria	507
3300012931|Ga0153915_11979461	All Organisms → cellular organisms → Bacteria	682
3300012931|Ga0153915_12889859	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	560
3300012944|Ga0137410_11148775	All Organisms → cellular organisms → Bacteria	667
3300012971|Ga0126369_11213351	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	844
3300012987|Ga0164307_10870432	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	722
3300013100|Ga0157373_11190045	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	574
3300013297|Ga0157378_13187066	All Organisms → cellular organisms → Bacteria	509
3300013764|Ga0120111_1161887	All Organisms → cellular organisms → Bacteria	506
3300014056|Ga0120125_1003069	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	3425
3300015077|Ga0173483_10610314	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	601
3300015161|Ga0167623_1062935	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	675
3300015242|Ga0137412_10321558	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1209
3300015262|Ga0182007_10395225	All Organisms → cellular organisms → Bacteria	526
3300015357|Ga0134072_10291943	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	604
3300015359|Ga0134085_10511120	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	550
3300015372|Ga0132256_101917153	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	700
3300015373|Ga0132257_101974876	All Organisms → cellular organisms → Bacteria	752
3300015374|Ga0132255_102747813	All Organisms → cellular organisms → Bacteria	753
3300017657|Ga0134074_1285996	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	598
3300017659|Ga0134083_10073809	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1315
3300017997|Ga0184610_1000623	All Organisms → cellular organisms → Bacteria	8178
3300017997|Ga0184610_1293935	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	535
3300018054|Ga0184621_10170571	All Organisms → cellular organisms → Bacteria	782
3300018066|Ga0184617_1034214	All Organisms → cellular organisms → Bacteria	1221
3300018071|Ga0184618_10286549	All Organisms → cellular organisms → Bacteria	700
3300018917|Ga0193611_1149440	All Organisms → cellular organisms → Bacteria	580
3300019356|Ga0173481_10151668	All Organisms → cellular organisms → Bacteria	957
3300019361|Ga0173482_10746491	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	512
3300019873|Ga0193700_1007238	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1743
3300019885|Ga0193747_1131145	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	585
3300021080|Ga0210382_10306742	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	699
3300021344|Ga0193719_10243028	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	762
3300021413|Ga0193750_1038774	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1048
3300021445|Ga0182009_10380987	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	726
3300021560|Ga0126371_13809075	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	508
3300022883|Ga0247786_1075663	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	707
3300023062|Ga0247791_1046812	All Organisms → cellular organisms → Bacteria	679
3300025548|Ga0208716_1043837	All Organisms → cellular organisms → Bacteria	970
3300025846|Ga0209538_1053893	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1713
3300025852|Ga0209124_10218127	All Organisms → cellular organisms → Bacteria	747
3300025919|Ga0207657_10614278	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	848
3300025921|Ga0207652_10640079	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	951
3300025931|Ga0207644_10634760	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	888
3300025933|Ga0207706_11141786	All Organisms → cellular organisms → Bacteria	649
3300025941|Ga0207711_10604830	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1023
3300025942|Ga0207689_10239629	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1499
3300025944|Ga0207661_10562393	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1045
3300026032|Ga0208419_1023961	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	700
3300026075|Ga0207708_10423429	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1104
3300026277|Ga0209350_1058195	All Organisms → cellular organisms → Bacteria	1110
3300026535|Ga0256867_10002754	All Organisms → cellular organisms → Bacteria	7587
3300027480|Ga0208993_1066812	All Organisms → cellular organisms → Bacteria	653
3300027765|Ga0209073_10323694	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	616
3300027869|Ga0209579_10686380	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	554
3300028381|Ga0268264_10804700	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	939
3300028587|Ga0247828_10839285	All Organisms → cellular organisms → Bacteria	586
3300028705|Ga0307276_10146066	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	599
3300028708|Ga0307295_10033599	All Organisms → cellular organisms → Bacteria	1293
3300028717|Ga0307298_10140607	All Organisms → cellular organisms → Bacteria	698
3300028719|Ga0307301_10009690	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2717
3300028722|Ga0307319_10111329	All Organisms → cellular organisms → Bacteria	879
3300028778|Ga0307288_10097803	Not Available	1066
3300028778|Ga0307288_10208066	All Organisms → cellular organisms → Bacteria	755
3300028784|Ga0307282_10077853	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1515
3300028796|Ga0307287_10230494	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli	702
3300028811|Ga0307292_10476793	All Organisms → cellular organisms → Bacteria	534
3300030294|Ga0311349_10664688	All Organisms → cellular organisms → Bacteria	984
3300030336|Ga0247826_10511381	All Organisms → cellular organisms → Bacteria	909
3300030838|Ga0311335_11399822	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	504
3300031092|Ga0308204_10195297	All Organisms → cellular organisms → Bacteria	628
3300031226|Ga0307497_10744466	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli	510
3300031903|Ga0307407_11683379	All Organisms → cellular organisms → Bacteria	505
3300032126|Ga0307415_100114265	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2009

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	79.47%
Host-Associated	Host-Associated	20.53%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	71.52%
Plants	Host-Associated → Plants	20.53%
Aquatic	Environmental → Aquatic	7.95%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	70.20%
Rhizosphere	Host-Associated → Plants → Rhizosphere	13.25%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.62%
Sediment	Environmental → Aquatic → Sediment	4.64%
Freshwater	Environmental → Aquatic → Freshwater	2.65%
Peat	Environmental → Terrestrial → Peat	1.32%
Marine	Environmental → Aquatic → Marine	0.66%
Roots	Host-Associated → Plants → Roots	0.66%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	58.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.93%
Loam	Environmental → Terrestrial → Soil → Loam	8.61%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.30%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.64%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.31%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.32%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.32%
Sand	Environmental → Terrestrial → Soil → Sand	1.32%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.32%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.32%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.66%
Ice	Environmental → Aquatic → Freshwater → Ice	0.66%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.66%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.66%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	39.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.93%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.61%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.30%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.64%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	4.64%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.97%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.31%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.32%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.32%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.32%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.32%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.32%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.32%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.32%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.66%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.66%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.66%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.66%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.66%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.66%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.66%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	17.22%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.27%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.95%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	5.30%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.64%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.97%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.31%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	2.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.99%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.99%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.99%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.99%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.32%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.32%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.32%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.32%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.32%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	1.32%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.32%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.32%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	1.32%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.32%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.32%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.66%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.66%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.66%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.66%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.66%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.66%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.66%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.66%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	0.66%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.66%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.66%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.66%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.66%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.66%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.66%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.66%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.66%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.66%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.66%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.66%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.66%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.66%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.66%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.66%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.66%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.66%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.66%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.66%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.66%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000651	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10	Environmental
3300000858	Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil	Environmental
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental
3300001205	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental
3300001536	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina	Environmental
3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Host-Associated
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental
3300004013	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2	Environmental
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300005886	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205	Environmental
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental
3300006169	Termite nest microbial communities from Madurai, India	Environmental
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental
3300006353	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Host-Associated
3300006579	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)	Environmental
3300006581	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)	Environmental
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009817	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20	Environmental
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental
3300010123	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome)	Environmental
3300010301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015	Environmental
3300010322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG	Environmental
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300011399	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2	Environmental
3300011987	Permafrost microbial communities from Nunavut, Canada - A20_80cm_0M	Environmental
3300012186	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)	Environmental
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012483	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610	Host-Associated
3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Host-Associated
3300012882	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2	Environmental
3300012897	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1	Environmental
3300012907	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1	Environmental
3300012909	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1	Environmental
3300012911	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2	Environmental
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013764	Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M	Environmental
3300014056	Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M	Environmental
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental
3300015161	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin)	Environmental
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental
3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Host-Associated
3300015357	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG	Environmental
3300015359	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015	Environmental
3300015372	Soil combined assembly	Host-Associated
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300017657	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015	Environmental
3300017659	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG	Environmental
3300017997	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex	Environmental
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental
3300018066	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1	Environmental
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental
3300018917	Soil crust microbial communities from Colorado Plateau, Utah, USA - early-mid stage, 0 min after wetting v1	Environmental
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental
3300019873	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1	Environmental
3300019885	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2	Environmental
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental
3300021413	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1	Environmental
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300022883	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4	Environmental
3300023062	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4	Environmental
3300025548	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012 (SPAdes)	Environmental
3300025846	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes)	Environmental
3300025852	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)	Environmental
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental
3300026032	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 (SPAdes)	Environmental
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental
3300026277	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)	Environmental
3300026535	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)	Environmental
3300027480	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)	Environmental
3300027765	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)	Environmental
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental
3300028705	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115	Environmental
3300028708	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152	Environmental
3300028717	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158	Environmental
3300028719	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182	Environmental
3300028722	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368	Environmental
3300028778	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142	Environmental
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental
3300028796	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141	Environmental
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental
3300030294	II_Fen_E3 coassembly	Environmental
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental
3300030838	I_Fen_N1 coassembly	Environmental
3300031092	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)	Environmental
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
AP72_2010_repI_A10DRAFT_10407873	3300000651	Forest Soil	ILSGKVPVERGQTVVSVVSGGNVAPQQAAAILAGR*
JGI10213J12805_101478961	3300000858	Soil	GAASMAALLAGKVPLSNGESVVVVVSGGNVAAETASAILARR*
JGI10214J12806_116536933	3300000891	Soil	GALLAGKVPDVQGKTVAVVVSGGNVAPQTAAAILSANEA*
C688J13580_10435961	3300001205	Soil	ATAALLAGKIALEATDTVVAVVSGGNVATQTAVAILAGR*
A1565W1_105242681	3300001536	Permafrost	LLAGKVAVSQGETVAVVVSGGNAAPETASAILARR*
JGI24742J22300_100637331	3300002244	Corn, Switchgrass And Miscanthus Rhizosphere	GAFVPEPGQTVAAVVSGGNVAAKTAAAILNADEA*
C688J35102_1208738224	3300002568	Soil	GVGALLAGKVPLDGASEVAVVVSGGNVGAQTAVAILTRP*
Ga0055465_100110074	3300004013	Natural And Restored Wetlands	TAALLAGTVPDVAGKTVVAVVSGGNVAAKTASAILDSDEA*
Ga0062590_1007405961	3300004157	Soil	GGATAAALLAGKIPLEAGNTVAAVVSGGNVAPQTAAAILAEQ*
Ga0062592_1019652643	3300004480	Soil	TAALLAGKVTGVEGQDVVAVISGGNVAAKTAAGILDPDES*
Ga0066684_101444441	3300005179	Soil	GAAGVAALLAGKVPIEGSKGVAIVVSGGNVAAETAVAILAGR*
Ga0070701_110060273	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	AATAALLAGKVPLEPDEDVAAVVSGGNVVPETASAILASR*
Ga0070708_1019936321	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	AAALLSGAFVPEPGQTVAAVVSGGNVAAKTAAAILNADEA*
Ga0070707_1004053433	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	GAATTAALMAGKVRLEPGETAVAVISGGNVALETASAILAGA*
Ga0070704_1001569181	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	LGVAALLAGKVPLNGVTAVAVVVSGGNVVPETAAAILAGR*
Ga0066661_105827383	3300005554	Soil	ATAAALLAGKVELEPHSRVAAVVSGGNVAPQAAVAILAER*
Ga0066700_108581243	3300005559	Soil	LLSGAFVPEPGQTVAAVVSGGNVAPETAAAILGSDEA*
Ga0066703_102063923	3300005568	Soil	TAAALLSGAIVPEPGQTVAAVVSGGNVAPETAAAILNSNEA*
Ga0066702_109797422	3300005575	Soil	VAALLGGKVALEPGETAVAIVSGGNVATQTAVAILGKP*
Ga0066708_109091851	3300005576	Soil	LMSGAVEVEPGQTVAAVVSGGNVAPKTAAAILASEDEG*
Ga0068857_1011282801	3300005577	Corn Rhizosphere	AATAALLAGKVELEPGESVVAVVSGGNVATDTAVAILGGR*
Ga0066905_1020896951	3300005713	Tropical Forest Soil	TAAALMSGVVDLEPGQTVAAVVSGGNVAPQTAVAILAPEHE*
Ga0075286_10384571	3300005886	Rice Paddy Soil	ALLAGKIPHAPGEHVVVVVSGGNVAPETASAILAAR*
Ga0081455_107721663	3300005937	Tabebuia Heterophylla Rhizosphere	TAALLAGRVPGVEGKTVVAVVSGGNVSAETASAILAPDEA*
Ga0081455_110260133	3300005937	Tabebuia Heterophylla Rhizosphere	ALLAGKVPLDKGETVVAVVSGGNVAPQTAAAILAER*
Ga0066656_105204433	3300006034	Soil	AALLAEKVELEPGNTVAAVVSGGNVAAETAAAILAGQ*
Ga0066652_1019282213	3300006046	Soil	AGVAALLAGKVPDIEGKTLVAVVSGGNVAAKTAAAILSSDEA*
Ga0075028_1000588001	3300006050	Watersheds	LSGRVELEPGVTVAAVVSGGNVAPKTASAILASDQ*
Ga0082029_15873403	3300006169	Termite Nest	LIAGKIPHEPGEHVALVVSGGNVSAETASAILAPR*
Ga0070712_1015740033	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	STAALLSGKVPLEPGETVVAIVSGGNIAPQQAAAILTL*
Ga0075370_105789551	3300006353	Populus Endosphere	AALLAGKVELEPGENAVAVVSGGNVATDTAVAILAGR*
Ga0074054_120841901	3300006579	Soil	VAALLAGKVPLRPGETAVAVVSGGNVAAETAVAILAGE*
Ga0074048_100077035	3300006581	Soil	ALLAGKIAHEQGERVVLVVSGGNVSAKTASAILASR*
Ga0079222_108034873	3300006755	Agricultural Soil	ATAALLSGKIGLEKGETVVAVVSGGNAAPETASAILAKR*
Ga0066653_107508223	3300006791	Soil	ACAAALLAGKVSLTPGETVVAVVSGGNVATRTAVAILDEE*
Ga0066660_107439381	3300006800	Soil	AALLAGRIDLEPGQTVTAVVSGGNVAPKTAAAILDSNEA*
Ga0075431_1008888741	3300006847	Populus Rhizosphere	AAALLSGRVELEDGDVVAAVVSGGNVAPETAAAILAGR*
Ga0075431_1018544753	3300006847	Populus Rhizosphere	AVEPAGAASTAALIAGKVPHEPGEHVALVVSGGNVSAETASAILASR*
Ga0075420_1017435413	3300006853	Populus Rhizosphere	AAALMSGAVKIDKGQKVAAVVSGGNVAPKTAAAILDSNEA*
Ga0075434_1014284423	3300006871	Populus Rhizosphere	ALLAGKVPLEADEEVVSVVSGGNVAPETASAILASR*
Ga0075435_1015522081	3300007076	Populus Rhizosphere	ATAALLAGKITVERGERVVAVVSGGNAATETASAILASR*
Ga0099828_116414721	3300009089	Vadose Zone Soil	AAALLAGKIELEPGDTVVAVVSGGNVAPETASAILAGA*
Ga0099827_102775651	3300009090	Vadose Zone Soil	AAALLAGKVPLERGNTVAAVVSGGNVAAQTAAAILAEQ*
Ga0105245_104683611	3300009098	Miscanthus Rhizosphere	LLGGKVPDVEGKTVAVVVSGGNVAGKTAAAILSANEA*
Ga0075423_120859131	3300009162	Populus Rhizosphere	AALMSGAVEVEAGQTVAAVVSGGNVAMKTAAAILASEQ*
Ga0105248_128095751	3300009177	Switchgrass Rhizosphere	ALLAGKIELEPQERVVAVVSGGNVATDTAVAILAGR*
Ga0105249_108769873	3300009553	Switchgrass Rhizosphere	ASVAALLAGKVPLEPGETAVAVVSGGNVATQTAAAILAEA*
Ga0105062_10677323	3300009817	Groundwater Sand	GVAALLAGKVELELGATVVVVVSGGNVARKTASAILAGE*
Ga0126309_111611741	3300010039	Serpentine Soil	ALLSGKVADVQGRTVVAVVSGGNVTGETAAGILGSDEA*
Ga0127479_11513913	3300010123	Grasslands Soil	ALLSGAVRVEPGQTVVAVVSGGNVAQKQAAAILDS*
Ga0134070_102830471	3300010301	Grasslands Soil	LLSGNVPLERRDTVAAVVSGGNVAPKTAAAILAGQ*
Ga0134084_101445163	3300010322	Grasslands Soil	AALLAGKIELEPGKTVVAVVSGGNVATQTAVAILGEG*
Ga0134064_101529401	3300010325	Grasslands Soil	ALLAGKVPLEGAKGVAVVVSGGNVAAETAVAILAGR*
Ga0126372_120979303	3300010360	Tropical Forest Soil	ATAAALLAGKVPLERGNTVAAVVSGGNVAPETAAAILAER*
Ga0134128_127468513	3300010373	Terrestrial Soil	AALLAGKVPLEADEEVVSVVSGGNVAPETASAILASR*
Ga0134123_121228281	3300010403	Terrestrial Soil	STAALLAGKIAHEQGERVALVVSGGNVSAETASAILASR*
Ga0137466_10243361	3300011399	Soil	AASTAALLAGKIAHEQGERVALVVSGGNVSAKTASAILASR*
Ga0120164_10340643	3300011987	Permafrost	GAVVAGKVAVSQGETVAVVVSGGNAAPETASAILARR*
Ga0136620_103270451	3300012186	Polar Desert Sand	PAGAVATAALLAGKVTLESGSTVAVVVSGGNVSPGTASAILDADEA*
Ga0137388_102495161	3300012189	Vadose Zone Soil	AALLSGVVELEPGQTVAAVVSGGNVDAKTAAAILNADEA*
Ga0137383_106071213	3300012199	Vadose Zone Soil	STAALLAGKIALDPRESVVAVVSGGNTAPETTSDILGKR*
Ga0137382_108369963	3300012200	Vadose Zone Soil	AGAVGIAALLAGKVPLNGAKAITAVVSGGNVSAETAAAILAGR*
Ga0137365_111267593	3300012201	Vadose Zone Soil	AALLAGKVPLEPGNVVAAVVSGGNVAPQTAAAILAER*
Ga0137363_106874733	3300012202	Vadose Zone Soil	ALLSGKVPVEAGRNVVAVVSGGNVAPRQAAAILAGR*
Ga0137381_104958891	3300012207	Vadose Zone Soil	AALMSGKIMLEPGETAVAVISGGNVALETASAILAGA*
Ga0137387_103619161	3300012349	Vadose Zone Soil	LLAGKVPLSGATPVAAVVSGGNVAAETAAAILAGR*
Ga0137366_105908573	3300012354	Vadose Zone Soil	GAAGVAALLAGKVPLNDAKAVVVVVSGGNVAAETAAAILARR*
Ga0137368_104658721	3300012358	Vadose Zone Soil	TAAALLAGKVPLERGNTVAAVVSGGNVAAQTAAAILAEQ*
Ga0137385_105370431	3300012359	Vadose Zone Soil	LAGKISVTKDETVVAVVSGGNVATETAVAILAGQ*
Ga0150984_1158342621	3300012469	Avena Fatua Rhizosphere	DPGAAAGVGALLAGKVPNVEGKTVAVVVSGGNVAGQTAAAILSSNEA*
Ga0157337_10051343	3300012483	Arabidopsis Rhizosphere	ALLAGKVPLEPDEDVIAVVSGGNVVPETASAILASR*
Ga0157345_10155931	3300012498	Arabidopsis Rhizosphere	STAALLAGKVLLEQGETVVAVVSGGNVATETAVAILAGR*
Ga0157304_10292373	3300012882	Soil	GKVPDVEGKTVAVVVSGGNVAPQTAAAILNGNEA*
Ga0157285_102257463	3300012897	Soil	EPAGAASTAALIAGKIAHEPGEHVALVVSGGNVSAETASAILASR*
Ga0157283_102853103	3300012907	Soil	AAEPGAAAGVGALLAGKVPEVEGRTVAVVVSGGNVAGKTAAAILSSNEA*
Ga0157290_100174424	3300012909	Soil	TAALLAGKIAHEQGERVALVVSGGNVSAKTASAILASR*
Ga0157301_104587233	3300012911	Soil	LLAGKVPLNGVTAVAVVVSGGNVVPETAAAILAGR*
Ga0153915_119794613	3300012931	Freshwater Wetlands	AALLSGKVRAEPGETVVAIVSGGNIAAKQAAAILAA*
Ga0153915_128898591	3300012931	Freshwater Wetlands	LLAGKVPLGSGDVAVAVVSGGNVAPGTASAILAGR*
Ga0137410_111487753	3300012944	Vadose Zone Soil	LAGKIDLEPDNTVAAVVSGGNIAAQTAAAILAEQ*
Ga0126369_112133513	3300012971	Tropical Forest Soil	LAGKVRLQQGETVVAVVSGGNVATQTAAAILAGR*
Ga0164307_108704321	3300012987	Soil	AALLAGKVPLNGAKGIAVVVSGGNVSAETAAAILAER*
Ga0157373_111900453	3300013100	Corn Rhizosphere	TAAALLSGAFVPEPGQTVAAVVSGGNVAPKTAAAILGSDEA*
Ga0157378_131870661	3300013297	Miscanthus Rhizosphere	CETAGAATAAALLAGKVPLERNEKAVAVVSGGNVAPENASAILAGR*
Ga0120111_11618871	3300013764	Permafrost	LLAGKVELDASGTTVAVVSGGNVATQTAVAILGGQ*
Ga0120125_10030695	3300014056	Permafrost	ASTAALLSGKVQLDAGSTTVAVVSGGNVAASTAVAILAAG*
Ga0173483_106103141	3300015077	Soil	AVSTAALLAGKVQADPAGTTVAVVSGGNVAAQTAVAILDEE*
Ga0167623_10629353	3300015161	Glacier Forefield Soil	AASTAALLSGKVRPEAGETAVAVVSGGNISPETASGILAGG*
Ga0137412_103215583	3300015242	Vadose Zone Soil	STAALLSGKVPLEPGETVVAIVSGGNIAPLEAAAILAL*
Ga0182007_103952253	3300015262	Rhizosphere	AAATAALLAGKIELEPDERVVAVVSGGNVATDTAVAILAGR*
Ga0134072_102919431	3300015357	Grasslands Soil	ALLSGKIDLLPGQSVAAVVSGGNVAAQTAAAILGEQ*
Ga0134085_105111203	3300015359	Grasslands Soil	ATAAALLAGKVGLEPHSRVAAVVSGGNVAPEAAVAILAER*
Ga0132256_1019171533	3300015372	Arabidopsis Rhizosphere	ALLAGKVELGPREHAVAVVSGGNVVAEIASAILARR*
Ga0132257_1019748763	3300015373	Arabidopsis Rhizosphere	EPAGAASTAGLLARTIALEPGETVVAVVSGGNAGSQTASAILASE*
Ga0132255_1027478133	3300015374	Arabidopsis Rhizosphere	ATAALLAAKFELDAGGTTVAVVTGGNVAPQTAVAILAEE*
Ga0134074_12859961	3300017657	Grasslands Soil	GAAAGVGALLAGNVPDVEGKTVVVVVSGGNVAARTAAAILSSNEA
Ga0134083_100738091	3300017659	Grasslands Soil	TAAALLSGAFVPEPGQTVAAVVSGGNVAPETAAAILNSNEA
Ga0184610_100062311	3300017997	Groundwater Sediment	AGKIPEVEGRTVCFVVSGGNVSPQTASAILEGDEG
Ga0184610_12939351	3300017997	Groundwater Sediment	AALLSGVVVPEQGLTVAAVVSGGNVAPQTAAAILASDEA
Ga0184621_101705713	3300018054	Groundwater Sediment	GAAAGVGALLAGKVRDVEGKTVAVVVSGGTVGAKTAAAILSSNEA
Ga0184617_10342143	3300018066	Groundwater Sediment	GVVELERGQTVAAVVSGGNVAPKTAAAILASEDEA
Ga0184618_102865493	3300018071	Groundwater Sediment	LLAGKVPLNEAKAVGVVVSGGNVAAETAAAILARR
Ga0193611_11494401	3300018917	Soil	GVGAFLAGKIGGDAVTFIVSGGNVAPQTASAILARA
Ga0173481_101516681	3300019356	Soil	TAALLAGKIAHEQGERVALVVSGGNVSAQTASAILASR
Ga0173482_107464913	3300019361	Soil	RRLAVGALLAGKVPDVEGKTVTAVVSGGNVAAQTAAAILGSNEA
Ga0193700_10072381	3300019873	Soil	LLAGKIPLQAGETVVAVVSGGNVATQTAAAILGGQ
Ga0193747_11311453	3300019885	Soil	LLAGKVELEPGESVVAVVSGGNVATDTAVAILAGR
Ga0210382_103067423	3300021080	Groundwater Sediment	AAALLAGKVPLERGNTVAAVVSGGNVVAQTAAAILAEQ
Ga0193719_102430283	3300021344	Soil	GAVAVAALLARKIDLEPGETAVAIVSGGNVATQTAVAILGER
Ga0193750_10387741	3300021413	Soil	LLAGKVPLNGAKAIAVVVSGGNVSAETAAAILAGR
Ga0182009_103809871	3300021445	Soil	LLAGKVDLEPGNTVAAVVSGGNVAAQTAAAILAEQ
Ga0126371_138090751	3300021560	Tropical Forest Soil	VGVAALLAGKVPLEGAKGVAVVVSGGNVAAETAVAILAGR
Ga0247786_10756631	3300022883	Soil	LAGKVPDVEGKTVAVVVSGGNVAPQTAAAILNGNEA
Ga0247791_10468123	3300023062	Soil	TAALLAGKVPLEQGETVVAVVSGGNVAPETAVAILAGR
Ga0208716_10438373	3300025548	Arctic Peat Soil	AVSTAALLAGVYKPEPGTTVIAVVSGGNVAPRTASGILDPDEG
Ga0209538_10538931	3300025846	Arctic Peat Soil	STAALLAGVYKPEPGSTVVAVVSGGNVAPRTASGILDPDEG
Ga0209124_102181271	3300025852	Arctic Peat Soil	TAALLAGVYKPEPGTTVIAVVSGGNVAPRTASGILDPDEG
Ga0207657_106142783	3300025919	Corn Rhizosphere	AALLAGKIDVEPGENVVAVVSGGNVATDTAVAILSGR
Ga0207652_106400793	3300025921	Corn Rhizosphere	LSGAFVPEPGQTVAAVVSGGNVAAKTAAAILNADEA
Ga0207700_108263261	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	ALLAGKVRAAPDASVVCVVSGGNVAGETAAAILAAR
Ga0207644_106347601	3300025931	Switchgrass Rhizosphere	TAAALLSGAFVPEPGQTVAAVVSGGNVAAKTAAAILNADEA
Ga0207706_111417861	3300025933	Corn Rhizosphere	ALLAGRVPDVEGKTVVAVVSGGNVAGETASAILAPDEA
Ga0207711_106048303	3300025941	Switchgrass Rhizosphere	ALLAGKVPLEADEEVVSVVSGGNVAPETASAILASR
Ga0207689_102396292	3300025942	Miscanthus Rhizosphere	LLSGAFVPEPGQTVAAVVSGGNVAAKTAAAILNADEA
Ga0207661_105623931	3300025944	Corn Rhizosphere	ATAALLAGKIELEPDERVVAVVSGGNVATDTAVAILAGR
Ga0208419_10239611	3300026032	Natural And Restored Wetlands	EAAGVAALLAGKIADLEGATVAVVVSGGNVSARMASDILASHEA
Ga0207708_104234291	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	AVEPAGAASTAALIAGKIPHEPGEHVALVVSGGNVSAETASAILASR
Ga0209350_10581951	3300026277	Grasslands Soil	LLSGAIVPEPGQTVAAVVSGGNVAPETAAAILNSNEA
Ga0256867_1000275411	3300026535	Soil	AGVAALLAGKVPGVEGATVAVVVSGGNVAGETASGILKPVQPPADS
Ga0208993_10668123	3300027480	Forest Soil	ASTAALLSGKVRVEPGETVVAVVSGGNIAAKQAAAILVT
Ga0209073_103236943	3300027765	Agricultural Soil	ALLAGKIELEPQERVVAVVSGGNVATDTAVAILAGR
Ga0209579_106863801	3300027869	Surface Soil	AALLSGKVPLEAGETVVAVVSGGNAAPEMASAILAKR
Ga0268264_108047001	3300028381	Switchgrass Rhizosphere	VGALLAGKVPDVDGKTVAVVVSGGNVAGKTAAAILSSNED
Ga0247828_108392851	3300028587	Soil	LLAGKVPDVEGKTVAVVVSGGNVAGKTAAAILSSNEA
Ga0307276_101460661	3300028705	Soil	GVAALLAGKVPLNGAKALGVVVSGGNVAAETAAAILARR
Ga0307295_100335993	3300028708	Soil	LLAGKLPGVEGQDVVAVISGGNVAAKTAAGILDNR
Ga0307298_101406073	3300028717	Soil	ATAAALMSGVVELERGQTVAAVVSGGNVAPKTAAAILASEDEA
Ga0307301_100096906	3300028719	Soil	LLAGKVPDVQGKTVAVVVSGGNVAAETAAAILSSNEA
Ga0307319_101113293	3300028722	Soil	ALMSGVVELERGQTVAAVVSGGNVAPKTAAAILASEDEA
Ga0307288_100978031	3300028778	Soil	LLAGKVRDVEGKTVAVVVSGGNVGAKTAAAILSSNEA
Ga0307288_102080661	3300028778	Soil	GVGALLAGKVPDVEGKTVAVVVSGGNVAGKTAAAILSSNEA
Ga0307282_100778531	3300028784	Soil	GGAAAVAALLAAKVPDVEGKTVVAVVSGGNVAAETATAILSSDEA
Ga0307287_102304941	3300028796	Soil	VSTAALLSGKVAPEQGESVVAVVSGGNVASETAAAILAGR
Ga0307292_104767933	3300028811	Soil	GAASTAALLAGKIAHEQGERVALVVSGGNVAPETASAILASR
Ga0311349_106646881	3300030294	Fen	AGVYKPKPGSTVIAVVSGGNVAPRTASGILDPDEG
Ga0247826_105113811	3300030336	Soil	TAALLAGRVPGVEGKTVVAVVSGGNVAAQTASAILAPDEA
Ga0311335_113998221	3300030838	Fen	AALLTGAYKPEPGTTVIAVVSGGNVAPHTASGILDPDEG
Ga0308204_101952971	3300031092	Soil	AASVAAILSGKIPLAEEETVVAVVSGGNVSGETAAALLARP
Ga0307497_107444661	3300031226	Soil	GAAAGVGALLAGKVPDVGGKTVAVVVSGGNVAGKTAAAILSSNEA
Ga0307407_116833791	3300031903	Rhizosphere	SAAALLSGRVELERDDVVPAVVSGGNVAPETAAAILARR
Ga0307415_1001142655	3300032126	Rhizosphere	ALLAHKVPLEGARTVVAVVSGGNVAPETASAILARA