| Basic Information | |
|---|---|
| Family ID | F046607 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 151 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRRLSIGVRLTLWYLAIFALAQLVFGAGMWLILRHHL |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.09 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.39 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.338 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.232 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.517 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.682 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF00486 | Trans_reg_C | 86.09 |
| PF13620 | CarboxypepD_reg | 4.64 |
| PF14534 | DUF4440 | 4.64 |
| PF00406 | ADK | 1.32 |
| PF02662 | FlpD | 0.66 |
| PF02535 | Zip | 0.66 |
| PF14905 | OMP_b-brl_3 | 0.66 |
| PF13738 | Pyr_redox_3 | 0.66 |
| PF10282 | Lactonase | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 1.32 |
| COG0428 | Zinc transporter ZupT | Inorganic ion transport and metabolism [P] | 0.66 |
| COG1908 | Coenzyme F420-reducing hydrogenase, delta subunit | Energy production and conversion [C] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.34 % |
| Unclassified | root | N/A | 0.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0465124 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300001593|JGI12635J15846_10628580 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005435|Ga0070714_100919966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 849 | Open in IMG/M |
| 3300005436|Ga0070713_100730417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 946 | Open in IMG/M |
| 3300005439|Ga0070711_101710615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300005454|Ga0066687_10519106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 705 | Open in IMG/M |
| 3300005534|Ga0070735_10048456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2824 | Open in IMG/M |
| 3300005541|Ga0070733_10123236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1667 | Open in IMG/M |
| 3300005542|Ga0070732_10648153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300005554|Ga0066661_10200306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1236 | Open in IMG/M |
| 3300005556|Ga0066707_10119355 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300005591|Ga0070761_10029363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3067 | Open in IMG/M |
| 3300005610|Ga0070763_10234865 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300005610|Ga0070763_10486815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 704 | Open in IMG/M |
| 3300005888|Ga0075289_1008095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1380 | Open in IMG/M |
| 3300006052|Ga0075029_100498031 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300006052|Ga0075029_100719670 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300006052|Ga0075029_100721939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 673 | Open in IMG/M |
| 3300006102|Ga0075015_100065473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1757 | Open in IMG/M |
| 3300006102|Ga0075015_101026614 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006172|Ga0075018_10150978 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300006804|Ga0079221_11797023 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006893|Ga0073928_10086582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2667 | Open in IMG/M |
| 3300009548|Ga0116107_1139422 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300009624|Ga0116105_1109314 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300010376|Ga0126381_105022493 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010379|Ga0136449_103122767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300010379|Ga0136449_104155752 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012202|Ga0137363_11034053 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012357|Ga0137384_10036713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4037 | Open in IMG/M |
| 3300012363|Ga0137390_10436015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1287 | Open in IMG/M |
| 3300012917|Ga0137395_10602642 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300012918|Ga0137396_10798054 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300012924|Ga0137413_10274003 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300012925|Ga0137419_11364280 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012925|Ga0137419_11798810 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012958|Ga0164299_11577622 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300013100|Ga0157373_11223111 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300014155|Ga0181524_10074330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2006 | Open in IMG/M |
| 3300014165|Ga0181523_10134869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1462 | Open in IMG/M |
| 3300014165|Ga0181523_10166506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1289 | Open in IMG/M |
| 3300015242|Ga0137412_10486190 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300016294|Ga0182041_10536189 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300016294|Ga0182041_11028971 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300016371|Ga0182034_10620473 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300016371|Ga0182034_11572210 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300016404|Ga0182037_10629528 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300016445|Ga0182038_11242401 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300016750|Ga0181505_10999645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3550 | Open in IMG/M |
| 3300017930|Ga0187825_10087465 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300017933|Ga0187801_10497763 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300017940|Ga0187853_10069106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1779 | Open in IMG/M |
| 3300017959|Ga0187779_10207558 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300017961|Ga0187778_10457170 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300017973|Ga0187780_11056792 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300017974|Ga0187777_11396527 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300017975|Ga0187782_10078543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2415 | Open in IMG/M |
| 3300017993|Ga0187823_10325497 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300017998|Ga0187870_1282703 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300018006|Ga0187804_10466410 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300018030|Ga0187869_10402288 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300018044|Ga0187890_10457987 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300018058|Ga0187766_11246675 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300018060|Ga0187765_10971370 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300018085|Ga0187772_10540910 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300018088|Ga0187771_10443239 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300018088|Ga0187771_10638401 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300018431|Ga0066655_10253985 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300019240|Ga0181510_1145273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300019240|Ga0181510_1463366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300019260|Ga0181506_1386367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300019278|Ga0187800_1387157 | All Organisms → cellular organisms → Bacteria | 10654 | Open in IMG/M |
| 3300020580|Ga0210403_10233952 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300020580|Ga0210403_10295045 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300021088|Ga0210404_10276010 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300021180|Ga0210396_10143755 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
| 3300021401|Ga0210393_10138127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1955 | Open in IMG/M |
| 3300021401|Ga0210393_10750510 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300021407|Ga0210383_11387060 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300021475|Ga0210392_10228920 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300021478|Ga0210402_11599655 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300021479|Ga0210410_10494610 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300021479|Ga0210410_11330306 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300021479|Ga0210410_11382056 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300022532|Ga0242655_10093879 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300022731|Ga0224563_1001473 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300025442|Ga0208034_1070101 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300025914|Ga0207671_11418654 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300025915|Ga0207693_11488877 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300025922|Ga0207646_10920416 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300025929|Ga0207664_10821453 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300025939|Ga0207665_10129897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1787 | Open in IMG/M |
| 3300026308|Ga0209265_1026382 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300026309|Ga0209055_1046979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1880 | Open in IMG/M |
| 3300026498|Ga0257156_1095165 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300026499|Ga0257181_1025750 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300026529|Ga0209806_1295387 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300026984|Ga0208732_1027724 | Not Available | 526 | Open in IMG/M |
| 3300027061|Ga0209729_1052034 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300027497|Ga0208199_1119405 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300027505|Ga0209218_1013420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1457 | Open in IMG/M |
| 3300027619|Ga0209330_1025314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1341 | Open in IMG/M |
| 3300027674|Ga0209118_1174097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300027703|Ga0207862_1177635 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300027855|Ga0209693_10060527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1864 | Open in IMG/M |
| 3300027855|Ga0209693_10238550 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300027869|Ga0209579_10610824 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300027884|Ga0209275_10102481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1467 | Open in IMG/M |
| 3300027894|Ga0209068_10957679 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300027898|Ga0209067_10273115 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300027903|Ga0209488_10281397 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300027911|Ga0209698_10100572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2421 | Open in IMG/M |
| 3300027911|Ga0209698_10232847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1477 | Open in IMG/M |
| 3300027915|Ga0209069_11015929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300027986|Ga0209168_10298356 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300028560|Ga0302144_10160516 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300028769|Ga0302213_1205363 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300030013|Ga0302178_10386695 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300030339|Ga0311360_11332007 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300030503|Ga0311370_10131802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3474 | Open in IMG/M |
| 3300030738|Ga0265462_11851374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300030738|Ga0265462_11885560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300030740|Ga0265460_12430819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300030838|Ga0311335_10255770 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300031231|Ga0170824_126767527 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031250|Ga0265331_10161243 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300031474|Ga0170818_104530149 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031474|Ga0170818_112371174 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300031564|Ga0318573_10533207 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300031715|Ga0307476_10187687 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300031718|Ga0307474_10638184 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300031736|Ga0318501_10011924 | All Organisms → cellular organisms → Bacteria | 3398 | Open in IMG/M |
| 3300031753|Ga0307477_10654614 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300031754|Ga0307475_10663065 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300031754|Ga0307475_11393190 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300031792|Ga0318529_10616578 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031823|Ga0307478_10647204 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300031897|Ga0318520_10571087 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300031910|Ga0306923_10308808 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300031954|Ga0306926_10390141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1719 | Open in IMG/M |
| 3300032076|Ga0306924_10775655 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300032076|Ga0306924_11292659 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300032174|Ga0307470_10533753 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300032174|Ga0307470_11260080 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300032783|Ga0335079_10073713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3886 | Open in IMG/M |
| 3300032805|Ga0335078_11242454 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300032828|Ga0335080_11390265 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300032893|Ga0335069_11461932 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300033289|Ga0310914_11828147 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300033807|Ga0314866_068742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300033887|Ga0334790_212812 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.23% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.62% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.30% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.31% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.99% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.99% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.32% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.32% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.32% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.32% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.66% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.66% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028769 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_1 | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_04651241 | 2228664022 | Soil | VKRLSIGLRLTLWYLSIFALAQLVFGIGMWLILRE |
| JGI12635J15846_106285802 | 3300001593 | Forest Soil | VKRLSIGLRLTLWYLAIFLLAELIFGVGMWFILRQNMYDIADQAL |
| Ga0070714_1009199662 | 3300005435 | Agricultural Soil | MKRLSIGVRLTLWYLVIFAVGEVVFGVGMWFILRDSVLDMVDDDIETQVDDLSHLL |
| Ga0070713_1007304172 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLSIGVRLTLWYLVIFALGEVVFGVGMWFILRDSVLDM |
| Ga0070711_1017106152 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRLSIGVRLTVWYLAIFALGELVFGAGMWFILRDNLLDIVDDGLESQVD |
| Ga0066687_105191062 | 3300005454 | Soil | MKRLSIGMRLTLWYLVIFALGELVFGLGMWLILRDSVFDMVDD |
| Ga0070735_100484563 | 3300005534 | Surface Soil | MKKLSIGLRLTIWYLAIFALGELVFGAGMWFILRESLFD |
| Ga0070733_101232361 | 3300005541 | Surface Soil | MRKLSIGLRLTVWYVAIFAVAQLIFGAGMWFMLRYRLY |
| Ga0070732_106481532 | 3300005542 | Surface Soil | MKKFSIGVRLTVWYLAIFAVAQLAFGAGMWFILREHLYDLVDDGL |
| Ga0066661_102003062 | 3300005554 | Soil | MTKLSIGMRLTLWYLAIFAGAQLIFGAGMWFVLRHH |
| Ga0066707_101193553 | 3300005556 | Soil | MRLTLWYLAIFALAQLVFGAGMWLVLRHHLYDLVDDNLE |
| Ga0070761_100293633 | 3300005591 | Soil | MRRPSIGVRLTLWYLAIFAIAQFVFGVGMWLILRH |
| Ga0070763_102348653 | 3300005610 | Soil | MTRLSIGWRLTLWYLAIFALGQFAFGAGIWLVLRHHLV |
| Ga0070763_104868151 | 3300005610 | Soil | MKTSMRRLSIGLRLTLWYLAIFAVAQLVFGAGMWLIL |
| Ga0075289_10080951 | 3300005888 | Rice Paddy Soil | MRRLSIGLRLSLWYVAIFALGELVFGVGMWLILRDSVLDMVDDDLETQ |
| Ga0075029_1004980312 | 3300006052 | Watersheds | MRKLSIGVRLTLWYLAIFALAQFVFGVGMWLLLRNHL |
| Ga0075029_1007196701 | 3300006052 | Watersheds | MRRLSIGVRLTLWYVTIFAVGELVFGASMFIILRHNLYDLVDDGVES |
| Ga0075029_1007219391 | 3300006052 | Watersheds | MRRLSIGMRLTLWYVTIFAVGELVFGASMFIILRHNLYDLVDDGVES |
| Ga0075015_1000654733 | 3300006102 | Watersheds | MKRLSIGVRLMLWYLAVFALGELFFGASMWFILRNNLYDL |
| Ga0075015_1010266141 | 3300006102 | Watersheds | MRRLSIGMRLTLWYVAIFAVGELIFGASMFLILRHNLY |
| Ga0075018_101509781 | 3300006172 | Watersheds | MKKGLSIGLRLTLSYLMIFAVAQLIFGLGMWFILRH |
| Ga0079221_117970231 | 3300006804 | Agricultural Soil | MRRLSIGVRLTLWYLAIFALAQLVFGAGMWLILRHHL |
| Ga0073928_100865821 | 3300006893 | Iron-Sulfur Acid Spring | MRRLSIGVRLTLWYLAIFAFAQLVFGTGMWFVLRHHLYGLIDDGLVGQVEDL |
| Ga0116107_11394222 | 3300009548 | Peatland | LKRLSIGMRLALWYLAIFLLAEFVFGAGMWFILRKNLYDIA |
| Ga0116105_11093141 | 3300009624 | Peatland | MKRLSIGVRLMLWYVAIFALGELAFGAGMWFILRQNLYDLVDDGIESQVDDLKS |
| Ga0126381_1050224931 | 3300010376 | Tropical Forest Soil | MKHVSIRLRLTLWYLAVFALGELIFGAGMWLILRHNVY |
| Ga0136449_1031227671 | 3300010379 | Peatlands Soil | MKKLSIGVRLTLWYLAIFAVAQLVFAAGMWFLLLSHLYDLVDDGLESQVED |
| Ga0136449_1041557522 | 3300010379 | Peatlands Soil | VRKLSIGFRLTIGYMALFAAAQLFFGAGMWLLLRRSLYDI |
| Ga0137363_110340532 | 3300012202 | Vadose Zone Soil | VKWLSIRLRLTLWYFAIFLLAELIFGAGMWLILRENLFDIA |
| Ga0137384_100367135 | 3300012357 | Vadose Zone Soil | MKRLSIGVRLTLWYLAIFALAQIVFGAGMWFILRQ |
| Ga0137390_104360151 | 3300012363 | Vadose Zone Soil | VKKLSIGLRLTLWYLVIFLFAEVIFGVGMWLILRQNLL |
| Ga0137395_106026421 | 3300012917 | Vadose Zone Soil | VKWLSIRLRLSLWYFAIFLLAELIFGAGMWLILRENLFDIADIALDG |
| Ga0137396_107980542 | 3300012918 | Vadose Zone Soil | MKRLSIGMRLTLWYLGVFALAQLVIGVGMWFILRENLHDV |
| Ga0137413_102740031 | 3300012924 | Vadose Zone Soil | MKRLSIGTRLTLSYLLIFAAAQLIFGVGMWIILRHKL |
| Ga0137419_113642802 | 3300012925 | Vadose Zone Soil | VKRLSIGLRLTLWYLAIFLLAEFIFGAGMWVILRQNLFDIADLA |
| Ga0137419_117988102 | 3300012925 | Vadose Zone Soil | VSLPKLSIGLRLSLWYVLIFALAQCVFGAGMYVVLR |
| Ga0164299_115776221 | 3300012958 | Soil | MKKLSIGFRLTLWYLAIFALGELVFGAGMWFILREN |
| Ga0157373_112231112 | 3300013100 | Corn Rhizosphere | MKRLSIGVRLTLWYLVIFALGEVVFGVGMWFILRDSVLDMV |
| Ga0181524_100743301 | 3300014155 | Bog | LKRLSIGMRLALWYLAIFLLAEFVFGAGMWFILRKNLYDIADAT |
| Ga0181523_101348693 | 3300014165 | Bog | MKKLSIGVRLTLWYLAIFAAAECLFSVGMWLALRQDLYGIA |
| Ga0181523_101665063 | 3300014165 | Bog | VKRVSIGMRLTLWYLAVFLLAEFILGAGMWLILRKNLND |
| Ga0137412_104861902 | 3300015242 | Vadose Zone Soil | MKRLSIGTRLTLSYLLIFAAAQLIFGVGMWIILRQNL |
| Ga0182041_105361892 | 3300016294 | Soil | MSMRRLPIGVRLTLWYVAIFATAQVVFGGLMYVTLRHYLYEI |
| Ga0182041_110289711 | 3300016294 | Soil | MKRLSIGVRLTLWYVAIFALGEFVFGASMWLILRHNI |
| Ga0182034_106204731 | 3300016371 | Soil | MRRLSIGLRLTLWYLTIFALAQLAFGAGMWFLLRHHLYDLVDNGLKG |
| Ga0182034_115722102 | 3300016371 | Soil | MRRLSIGVRLTLWYLAIFALGELIFGAGMWFILRHNL |
| Ga0182037_106295282 | 3300016404 | Soil | VKRLSIGSRLTLWYLGIFALAQLLFGVGMWFILRKNLHDVADA |
| Ga0182038_112424011 | 3300016445 | Soil | MKRLSIGVRLTLWYVAIFTLGELLFAAGTWMILRHSLFDLIDDN |
| Ga0181505_109996451 | 3300016750 | Peatland | MKRLSIGLRLTLWYLAIFAAAQLFFGVGMWLVLRQ |
| Ga0187825_100874652 | 3300017930 | Freshwater Sediment | MKRLSIGLRLTLWYLGIFALAELLFGVGMWFILREN |
| Ga0187801_104977632 | 3300017933 | Freshwater Sediment | MKRLSIGFRLTLWYLAIFAAAQLCFGVGMWLVLRHDL |
| Ga0187853_100691063 | 3300017940 | Peatland | VKRVSLGMRLTLWYLAVFLLAEFIFGAGMWLILRKNLTD |
| Ga0187779_102075583 | 3300017959 | Tropical Peatland | MRRLSIGLRLTVWYLAIFALAQVAFGAGMWFLLRHHLY |
| Ga0187778_104571702 | 3300017961 | Tropical Peatland | MRKPSIGVRLTLWYLLIFAGAQVVFGFGMWFILRQNLY |
| Ga0187780_110567921 | 3300017973 | Tropical Peatland | MRKLSIGMRLTLWYLAIFAVAQLVFAAAMWFMLREHL |
| Ga0187777_113965272 | 3300017974 | Tropical Peatland | MKKLSIGVRLMLWYVAIFALGELLFGASMFFILRNNLYDLVDDQIESQVEDLKTFL |
| Ga0187782_100785433 | 3300017975 | Tropical Peatland | MKKLSIGVRLTLWYLAIFALGEFVFGAGMWLILRHSI |
| Ga0187823_103254972 | 3300017993 | Freshwater Sediment | MKKLSIGVRLTIWYLAIFALGEFVFGAGMWIILRHNLLDIVDDSLE |
| Ga0187870_12827032 | 3300017998 | Peatland | MRRLSIGFRLTLWYLAIFAAAQLFFGVGMWLVLRQDLY |
| Ga0187804_104664101 | 3300018006 | Freshwater Sediment | MRRLSIGVRLTIWYVTIFAFAQLVFGIGMWVVLRHYLYDLADDD |
| Ga0187869_104022881 | 3300018030 | Peatland | VKRLSIGMRLALWYLAIFLLAEFIFGAGMWLILRKNLNDIADAAL |
| Ga0187890_104579872 | 3300018044 | Peatland | MKRLSIGVRLMLWYLAIFALGELVFGAGMWFILRQNLYDLVD |
| Ga0187766_112466752 | 3300018058 | Tropical Peatland | MKRLSIGLRLTLWYLAIFTVAQVVFASGMWLSLRHHLYAIVDDNLRDE |
| Ga0187765_109713702 | 3300018060 | Tropical Peatland | MKKLSIGVRLMLWYVAIFALGELLFGASMFFILRNNLYDLVDDQI |
| Ga0187772_105409101 | 3300018085 | Tropical Peatland | MKKLSIGMRLTLWSLAIFVVAQIIFGAGLWFLLQH |
| Ga0187771_104432391 | 3300018088 | Tropical Peatland | VKKLSIGLRLTLWYLAIFLLAELAFGAGMWLILRKNLYDI |
| Ga0187771_106384012 | 3300018088 | Tropical Peatland | MKRFSIGVRLTLWYLAIFTVAQVIFGAGMWFLLRHHLYD |
| Ga0066655_102539851 | 3300018431 | Grasslands Soil | MMGLRRFSIGSRLTLWYLAIFAVAQLIFGAGMWFI |
| Ga0181510_11452732 | 3300019240 | Peatland | VAKGLSIGLRLTLLYLALFLLAQIIIGEGMWLVLRQNLFTTADTAL |
| Ga0181510_14633662 | 3300019240 | Peatland | VKKLSIGLRLMLLYLAVFLIAEAILGAGLWIVIRQNLFAIADTAL |
| Ga0181506_13863671 | 3300019260 | Peatland | VKKLSIGLRLMLLYLAVFLIAEAILGAGLWIVIRQNLFAIADTALDGQAA |
| Ga0187800_138715710 | 3300019278 | Peatland | VKRLSIGMRLTLWYLAIFLLAEFVFGAGMWLILRKNLYDI |
| Ga0210403_102339523 | 3300020580 | Soil | MRRLSIGLRLTLWYLAIFAFAQLVFGAGMWFILRHNLYDLVDDGLESQ |
| Ga0210403_102950453 | 3300020580 | Soil | MTRLSIGWRLTLWYLAIFALGQFAFGAGIWLVLRHHLVG |
| Ga0210404_102760102 | 3300021088 | Soil | MRRLSIGLRLTLWYLAIFAFAQLVFGAGMWFILRHNLYDLVDDGLES |
| Ga0210396_101437553 | 3300021180 | Soil | VKKLSIGMRLTLWYFAIFLLAEFVFGAGMWLILRKNL |
| Ga0210393_101381273 | 3300021401 | Soil | MTRLSIGWRLTVWYLAIFAVGQFAFGAGMWLVLRHHLISLVDENL |
| Ga0210393_107505102 | 3300021401 | Soil | MRRLPIGVRLTLWYVAIFATAQIVFGGLMWVTLRHH |
| Ga0210383_113870601 | 3300021407 | Soil | MSRLSIGVRLTLWYLAIFAFAQLVFGTGMWFVLRHHLYGLIDDG |
| Ga0210392_102289203 | 3300021475 | Soil | MRKLSIGLRLTLWYLAIFLLAELIFGAGMWFILRQNLYDI |
| Ga0210402_115996551 | 3300021478 | Soil | VKKLSIGLRLTLWYLAIFFLAELIFGAGMWLILRQNLFDIA |
| Ga0210410_104946103 | 3300021479 | Soil | MKRISQLSIGMRLALSYLAIFLLAELVFGAGMWLILRKNLYDI |
| Ga0210410_113303061 | 3300021479 | Soil | MRKLSIGVRLTLWYLLFFAVAQLFFGAGMWWILHDNIYDLVDD |
| Ga0210410_113820562 | 3300021479 | Soil | MSRLSIGVRLTLWYLAIFAFAQLVFGTGMWFVLRHH |
| Ga0242655_100938791 | 3300022532 | Soil | MQRLSIGLRLTLWYLAIFALAQLIFGVGMWFILRKNLHDVA |
| Ga0224563_10014733 | 3300022731 | Soil | MTRLSIGWRLTLWYLAIFALGQFAFGAGIWLVLRHHLVGLVDKNL |
| Ga0208034_10701012 | 3300025442 | Peatland | LKRLSIGMRLTLWYLAIFLLAEFVFGAGMWFILRKNLYDIADATLEG |
| Ga0207671_114186541 | 3300025914 | Corn Rhizosphere | MKRLSIGARLTLWYLVIFALSEAVFGVGMWFILRDSV |
| Ga0207693_114888771 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VKRLSIGLRLTAWYLAIFAVAQLIFGVGMWFILRQNLHDIADTT |
| Ga0207646_109204161 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VKKLSIGLRLTLWYLVIFLLAEVIFGVGMWLILRQNLLDIADT |
| Ga0207664_108214531 | 3300025929 | Agricultural Soil | MRKLSIGVRLTLWYVAIFAVGELVFGASMFFILRHNLYD |
| Ga0207665_101298971 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRLSIGVRLTLWYVAIFAVGELVFGASMFLILRHNLYDLV |
| Ga0209265_10263821 | 3300026308 | Soil | MKRLSIGVRLTLWYLVIFAVGEVVFGVGMWFILRDSVLDMVDDD |
| Ga0209055_10469794 | 3300026309 | Soil | MTKLSIGMRLTLWYLAIFAGAQLIFGAGMWFVLRHHVYD |
| Ga0257156_10951652 | 3300026498 | Soil | VKWLSIRLRLTLWYFAIFLLAELIFGAGMWLILRENLF |
| Ga0257181_10257501 | 3300026499 | Soil | MRKLSIGMRLTLWYLAIFALAQLVFGAGMWLVLRHHLYDLV |
| Ga0209806_12953872 | 3300026529 | Soil | MTKLSIGMRLTLWYLAIFAGAQLIFGAGMWFVLRHHVYDLVDDGLESQVEDLESFL |
| Ga0208732_10277241 | 3300026984 | Forest Soil | MRKLSIGVRLTLWYVAIFAVGELLFGASMFLILRHNLYDLVDDGLESQIEDL |
| Ga0209729_10520341 | 3300027061 | Forest Soil | MKGLSIGVRLTLWYVAIFTLGELVFATGTWMILRHSLFDLIDDNLES |
| Ga0208199_11194052 | 3300027497 | Peatlands Soil | MKRLSIGLRLTLWYLAIFFVGELIFGTGMWFILRKNLYDIADA |
| Ga0209218_10134203 | 3300027505 | Forest Soil | VTRLSIGWRLTLWYLAIFALGQFAFGAGMWLVLRHHLVSLIDKNLQDQAAD |
| Ga0209330_10253141 | 3300027619 | Forest Soil | VRRFSIGLRLTLWYLAIFAVAQIAFGAGMWVMLRHHLYDLV |
| Ga0209118_11740972 | 3300027674 | Forest Soil | MGTHEKTGMRRLSIGVRLTLWYLVFFAVAQLIFGIGMWLILRHNIYDLVDDSLE |
| Ga0207862_11776352 | 3300027703 | Tropical Forest Soil | MSRLSIGVRLTLWYVAIFAVAQVVFGTVMWVSLRHHLYSIVDDSL |
| Ga0209693_100605273 | 3300027855 | Soil | MTRLSIGWRLTLWYLAIFALGQFAFGAGIWLVLRHHLVGLVDKN |
| Ga0209693_102385501 | 3300027855 | Soil | MRRLSIGVRLTLWYLAIFALAQIVFGVGMWLILRHHLY |
| Ga0209579_106108242 | 3300027869 | Surface Soil | MRKLSIGVRLTVWYLAIFALAQFVFGIGMWLLLRHKLYDVSNDNLESQVEDLQ |
| Ga0209275_101024813 | 3300027884 | Soil | MKKLSIGVRLALWYVAIFALGELIFGASMWVILRENLYDLVDDSLENQVEDLRNFL |
| Ga0209068_109576792 | 3300027894 | Watersheds | VTRLSIGFRLTIWYLTVFALAQLAFGLGMWLILRENLREVTRTALAG |
| Ga0209067_102731152 | 3300027898 | Watersheds | MKKFSIGVRLTLWYLAIFAVAQIAFGAGMWFILHEHLYDLVD |
| Ga0209488_102813973 | 3300027903 | Vadose Zone Soil | VKWLSIRLRLTLWYFAIFLLAELIFGAGMWLILRQNLFDIADIAL |
| Ga0209698_101005723 | 3300027911 | Watersheds | MRRLSIGMRLTLWYVTIFAVGELVFGASMFIILRHNLYDL |
| Ga0209698_102328473 | 3300027911 | Watersheds | MRRLSIGVRLTLWYVTIFAVGELVFGASMFIILRHNLYDL |
| Ga0209069_110159291 | 3300027915 | Watersheds | MKSLSIGLRLTLSYLLVFAAAQFLFGLGMWMILRHNLYQ |
| Ga0209168_102983562 | 3300027986 | Surface Soil | MKRPSIGVRLALWYLAFFALAQFVFGVGMWVILRHNL |
| Ga0302144_101605162 | 3300028560 | Bog | MKKLSIGLRLTLWYLAIFAAAQVLFGVAMWLVLRRDLYRI |
| Ga0302213_12053632 | 3300028769 | Fen | MRKLSIGWRLTLWYVAIFALAQLVFGVGMWVLLRH |
| Ga0302178_103866951 | 3300030013 | Palsa | MKKLSIGMRLTLWYLAIFLLAEFVFGAGMWLILRKNLYD |
| Ga0311360_113320071 | 3300030339 | Bog | VTRLSIGLRLTLWYLVIFALGQFVFGAGMWLVLRHHLVSLVDDNLRDQTEDLR |
| Ga0311370_101318028 | 3300030503 | Palsa | MKKLSIGMRLTLWYLAIFLLAEFVFGAGMWLILRKNLYDI |
| Ga0265462_118513742 | 3300030738 | Soil | VKKLSIGLRLTLLYLGLFLLVQIIVGEGMWLVLRQN |
| Ga0265462_118855602 | 3300030738 | Soil | MKISIGLRLTLLYLAIFLLAQVILGGGMWLENKKKKK |
| Ga0265460_124308191 | 3300030740 | Soil | VNKLSIGLRLMLLYLAIFLFAQVILGAGMWLVLRQNLFAIA |
| Ga0311335_102557702 | 3300030838 | Fen | MRKLSIGWRLTLWYVAIFAMAQLVFGVGMWVLLRHYL |
| Ga0170824_1267675271 | 3300031231 | Forest Soil | MRKLSIGVRLTLWYLAIFALGQVIFGAGMWLILRHNLYDLVD |
| Ga0265331_101612431 | 3300031250 | Rhizosphere | MRRLSIGVRLTLWYLAIFALAQILFGAGMWFILRHNL |
| Ga0170818_1045301492 | 3300031474 | Forest Soil | MKSLSIGSRLTLSYLIIFAVAQLVFGLGMWFILRH |
| Ga0170818_1123711742 | 3300031474 | Forest Soil | MRRLSIGVRLTLWYLAIFALAQIVFGAGMWFILRH |
| Ga0318573_105332072 | 3300031564 | Soil | VKRLSIGFRLTLWYLAIFALAQGLFGVGMWFILRENLHDIAD |
| Ga0307476_101876871 | 3300031715 | Hardwood Forest Soil | MQRLSIGLRLTLWYLAIFALAQLIFGVGMWFILRKNLHDV |
| Ga0307474_106381842 | 3300031718 | Hardwood Forest Soil | VKKLSIGTRLTLWYFAIFLLAEFVFGAGMWLILRKNLLDIADEVLEGQ |
| Ga0318501_100119244 | 3300031736 | Soil | VKRLSIGFRLTLWYLAIFALAQGLFGVGMWFILRENLHDIADHV |
| Ga0307477_106546142 | 3300031753 | Hardwood Forest Soil | VKKLSIGMRLTLWYFAIFLLAEFVFGAGMWLILRKNLLDIADEVLEG |
| Ga0307475_106630652 | 3300031754 | Hardwood Forest Soil | VKRLSIGSRLTLWYLAIFLLAELIFGAGMWFILRKNLYDIADQALK |
| Ga0307475_113931902 | 3300031754 | Hardwood Forest Soil | VKKLSIGLRLTLWYLAIFFVAELIFGAGMWLILRQNLFDLADAALEDQAA |
| Ga0318529_106165781 | 3300031792 | Soil | MRRLSIGLRLTLWYLTIFALAQLAFGAGMWFLLRHHLYDLVDNGLKGQIED |
| Ga0307478_106472042 | 3300031823 | Hardwood Forest Soil | VTKLSIGMRLTLWYFAIFLLAEFVFGAGMWLILRKNLLDIADEVLEGQA |
| Ga0318520_105710872 | 3300031897 | Soil | MSMRRLPIGVRLTLWYVAIFATAQVVFGGLMYVTLRHYL |
| Ga0306923_103088084 | 3300031910 | Soil | MKKLSIGFRLTLWYLAIFALGQLVFGAGMWFILREN |
| Ga0306926_103901413 | 3300031954 | Soil | MRRLSIGVRLTLWYLAIFALGELIFGAGMWFILRHNLYDIVDDGLE |
| Ga0306924_107756551 | 3300032076 | Soil | VKRLSIGSRLTLWYLGIFALAQLLFGVGMWFILRKNLHDVADAA |
| Ga0306924_112926592 | 3300032076 | Soil | MSMRRLPIGVRLTLWYVAIFATAQVVFGGLMYVTLRHYLYEIV |
| Ga0307470_105337532 | 3300032174 | Hardwood Forest Soil | MRKLSIGVRLTLWYVAIFALGEFVFGAGMWFILRHNLYDLADDSLENQSD |
| Ga0307470_112600802 | 3300032174 | Hardwood Forest Soil | LRRLSIGLRLTLWYVAVFAVAQLVFGAGMYLILRQSLYSITDDALHEQI |
| Ga0335079_100737131 | 3300032783 | Soil | MKRLSIGMRLTVWYLAIFALGQIVFGAGMWFILRNN |
| Ga0335078_112424542 | 3300032805 | Soil | MKKLSIGMRLTFWYLAIFALAQIVFGLGMWLILRGYLYDLADDSLESQVEDL |
| Ga0335080_113902652 | 3300032828 | Soil | MKKLSIGFRLTLWYLAIFALGELVFGAGMWFSLRENVLD |
| Ga0335069_114619321 | 3300032893 | Soil | MVKALSIGTRLTLWYAAIFALSELIFGAGMWFVLRQELYSIADDSLRA |
| Ga0310914_118281472 | 3300033289 | Soil | MRRLSIGVRLTLWYVAIFALGELVFGASMWLILRH |
| Ga0314866_068742_495_602 | 3300033807 | Peatland | MKKLSIGLRLTLWYLAIFAAAQLLFGLGMWFILRQN |
| Ga0334790_212812_2_133 | 3300033887 | Soil | MRRLSIGVRLTLWYLAIFALAQILFGAGMWFILRHNLYDLVDDG |
| ⦗Top⦘ |