NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046607

Metagenome / Metatranscriptome Family F046607

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046607
Family Type Metagenome / Metatranscriptome
Number of Sequences 151
Average Sequence Length 42 residues
Representative Sequence MRRLSIGVRLTLWYLAIFALAQLVFGAGMWLILRHHL
Number of Associated Samples 129
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.09 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.39 %
Associated GOLD sequencing projects 120
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.338 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.232 % of family members)
Environment Ontology (ENVO) Unclassified
(22.517 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.682 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 47.69%    β-sheet: 0.00%    Coil/Unstructured: 52.31%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF00486Trans_reg_C 86.09
PF13620CarboxypepD_reg 4.64
PF14534DUF4440 4.64
PF00406ADK 1.32
PF02662FlpD 0.66
PF02535Zip 0.66
PF14905OMP_b-brl_3 0.66
PF13738Pyr_redox_3 0.66
PF10282Lactonase 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 1.32
COG0428Zinc transporter ZupTInorganic ion transport and metabolism [P] 0.66
COG1908Coenzyme F420-reducing hydrogenase, delta subunitEnergy production and conversion [C] 0.66

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.34 %
UnclassifiedrootN/A0.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c0465124All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300001593|JGI12635J15846_10628580All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005435|Ga0070714_100919966All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter849Open in IMG/M
3300005436|Ga0070713_100730417All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter946Open in IMG/M
3300005439|Ga0070711_101710615All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300005454|Ga0066687_10519106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae705Open in IMG/M
3300005534|Ga0070735_10048456All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2824Open in IMG/M
3300005541|Ga0070733_10123236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1667Open in IMG/M
3300005542|Ga0070732_10648153All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300005554|Ga0066661_10200306All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1236Open in IMG/M
3300005556|Ga0066707_10119355All Organisms → cellular organisms → Bacteria1642Open in IMG/M
3300005591|Ga0070761_10029363All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3067Open in IMG/M
3300005610|Ga0070763_10234865All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300005610|Ga0070763_10486815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter704Open in IMG/M
3300005888|Ga0075289_1008095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1380Open in IMG/M
3300006052|Ga0075029_100498031All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300006052|Ga0075029_100719670All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300006052|Ga0075029_100721939All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia673Open in IMG/M
3300006102|Ga0075015_100065473All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1757Open in IMG/M
3300006102|Ga0075015_101026614All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300006172|Ga0075018_10150978All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300006804|Ga0079221_11797023All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300006893|Ga0073928_10086582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2667Open in IMG/M
3300009548|Ga0116107_1139422All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300009624|Ga0116105_1109314All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300010376|Ga0126381_105022493All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300010379|Ga0136449_103122767All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300010379|Ga0136449_104155752All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300012202|Ga0137363_11034053All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300012357|Ga0137384_10036713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4037Open in IMG/M
3300012363|Ga0137390_10436015All Organisms → cellular organisms → Bacteria → Acidobacteria1287Open in IMG/M
3300012917|Ga0137395_10602642All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300012918|Ga0137396_10798054All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300012924|Ga0137413_10274003All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300012925|Ga0137419_11364280All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300012925|Ga0137419_11798810All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300012958|Ga0164299_11577622All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300013100|Ga0157373_11223111All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300014155|Ga0181524_10074330All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2006Open in IMG/M
3300014165|Ga0181523_10134869All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1462Open in IMG/M
3300014165|Ga0181523_10166506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1289Open in IMG/M
3300015242|Ga0137412_10486190All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300016294|Ga0182041_10536189All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300016294|Ga0182041_11028971All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300016371|Ga0182034_10620473All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300016371|Ga0182034_11572210All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300016404|Ga0182037_10629528All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300016445|Ga0182038_11242401All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300016750|Ga0181505_10999645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3550Open in IMG/M
3300017930|Ga0187825_10087465All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300017933|Ga0187801_10497763All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300017940|Ga0187853_10069106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1779Open in IMG/M
3300017959|Ga0187779_10207558All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300017961|Ga0187778_10457170All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300017973|Ga0187780_11056792All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300017974|Ga0187777_11396527All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300017975|Ga0187782_10078543All Organisms → cellular organisms → Bacteria → Acidobacteria2415Open in IMG/M
3300017993|Ga0187823_10325497All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300017998|Ga0187870_1282703All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300018006|Ga0187804_10466410All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300018030|Ga0187869_10402288All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300018044|Ga0187890_10457987All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300018058|Ga0187766_11246675All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300018060|Ga0187765_10971370All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300018085|Ga0187772_10540910All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300018088|Ga0187771_10443239All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300018088|Ga0187771_10638401All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300018431|Ga0066655_10253985All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300019240|Ga0181510_1145273All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300019240|Ga0181510_1463366All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300019260|Ga0181506_1386367All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300019278|Ga0187800_1387157All Organisms → cellular organisms → Bacteria10654Open in IMG/M
3300020580|Ga0210403_10233952All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300020580|Ga0210403_10295045All Organisms → cellular organisms → Bacteria1328Open in IMG/M
3300021088|Ga0210404_10276010All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300021180|Ga0210396_10143755All Organisms → cellular organisms → Bacteria2145Open in IMG/M
3300021401|Ga0210393_10138127All Organisms → cellular organisms → Bacteria → Acidobacteria1955Open in IMG/M
3300021401|Ga0210393_10750510All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300021407|Ga0210383_11387060All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300021475|Ga0210392_10228920All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300021478|Ga0210402_11599655All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300021479|Ga0210410_10494610All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300021479|Ga0210410_11330306All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300021479|Ga0210410_11382056All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300022532|Ga0242655_10093879All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300022731|Ga0224563_1001473All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300025442|Ga0208034_1070101All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300025914|Ga0207671_11418654All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300025915|Ga0207693_11488877All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300025922|Ga0207646_10920416All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300025929|Ga0207664_10821453All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300025939|Ga0207665_10129897All Organisms → cellular organisms → Bacteria → Acidobacteria1787Open in IMG/M
3300026308|Ga0209265_1026382All Organisms → cellular organisms → Bacteria1799Open in IMG/M
3300026309|Ga0209055_1046979All Organisms → cellular organisms → Bacteria → Acidobacteria1880Open in IMG/M
3300026498|Ga0257156_1095165All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300026499|Ga0257181_1025750All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300026529|Ga0209806_1295387All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300026984|Ga0208732_1027724Not Available526Open in IMG/M
3300027061|Ga0209729_1052034All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300027497|Ga0208199_1119405All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300027505|Ga0209218_1013420All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1457Open in IMG/M
3300027619|Ga0209330_1025314All Organisms → cellular organisms → Bacteria → Acidobacteria1341Open in IMG/M
3300027674|Ga0209118_1174097All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300027703|Ga0207862_1177635All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300027855|Ga0209693_10060527All Organisms → cellular organisms → Bacteria → Acidobacteria1864Open in IMG/M
3300027855|Ga0209693_10238550All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300027869|Ga0209579_10610824All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300027884|Ga0209275_10102481All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1467Open in IMG/M
3300027894|Ga0209068_10957679All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300027898|Ga0209067_10273115All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300027903|Ga0209488_10281397All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300027911|Ga0209698_10100572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2421Open in IMG/M
3300027911|Ga0209698_10232847All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1477Open in IMG/M
3300027915|Ga0209069_11015929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300027986|Ga0209168_10298356All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300028560|Ga0302144_10160516All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300028769|Ga0302213_1205363All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300030013|Ga0302178_10386695All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300030339|Ga0311360_11332007All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300030503|Ga0311370_10131802All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3474Open in IMG/M
3300030738|Ga0265462_11851374All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300030738|Ga0265462_11885560All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300030740|Ga0265460_12430819All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300030838|Ga0311335_10255770All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300031231|Ga0170824_126767527All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300031250|Ga0265331_10161243All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300031474|Ga0170818_104530149All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300031474|Ga0170818_112371174All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300031564|Ga0318573_10533207All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300031715|Ga0307476_10187687All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300031718|Ga0307474_10638184All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300031736|Ga0318501_10011924All Organisms → cellular organisms → Bacteria3398Open in IMG/M
3300031753|Ga0307477_10654614All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300031754|Ga0307475_10663065All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300031754|Ga0307475_11393190All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300031792|Ga0318529_10616578All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300031823|Ga0307478_10647204All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300031897|Ga0318520_10571087All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300031910|Ga0306923_10308808All Organisms → cellular organisms → Bacteria1807Open in IMG/M
3300031954|Ga0306926_10390141All Organisms → cellular organisms → Bacteria → Acidobacteria1719Open in IMG/M
3300032076|Ga0306924_10775655All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300032076|Ga0306924_11292659All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300032174|Ga0307470_10533753All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300032174|Ga0307470_11260080All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300032783|Ga0335079_10073713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3886Open in IMG/M
3300032805|Ga0335078_11242454All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300032828|Ga0335080_11390265All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300032893|Ga0335069_11461932All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300033289|Ga0310914_11828147All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300033807|Ga0314866_068742All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300033887|Ga0334790_212812All Organisms → cellular organisms → Bacteria549Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.23%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds7.28%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.62%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland6.62%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.30%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.64%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.97%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.31%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.31%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.65%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.99%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.99%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.99%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.32%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.32%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.32%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.32%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.32%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.32%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.66%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.66%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.66%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019240Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019260Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022731Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026984Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes)EnvironmentalOpen in IMG/M
3300027061Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028769Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_1EnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_046512412228664022SoilVKRLSIGLRLTLWYLSIFALAQLVFGIGMWLILRE
JGI12635J15846_1062858023300001593Forest SoilVKRLSIGLRLTLWYLAIFLLAELIFGVGMWFILRQNMYDIADQAL
Ga0070714_10091996623300005435Agricultural SoilMKRLSIGVRLTLWYLVIFAVGEVVFGVGMWFILRDSVLDMVDDDIETQVDDLSHLL
Ga0070713_10073041723300005436Corn, Switchgrass And Miscanthus RhizosphereMKRLSIGVRLTLWYLVIFALGEVVFGVGMWFILRDSVLDM
Ga0070711_10171061523300005439Corn, Switchgrass And Miscanthus RhizosphereMRRLSIGVRLTVWYLAIFALGELVFGAGMWFILRDNLLDIVDDGLESQVD
Ga0066687_1051910623300005454SoilMKRLSIGMRLTLWYLVIFALGELVFGLGMWLILRDSVFDMVDD
Ga0070735_1004845633300005534Surface SoilMKKLSIGLRLTIWYLAIFALGELVFGAGMWFILRESLFD
Ga0070733_1012323613300005541Surface SoilMRKLSIGLRLTVWYVAIFAVAQLIFGAGMWFMLRYRLY
Ga0070732_1064815323300005542Surface SoilMKKFSIGVRLTVWYLAIFAVAQLAFGAGMWFILREHLYDLVDDGL
Ga0066661_1020030623300005554SoilMTKLSIGMRLTLWYLAIFAGAQLIFGAGMWFVLRHH
Ga0066707_1011935533300005556SoilMRLTLWYLAIFALAQLVFGAGMWLVLRHHLYDLVDDNLE
Ga0070761_1002936333300005591SoilMRRPSIGVRLTLWYLAIFAIAQFVFGVGMWLILRH
Ga0070763_1023486533300005610SoilMTRLSIGWRLTLWYLAIFALGQFAFGAGIWLVLRHHLV
Ga0070763_1048681513300005610SoilMKTSMRRLSIGLRLTLWYLAIFAVAQLVFGAGMWLIL
Ga0075289_100809513300005888Rice Paddy SoilMRRLSIGLRLSLWYVAIFALGELVFGVGMWLILRDSVLDMVDDDLETQ
Ga0075029_10049803123300006052WatershedsMRKLSIGVRLTLWYLAIFALAQFVFGVGMWLLLRNHL
Ga0075029_10071967013300006052WatershedsMRRLSIGVRLTLWYVTIFAVGELVFGASMFIILRHNLYDLVDDGVES
Ga0075029_10072193913300006052WatershedsMRRLSIGMRLTLWYVTIFAVGELVFGASMFIILRHNLYDLVDDGVES
Ga0075015_10006547333300006102WatershedsMKRLSIGVRLMLWYLAVFALGELFFGASMWFILRNNLYDL
Ga0075015_10102661413300006102WatershedsMRRLSIGMRLTLWYVAIFAVGELIFGASMFLILRHNLY
Ga0075018_1015097813300006172WatershedsMKKGLSIGLRLTLSYLMIFAVAQLIFGLGMWFILRH
Ga0079221_1179702313300006804Agricultural SoilMRRLSIGVRLTLWYLAIFALAQLVFGAGMWLILRHHL
Ga0073928_1008658213300006893Iron-Sulfur Acid SpringMRRLSIGVRLTLWYLAIFAFAQLVFGTGMWFVLRHHLYGLIDDGLVGQVEDL
Ga0116107_113942223300009548PeatlandLKRLSIGMRLALWYLAIFLLAEFVFGAGMWFILRKNLYDIA
Ga0116105_110931413300009624PeatlandMKRLSIGVRLMLWYVAIFALGELAFGAGMWFILRQNLYDLVDDGIESQVDDLKS
Ga0126381_10502249313300010376Tropical Forest SoilMKHVSIRLRLTLWYLAVFALGELIFGAGMWLILRHNVY
Ga0136449_10312276713300010379Peatlands SoilMKKLSIGVRLTLWYLAIFAVAQLVFAAGMWFLLLSHLYDLVDDGLESQVED
Ga0136449_10415575223300010379Peatlands SoilVRKLSIGFRLTIGYMALFAAAQLFFGAGMWLLLRRSLYDI
Ga0137363_1103405323300012202Vadose Zone SoilVKWLSIRLRLTLWYFAIFLLAELIFGAGMWLILRENLFDIA
Ga0137384_1003671353300012357Vadose Zone SoilMKRLSIGVRLTLWYLAIFALAQIVFGAGMWFILRQ
Ga0137390_1043601513300012363Vadose Zone SoilVKKLSIGLRLTLWYLVIFLFAEVIFGVGMWLILRQNLL
Ga0137395_1060264213300012917Vadose Zone SoilVKWLSIRLRLSLWYFAIFLLAELIFGAGMWLILRENLFDIADIALDG
Ga0137396_1079805423300012918Vadose Zone SoilMKRLSIGMRLTLWYLGVFALAQLVIGVGMWFILRENLHDV
Ga0137413_1027400313300012924Vadose Zone SoilMKRLSIGTRLTLSYLLIFAAAQLIFGVGMWIILRHKL
Ga0137419_1136428023300012925Vadose Zone SoilVKRLSIGLRLTLWYLAIFLLAEFIFGAGMWVILRQNLFDIADLA
Ga0137419_1179881023300012925Vadose Zone SoilVSLPKLSIGLRLSLWYVLIFALAQCVFGAGMYVVLR
Ga0164299_1157762213300012958SoilMKKLSIGFRLTLWYLAIFALGELVFGAGMWFILREN
Ga0157373_1122311123300013100Corn RhizosphereMKRLSIGVRLTLWYLVIFALGEVVFGVGMWFILRDSVLDMV
Ga0181524_1007433013300014155BogLKRLSIGMRLALWYLAIFLLAEFVFGAGMWFILRKNLYDIADAT
Ga0181523_1013486933300014165BogMKKLSIGVRLTLWYLAIFAAAECLFSVGMWLALRQDLYGIA
Ga0181523_1016650633300014165BogVKRVSIGMRLTLWYLAVFLLAEFILGAGMWLILRKNLND
Ga0137412_1048619023300015242Vadose Zone SoilMKRLSIGTRLTLSYLLIFAAAQLIFGVGMWIILRQNL
Ga0182041_1053618923300016294SoilMSMRRLPIGVRLTLWYVAIFATAQVVFGGLMYVTLRHYLYEI
Ga0182041_1102897113300016294SoilMKRLSIGVRLTLWYVAIFALGEFVFGASMWLILRHNI
Ga0182034_1062047313300016371SoilMRRLSIGLRLTLWYLTIFALAQLAFGAGMWFLLRHHLYDLVDNGLKG
Ga0182034_1157221023300016371SoilMRRLSIGVRLTLWYLAIFALGELIFGAGMWFILRHNL
Ga0182037_1062952823300016404SoilVKRLSIGSRLTLWYLGIFALAQLLFGVGMWFILRKNLHDVADA
Ga0182038_1124240113300016445SoilMKRLSIGVRLTLWYVAIFTLGELLFAAGTWMILRHSLFDLIDDN
Ga0181505_1099964513300016750PeatlandMKRLSIGLRLTLWYLAIFAAAQLFFGVGMWLVLRQ
Ga0187825_1008746523300017930Freshwater SedimentMKRLSIGLRLTLWYLGIFALAELLFGVGMWFILREN
Ga0187801_1049776323300017933Freshwater SedimentMKRLSIGFRLTLWYLAIFAAAQLCFGVGMWLVLRHDL
Ga0187853_1006910633300017940PeatlandVKRVSLGMRLTLWYLAVFLLAEFIFGAGMWLILRKNLTD
Ga0187779_1020755833300017959Tropical PeatlandMRRLSIGLRLTVWYLAIFALAQVAFGAGMWFLLRHHLY
Ga0187778_1045717023300017961Tropical PeatlandMRKPSIGVRLTLWYLLIFAGAQVVFGFGMWFILRQNLY
Ga0187780_1105679213300017973Tropical PeatlandMRKLSIGMRLTLWYLAIFAVAQLVFAAAMWFMLREHL
Ga0187777_1139652723300017974Tropical PeatlandMKKLSIGVRLMLWYVAIFALGELLFGASMFFILRNNLYDLVDDQIESQVEDLKTFL
Ga0187782_1007854333300017975Tropical PeatlandMKKLSIGVRLTLWYLAIFALGEFVFGAGMWLILRHSI
Ga0187823_1032549723300017993Freshwater SedimentMKKLSIGVRLTIWYLAIFALGEFVFGAGMWIILRHNLLDIVDDSLE
Ga0187870_128270323300017998PeatlandMRRLSIGFRLTLWYLAIFAAAQLFFGVGMWLVLRQDLY
Ga0187804_1046641013300018006Freshwater SedimentMRRLSIGVRLTIWYVTIFAFAQLVFGIGMWVVLRHYLYDLADDD
Ga0187869_1040228813300018030PeatlandVKRLSIGMRLALWYLAIFLLAEFIFGAGMWLILRKNLNDIADAAL
Ga0187890_1045798723300018044PeatlandMKRLSIGVRLMLWYLAIFALGELVFGAGMWFILRQNLYDLVD
Ga0187766_1124667523300018058Tropical PeatlandMKRLSIGLRLTLWYLAIFTVAQVVFASGMWLSLRHHLYAIVDDNLRDE
Ga0187765_1097137023300018060Tropical PeatlandMKKLSIGVRLMLWYVAIFALGELLFGASMFFILRNNLYDLVDDQI
Ga0187772_1054091013300018085Tropical PeatlandMKKLSIGMRLTLWSLAIFVVAQIIFGAGLWFLLQH
Ga0187771_1044323913300018088Tropical PeatlandVKKLSIGLRLTLWYLAIFLLAELAFGAGMWLILRKNLYDI
Ga0187771_1063840123300018088Tropical PeatlandMKRFSIGVRLTLWYLAIFTVAQVIFGAGMWFLLRHHLYD
Ga0066655_1025398513300018431Grasslands SoilMMGLRRFSIGSRLTLWYLAIFAVAQLIFGAGMWFI
Ga0181510_114527323300019240PeatlandVAKGLSIGLRLTLLYLALFLLAQIIIGEGMWLVLRQNLFTTADTAL
Ga0181510_146336623300019240PeatlandVKKLSIGLRLMLLYLAVFLIAEAILGAGLWIVIRQNLFAIADTAL
Ga0181506_138636713300019260PeatlandVKKLSIGLRLMLLYLAVFLIAEAILGAGLWIVIRQNLFAIADTALDGQAA
Ga0187800_1387157103300019278PeatlandVKRLSIGMRLTLWYLAIFLLAEFVFGAGMWLILRKNLYDI
Ga0210403_1023395233300020580SoilMRRLSIGLRLTLWYLAIFAFAQLVFGAGMWFILRHNLYDLVDDGLESQ
Ga0210403_1029504533300020580SoilMTRLSIGWRLTLWYLAIFALGQFAFGAGIWLVLRHHLVG
Ga0210404_1027601023300021088SoilMRRLSIGLRLTLWYLAIFAFAQLVFGAGMWFILRHNLYDLVDDGLES
Ga0210396_1014375533300021180SoilVKKLSIGMRLTLWYFAIFLLAEFVFGAGMWLILRKNL
Ga0210393_1013812733300021401SoilMTRLSIGWRLTVWYLAIFAVGQFAFGAGMWLVLRHHLISLVDENL
Ga0210393_1075051023300021401SoilMRRLPIGVRLTLWYVAIFATAQIVFGGLMWVTLRHH
Ga0210383_1138706013300021407SoilMSRLSIGVRLTLWYLAIFAFAQLVFGTGMWFVLRHHLYGLIDDG
Ga0210392_1022892033300021475SoilMRKLSIGLRLTLWYLAIFLLAELIFGAGMWFILRQNLYDI
Ga0210402_1159965513300021478SoilVKKLSIGLRLTLWYLAIFFLAELIFGAGMWLILRQNLFDIA
Ga0210410_1049461033300021479SoilMKRISQLSIGMRLALSYLAIFLLAELVFGAGMWLILRKNLYDI
Ga0210410_1133030613300021479SoilMRKLSIGVRLTLWYLLFFAVAQLFFGAGMWWILHDNIYDLVDD
Ga0210410_1138205623300021479SoilMSRLSIGVRLTLWYLAIFAFAQLVFGTGMWFVLRHH
Ga0242655_1009387913300022532SoilMQRLSIGLRLTLWYLAIFALAQLIFGVGMWFILRKNLHDVA
Ga0224563_100147333300022731SoilMTRLSIGWRLTLWYLAIFALGQFAFGAGIWLVLRHHLVGLVDKNL
Ga0208034_107010123300025442PeatlandLKRLSIGMRLTLWYLAIFLLAEFVFGAGMWFILRKNLYDIADATLEG
Ga0207671_1141865413300025914Corn RhizosphereMKRLSIGARLTLWYLVIFALSEAVFGVGMWFILRDSV
Ga0207693_1148887713300025915Corn, Switchgrass And Miscanthus RhizosphereVKRLSIGLRLTAWYLAIFAVAQLIFGVGMWFILRQNLHDIADTT
Ga0207646_1092041613300025922Corn, Switchgrass And Miscanthus RhizosphereVKKLSIGLRLTLWYLVIFLLAEVIFGVGMWLILRQNLLDIADT
Ga0207664_1082145313300025929Agricultural SoilMRKLSIGVRLTLWYVAIFAVGELVFGASMFFILRHNLYD
Ga0207665_1012989713300025939Corn, Switchgrass And Miscanthus RhizosphereMRRLSIGVRLTLWYVAIFAVGELVFGASMFLILRHNLYDLV
Ga0209265_102638213300026308SoilMKRLSIGVRLTLWYLVIFAVGEVVFGVGMWFILRDSVLDMVDDD
Ga0209055_104697943300026309SoilMTKLSIGMRLTLWYLAIFAGAQLIFGAGMWFVLRHHVYD
Ga0257156_109516523300026498SoilVKWLSIRLRLTLWYFAIFLLAELIFGAGMWLILRENLF
Ga0257181_102575013300026499SoilMRKLSIGMRLTLWYLAIFALAQLVFGAGMWLVLRHHLYDLV
Ga0209806_129538723300026529SoilMTKLSIGMRLTLWYLAIFAGAQLIFGAGMWFVLRHHVYDLVDDGLESQVEDLESFL
Ga0208732_102772413300026984Forest SoilMRKLSIGVRLTLWYVAIFAVGELLFGASMFLILRHNLYDLVDDGLESQIEDL
Ga0209729_105203413300027061Forest SoilMKGLSIGVRLTLWYVAIFTLGELVFATGTWMILRHSLFDLIDDNLES
Ga0208199_111940523300027497Peatlands SoilMKRLSIGLRLTLWYLAIFFVGELIFGTGMWFILRKNLYDIADA
Ga0209218_101342033300027505Forest SoilVTRLSIGWRLTLWYLAIFALGQFAFGAGMWLVLRHHLVSLIDKNLQDQAAD
Ga0209330_102531413300027619Forest SoilVRRFSIGLRLTLWYLAIFAVAQIAFGAGMWVMLRHHLYDLV
Ga0209118_117409723300027674Forest SoilMGTHEKTGMRRLSIGVRLTLWYLVFFAVAQLIFGIGMWLILRHNIYDLVDDSLE
Ga0207862_117763523300027703Tropical Forest SoilMSRLSIGVRLTLWYVAIFAVAQVVFGTVMWVSLRHHLYSIVDDSL
Ga0209693_1006052733300027855SoilMTRLSIGWRLTLWYLAIFALGQFAFGAGIWLVLRHHLVGLVDKN
Ga0209693_1023855013300027855SoilMRRLSIGVRLTLWYLAIFALAQIVFGVGMWLILRHHLY
Ga0209579_1061082423300027869Surface SoilMRKLSIGVRLTVWYLAIFALAQFVFGIGMWLLLRHKLYDVSNDNLESQVEDLQ
Ga0209275_1010248133300027884SoilMKKLSIGVRLALWYVAIFALGELIFGASMWVILRENLYDLVDDSLENQVEDLRNFL
Ga0209068_1095767923300027894WatershedsVTRLSIGFRLTIWYLTVFALAQLAFGLGMWLILRENLREVTRTALAG
Ga0209067_1027311523300027898WatershedsMKKFSIGVRLTLWYLAIFAVAQIAFGAGMWFILHEHLYDLVD
Ga0209488_1028139733300027903Vadose Zone SoilVKWLSIRLRLTLWYFAIFLLAELIFGAGMWLILRQNLFDIADIAL
Ga0209698_1010057233300027911WatershedsMRRLSIGMRLTLWYVTIFAVGELVFGASMFIILRHNLYDL
Ga0209698_1023284733300027911WatershedsMRRLSIGVRLTLWYVTIFAVGELVFGASMFIILRHNLYDL
Ga0209069_1101592913300027915WatershedsMKSLSIGLRLTLSYLLVFAAAQFLFGLGMWMILRHNLYQ
Ga0209168_1029835623300027986Surface SoilMKRPSIGVRLALWYLAFFALAQFVFGVGMWVILRHNL
Ga0302144_1016051623300028560BogMKKLSIGLRLTLWYLAIFAAAQVLFGVAMWLVLRRDLYRI
Ga0302213_120536323300028769FenMRKLSIGWRLTLWYVAIFALAQLVFGVGMWVLLRH
Ga0302178_1038669513300030013PalsaMKKLSIGMRLTLWYLAIFLLAEFVFGAGMWLILRKNLYD
Ga0311360_1133200713300030339BogVTRLSIGLRLTLWYLVIFALGQFVFGAGMWLVLRHHLVSLVDDNLRDQTEDLR
Ga0311370_1013180283300030503PalsaMKKLSIGMRLTLWYLAIFLLAEFVFGAGMWLILRKNLYDI
Ga0265462_1185137423300030738SoilVKKLSIGLRLTLLYLGLFLLVQIIVGEGMWLVLRQN
Ga0265462_1188556023300030738SoilMKISIGLRLTLLYLAIFLLAQVILGGGMWLENKKKKK
Ga0265460_1243081913300030740SoilVNKLSIGLRLMLLYLAIFLFAQVILGAGMWLVLRQNLFAIA
Ga0311335_1025577023300030838FenMRKLSIGWRLTLWYVAIFAMAQLVFGVGMWVLLRHYL
Ga0170824_12676752713300031231Forest SoilMRKLSIGVRLTLWYLAIFALGQVIFGAGMWLILRHNLYDLVD
Ga0265331_1016124313300031250RhizosphereMRRLSIGVRLTLWYLAIFALAQILFGAGMWFILRHNL
Ga0170818_10453014923300031474Forest SoilMKSLSIGSRLTLSYLIIFAVAQLVFGLGMWFILRH
Ga0170818_11237117423300031474Forest SoilMRRLSIGVRLTLWYLAIFALAQIVFGAGMWFILRH
Ga0318573_1053320723300031564SoilVKRLSIGFRLTLWYLAIFALAQGLFGVGMWFILRENLHDIAD
Ga0307476_1018768713300031715Hardwood Forest SoilMQRLSIGLRLTLWYLAIFALAQLIFGVGMWFILRKNLHDV
Ga0307474_1063818423300031718Hardwood Forest SoilVKKLSIGTRLTLWYFAIFLLAEFVFGAGMWLILRKNLLDIADEVLEGQ
Ga0318501_1001192443300031736SoilVKRLSIGFRLTLWYLAIFALAQGLFGVGMWFILRENLHDIADHV
Ga0307477_1065461423300031753Hardwood Forest SoilVKKLSIGMRLTLWYFAIFLLAEFVFGAGMWLILRKNLLDIADEVLEG
Ga0307475_1066306523300031754Hardwood Forest SoilVKRLSIGSRLTLWYLAIFLLAELIFGAGMWFILRKNLYDIADQALK
Ga0307475_1139319023300031754Hardwood Forest SoilVKKLSIGLRLTLWYLAIFFVAELIFGAGMWLILRQNLFDLADAALEDQAA
Ga0318529_1061657813300031792SoilMRRLSIGLRLTLWYLTIFALAQLAFGAGMWFLLRHHLYDLVDNGLKGQIED
Ga0307478_1064720423300031823Hardwood Forest SoilVTKLSIGMRLTLWYFAIFLLAEFVFGAGMWLILRKNLLDIADEVLEGQA
Ga0318520_1057108723300031897SoilMSMRRLPIGVRLTLWYVAIFATAQVVFGGLMYVTLRHYL
Ga0306923_1030880843300031910SoilMKKLSIGFRLTLWYLAIFALGQLVFGAGMWFILREN
Ga0306926_1039014133300031954SoilMRRLSIGVRLTLWYLAIFALGELIFGAGMWFILRHNLYDIVDDGLE
Ga0306924_1077565513300032076SoilVKRLSIGSRLTLWYLGIFALAQLLFGVGMWFILRKNLHDVADAA
Ga0306924_1129265923300032076SoilMSMRRLPIGVRLTLWYVAIFATAQVVFGGLMYVTLRHYLYEIV
Ga0307470_1053375323300032174Hardwood Forest SoilMRKLSIGVRLTLWYVAIFALGEFVFGAGMWFILRHNLYDLADDSLENQSD
Ga0307470_1126008023300032174Hardwood Forest SoilLRRLSIGLRLTLWYVAVFAVAQLVFGAGMYLILRQSLYSITDDALHEQI
Ga0335079_1007371313300032783SoilMKRLSIGMRLTVWYLAIFALGQIVFGAGMWFILRNN
Ga0335078_1124245423300032805SoilMKKLSIGMRLTFWYLAIFALAQIVFGLGMWLILRGYLYDLADDSLESQVEDL
Ga0335080_1139026523300032828SoilMKKLSIGFRLTLWYLAIFALGELVFGAGMWFSLRENVLD
Ga0335069_1146193213300032893SoilMVKALSIGTRLTLWYAAIFALSELIFGAGMWFVLRQELYSIADDSLRA
Ga0310914_1182814723300033289SoilMRRLSIGVRLTLWYVAIFALGELVFGASMWLILRH
Ga0314866_068742_495_6023300033807PeatlandMKKLSIGLRLTLWYLAIFAAAQLLFGLGMWFILRQN
Ga0334790_212812_2_1333300033887SoilMRRLSIGVRLTLWYLAIFALAQILFGAGMWFILRHNLYDLVDDG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.