| Basic Information | |
|---|---|
| Family ID | F046606 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 151 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRNLTEDEFLRGKERLRRAIRHAEDTANPETRSNWLDLLVLR |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.97 % |
| % of genes near scaffold ends (potentially truncated) | 90.73 % |
| % of genes from short scaffolds (< 2000 bps) | 90.73 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.199 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.232 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.477 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.397 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF04978 | DUF664 | 9.27 |
| PF00582 | Usp | 7.95 |
| PF08241 | Methyltransf_11 | 4.64 |
| PF08327 | AHSA1 | 3.31 |
| PF00903 | Glyoxalase | 2.65 |
| PF03575 | Peptidase_S51 | 1.99 |
| PF07883 | Cupin_2 | 1.99 |
| PF00561 | Abhydrolase_1 | 1.99 |
| PF01039 | Carboxyl_trans | 1.32 |
| PF01370 | Epimerase | 1.32 |
| PF12840 | HTH_20 | 1.32 |
| PF01872 | RibD_C | 1.32 |
| PF01613 | Flavin_Reduct | 1.32 |
| PF00355 | Rieske | 1.32 |
| PF01243 | Putative_PNPOx | 1.32 |
| PF13439 | Glyco_transf_4 | 1.32 |
| PF01594 | AI-2E_transport | 1.32 |
| PF02585 | PIG-L | 1.32 |
| PF13517 | FG-GAP_3 | 0.66 |
| PF06821 | Ser_hydrolase | 0.66 |
| PF00067 | p450 | 0.66 |
| PF09413 | DUF2007 | 0.66 |
| PF00144 | Beta-lactamase | 0.66 |
| PF00313 | CSD | 0.66 |
| PF13304 | AAA_21 | 0.66 |
| PF04828 | GFA | 0.66 |
| PF00480 | ROK | 0.66 |
| PF14329 | DUF4386 | 0.66 |
| PF13649 | Methyltransf_25 | 0.66 |
| PF00483 | NTP_transferase | 0.66 |
| PF00884 | Sulfatase | 0.66 |
| PF02597 | ThiS | 0.66 |
| PF06778 | Chlor_dismutase | 0.66 |
| PF10604 | Polyketide_cyc2 | 0.66 |
| PF12680 | SnoaL_2 | 0.66 |
| PF13672 | PP2C_2 | 0.66 |
| PF16697 | Yop-YscD_cpl | 0.66 |
| PF01436 | NHL | 0.66 |
| PF03795 | YCII | 0.66 |
| PF03551 | PadR | 0.66 |
| PF12802 | MarR_2 | 0.66 |
| PF13489 | Methyltransf_23 | 0.66 |
| PF12695 | Abhydrolase_5 | 0.66 |
| PF01883 | FeS_assembly_P | 0.66 |
| PF00107 | ADH_zinc_N | 0.66 |
| PF04343 | DUF488 | 0.66 |
| PF13425 | O-antigen_lig | 0.66 |
| PF05977 | MFS_3 | 0.66 |
| PF10027 | DUF2269 | 0.66 |
| PF00486 | Trans_reg_C | 0.66 |
| PF13302 | Acetyltransf_3 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.32 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 1.32 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.32 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.32 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.32 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 1.32 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.32 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 1.32 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 1.32 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.66 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.66 |
| COG3545 | Predicted esterase of the alpha/beta hydrolase fold | General function prediction only [R] | 0.66 |
| COG3253 | Coproheme decarboxylase/chlorite dismutase | Coenzyme transport and metabolism [H] | 0.66 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.66 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.66 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.66 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.66 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.66 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.66 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.66 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.66 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.66 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.52 % |
| Unclassified | root | N/A | 28.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003324|soilH2_10163788 | Not Available | 1506 | Open in IMG/M |
| 3300003990|Ga0055455_10092756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 881 | Open in IMG/M |
| 3300004479|Ga0062595_101826406 | Not Available | 579 | Open in IMG/M |
| 3300005158|Ga0066816_1025594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
| 3300005162|Ga0066814_10063654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300005163|Ga0066823_10143440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 524 | Open in IMG/M |
| 3300005172|Ga0066683_10366579 | Not Available | 893 | Open in IMG/M |
| 3300005328|Ga0070676_10921885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
| 3300005332|Ga0066388_100590434 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300005332|Ga0066388_100705944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1615 | Open in IMG/M |
| 3300005364|Ga0070673_102203009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300005435|Ga0070714_100096346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2600 | Open in IMG/M |
| 3300005436|Ga0070713_100361351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1349 | Open in IMG/M |
| 3300005439|Ga0070711_100587884 | Not Available | 927 | Open in IMG/M |
| 3300005545|Ga0070695_100865966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 728 | Open in IMG/M |
| 3300005546|Ga0070696_101309410 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005560|Ga0066670_10106875 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300005578|Ga0068854_101439777 | Not Available | 624 | Open in IMG/M |
| 3300005616|Ga0068852_102833505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300005764|Ga0066903_108076857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 539 | Open in IMG/M |
| 3300006028|Ga0070717_12006426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 521 | Open in IMG/M |
| 3300006172|Ga0075018_10212657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 922 | Open in IMG/M |
| 3300006174|Ga0075014_100435616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 722 | Open in IMG/M |
| 3300006196|Ga0075422_10352287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300006804|Ga0079221_10081647 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300006806|Ga0079220_11647921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300006853|Ga0075420_100813556 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300006903|Ga0075426_10453443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 950 | Open in IMG/M |
| 3300006903|Ga0075426_11106618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300009098|Ga0105245_11855562 | Not Available | 656 | Open in IMG/M |
| 3300009147|Ga0114129_10262168 | All Organisms → cellular organisms → Bacteria | 2315 | Open in IMG/M |
| 3300009148|Ga0105243_12558716 | Not Available | 550 | Open in IMG/M |
| 3300009156|Ga0111538_11697915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 795 | Open in IMG/M |
| 3300009162|Ga0075423_10221811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1982 | Open in IMG/M |
| 3300009174|Ga0105241_10483169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1101 | Open in IMG/M |
| 3300009174|Ga0105241_11161998 | Not Available | 729 | Open in IMG/M |
| 3300009551|Ga0105238_10253598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1738 | Open in IMG/M |
| 3300009789|Ga0126307_10922653 | Not Available | 705 | Open in IMG/M |
| 3300009789|Ga0126307_11605295 | Not Available | 528 | Open in IMG/M |
| 3300009792|Ga0126374_10618945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 802 | Open in IMG/M |
| 3300009792|Ga0126374_11784953 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010036|Ga0126305_10067116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2081 | Open in IMG/M |
| 3300010038|Ga0126315_11071140 | Not Available | 543 | Open in IMG/M |
| 3300010040|Ga0126308_10822066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 644 | Open in IMG/M |
| 3300010043|Ga0126380_11400612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 614 | Open in IMG/M |
| 3300010337|Ga0134062_10023398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 2385 | Open in IMG/M |
| 3300010359|Ga0126376_13059073 | Not Available | 517 | Open in IMG/M |
| 3300010360|Ga0126372_10304150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1403 | Open in IMG/M |
| 3300010361|Ga0126378_11643122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 730 | Open in IMG/M |
| 3300010366|Ga0126379_11498827 | Not Available | 780 | Open in IMG/M |
| 3300010371|Ga0134125_10646729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1167 | Open in IMG/M |
| 3300010371|Ga0134125_12592363 | Not Available | 551 | Open in IMG/M |
| 3300010376|Ga0126381_102069516 | Not Available | 820 | Open in IMG/M |
| 3300010396|Ga0134126_10732982 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300010399|Ga0134127_10075748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2873 | Open in IMG/M |
| 3300010399|Ga0134127_10201131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1853 | Open in IMG/M |
| 3300010401|Ga0134121_11233555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 749 | Open in IMG/M |
| 3300011270|Ga0137391_10481368 | Not Available | 1053 | Open in IMG/M |
| 3300012198|Ga0137364_11249843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300012201|Ga0137365_10951398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300012207|Ga0137381_11326825 | Not Available | 612 | Open in IMG/M |
| 3300012900|Ga0157292_10107164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
| 3300012944|Ga0137410_10582465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 923 | Open in IMG/M |
| 3300012951|Ga0164300_10430707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 734 | Open in IMG/M |
| 3300012960|Ga0164301_11538853 | Not Available | 549 | Open in IMG/M |
| 3300012985|Ga0164308_10050227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2691 | Open in IMG/M |
| 3300012987|Ga0164307_10284518 | Not Available | 1171 | Open in IMG/M |
| 3300012987|Ga0164307_10498694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 919 | Open in IMG/M |
| 3300013105|Ga0157369_11121088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 804 | Open in IMG/M |
| 3300013296|Ga0157374_10144848 | All Organisms → cellular organisms → Bacteria | 2307 | Open in IMG/M |
| 3300013297|Ga0157378_11968080 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Gordonia | 634 | Open in IMG/M |
| 3300013306|Ga0163162_11687350 | Not Available | 723 | Open in IMG/M |
| 3300014745|Ga0157377_10843090 | Not Available | 680 | Open in IMG/M |
| 3300014968|Ga0157379_10734367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
| 3300015371|Ga0132258_13842538 | Not Available | 1022 | Open in IMG/M |
| 3300015372|Ga0132256_100486908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1343 | Open in IMG/M |
| 3300015373|Ga0132257_101644528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
| 3300015374|Ga0132255_100069295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4680 | Open in IMG/M |
| 3300015374|Ga0132255_100850822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1362 | Open in IMG/M |
| 3300016371|Ga0182034_11563749 | Not Available | 578 | Open in IMG/M |
| 3300017959|Ga0187779_11294799 | Not Available | 516 | Open in IMG/M |
| 3300017966|Ga0187776_10051553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2343 | Open in IMG/M |
| 3300017972|Ga0187781_10257497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1235 | Open in IMG/M |
| 3300017974|Ga0187777_10337185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1035 | Open in IMG/M |
| 3300018060|Ga0187765_10639745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces incarnatus | 691 | Open in IMG/M |
| 3300018081|Ga0184625_10149447 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300018468|Ga0066662_12082089 | Not Available | 595 | Open in IMG/M |
| 3300019356|Ga0173481_10295389 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300020199|Ga0179592_10342175 | Not Available | 659 | Open in IMG/M |
| 3300020579|Ga0210407_11007969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 635 | Open in IMG/M |
| 3300020583|Ga0210401_10664479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 903 | Open in IMG/M |
| 3300021478|Ga0210402_10516910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1108 | Open in IMG/M |
| 3300021560|Ga0126371_10405374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1506 | Open in IMG/M |
| 3300022467|Ga0224712_10386589 | Not Available | 665 | Open in IMG/M |
| 3300022533|Ga0242662_10239444 | Not Available | 585 | Open in IMG/M |
| 3300024182|Ga0247669_1022628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1080 | Open in IMG/M |
| 3300024288|Ga0179589_10526258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
| 3300025552|Ga0210142_1041823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 881 | Open in IMG/M |
| 3300025911|Ga0207654_10483561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia | 872 | Open in IMG/M |
| 3300025915|Ga0207693_11474241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
| 3300025921|Ga0207652_10158386 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
| 3300025924|Ga0207694_11452244 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Gordonia | 579 | Open in IMG/M |
| 3300025927|Ga0207687_11102748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 682 | Open in IMG/M |
| 3300025928|Ga0207700_10304186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1378 | Open in IMG/M |
| 3300025928|Ga0207700_11388072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
| 3300025929|Ga0207664_10376233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. FMUSA5-5 | 1260 | Open in IMG/M |
| 3300025931|Ga0207644_10632576 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300025935|Ga0207709_11713935 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300025937|Ga0207669_10359366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1128 | Open in IMG/M |
| 3300025944|Ga0207661_10012598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6153 | Open in IMG/M |
| 3300025944|Ga0207661_11050288 | Not Available | 750 | Open in IMG/M |
| 3300026041|Ga0207639_10207112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1686 | Open in IMG/M |
| 3300026041|Ga0207639_11024218 | Not Available | 773 | Open in IMG/M |
| 3300026118|Ga0207675_102133442 | Not Available | 576 | Open in IMG/M |
| 3300026959|Ga0207852_1022644 | Not Available | 649 | Open in IMG/M |
| 3300027725|Ga0209178_1063389 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300027765|Ga0209073_10208385 | Not Available | 746 | Open in IMG/M |
| 3300027821|Ga0209811_10434776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300028072|Ga0247675_1048063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
| 3300028138|Ga0247684_1069950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
| 3300028775|Ga0302231_10520386 | Not Available | 504 | Open in IMG/M |
| 3300028790|Ga0307283_10060430 | Not Available | 924 | Open in IMG/M |
| 3300028791|Ga0307290_10202343 | Not Available | 728 | Open in IMG/M |
| 3300031525|Ga0302326_11649837 | Not Available | 849 | Open in IMG/M |
| 3300031543|Ga0318516_10472661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
| 3300031549|Ga0318571_10377471 | Not Available | 549 | Open in IMG/M |
| 3300031572|Ga0318515_10310873 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300031679|Ga0318561_10853449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora globispora | 501 | Open in IMG/M |
| 3300031682|Ga0318560_10777538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300031720|Ga0307469_11030639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
| 3300031769|Ga0318526_10054860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1528 | Open in IMG/M |
| 3300031782|Ga0318552_10494859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300031793|Ga0318548_10227725 | Not Available | 916 | Open in IMG/M |
| 3300031795|Ga0318557_10568556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300031805|Ga0318497_10327796 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031845|Ga0318511_10475995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300031860|Ga0318495_10492908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300031947|Ga0310909_11452427 | Not Available | 547 | Open in IMG/M |
| 3300032039|Ga0318559_10128475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1141 | Open in IMG/M |
| 3300032055|Ga0318575_10650789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| 3300032068|Ga0318553_10087474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1576 | Open in IMG/M |
| 3300032074|Ga0308173_10353965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1279 | Open in IMG/M |
| 3300032126|Ga0307415_100775752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
| 3300032174|Ga0307470_10502362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 885 | Open in IMG/M |
| 3300032770|Ga0335085_10639490 | Not Available | 1191 | Open in IMG/M |
| 3300032892|Ga0335081_12551833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300032895|Ga0335074_10964882 | Not Available | 759 | Open in IMG/M |
| 3300032898|Ga0335072_10295770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1819 | Open in IMG/M |
| 3300033134|Ga0335073_10229134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2282 | Open in IMG/M |
| 3300033134|Ga0335073_10250854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2156 | Open in IMG/M |
| 3300033158|Ga0335077_10217276 | Not Available | 2137 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.30% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.64% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.97% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.31% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.99% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.99% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.32% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.32% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.32% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.66% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005158 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| soilH2_101637882 | 3300003324 | Sugarcane Root And Bulk Soil | LLAQVDTLRRADTTLHSLSEEEFQRGKDRLRRAAQAATATASPEPRSNWLDLLVLR* |
| Ga0055455_100927562 | 3300003990 | Natural And Restored Wetlands | RNLTDDEFLRGKDRLRRAVRHAETTGNAEHRSNWLDLLVLR* |
| Ga0062595_1018264061 | 3300004479 | Soil | ADTTMRSLSDDEFEQGKERLRRAMRQAAATGAPEPRGNLLDLLVLR* |
| Ga0066816_10255942 | 3300005158 | Soil | SLAEFLDQADNLRRADTIMRGLTEEEFLRGKEQLRRAVQHAGRTARTETRTSWLDLMVLR |
| Ga0066814_100636542 | 3300005162 | Soil | RADTIMRGLTEEEFLRGKEQLRRAVQHAGRTARTETRTSWLDLLVLR* |
| Ga0066823_101434402 | 3300005163 | Soil | LAEFLDQADNFRRADTNMRGLTEEEFLRGKEQLRRTVQHAGHTSRTETRTNWLDLLVLR* |
| Ga0066683_103665791 | 3300005172 | Soil | NLTEDEFRRGKARLRRAVRHAEDTTNPEIRSSWLDLLVLR* |
| Ga0070676_109218852 | 3300005328 | Miscanthus Rhizosphere | DVDAFRQADTTLRGLTDDEFRRGKQRLRRAVQDSSPEPRSNWLDLLVLRAG* |
| Ga0066388_1005904341 | 3300005332 | Tropical Forest Soil | QADNFRRADTNMRGLTEEEFLRGKEQLRRAVQHTKQTARTETRTNWLDLLVLR* |
| Ga0066388_1007059441 | 3300005332 | Tropical Forest Soil | DTTMRGLTDDEFLRGKARLRRAVQHAEDTAQPENRSNRLDLLVLR* |
| Ga0070673_1022030091 | 3300005364 | Switchgrass Rhizosphere | FRDADTTMRTLSDDEFVRGKERLRRAVRQANPEPRSNVLDLLVLR* |
| Ga0070714_1000963464 | 3300005435 | Agricultural Soil | LTEDEFARGKERLRRAVRDAEGTPNPETRSNWLDLLVLR* |
| Ga0070713_1003613514 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AFRHADTTMRDLTEAEFLRGRERLRRAVEEAEDAATPETRSNWLDLLVLR* |
| Ga0070711_1005878842 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TMRNLTEEEFLRGKERLRRAAQDAEETPSPEPRTNWLDLLVLR* |
| Ga0070695_1008659662 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNLTEGEFLRGKERLRRAARDAQTTANREPRSNWLDLLVLH* |
| Ga0070696_1013094101 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RSLTDDEFERGKERLRRAVRQAEASGAPERRGNWLELLVLR* |
| Ga0066670_101068751 | 3300005560 | Soil | LRHADTSLRALTEDEFRRGKERLRRAAQQAEDLRSNWLDLLVLRRRRRR* |
| Ga0068854_1014397772 | 3300005578 | Corn Rhizosphere | LRRADTTMRSLSDDEFRRGKERLRRAVRHAEAGGARKPHGNWLDLLVLR* |
| Ga0068852_1028335052 | 3300005616 | Corn Rhizosphere | SLTDDQFLRGKDRVRRAVRDATDTEPRSNWLDLLVLRAP* |
| Ga0066903_1080768571 | 3300005764 | Tropical Forest Soil | DEFLRGKERLRRAVRHADDTANPETRTNWLDLLVLR* |
| Ga0070717_120064262 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GELLAELDTLRHADTTLRNLTEDEFLRGKERIRRAAESGDREPRSNRLDLIVLR* |
| Ga0075018_102126573 | 3300006172 | Watersheds | FLRGKEQLRRAVQHAGHTSRTETRTNWLDLLVLR* |
| Ga0075014_1004356162 | 3300006174 | Watersheds | AEFLDQADNFRRADTNMRGLTEEEFLRGKEQLRRAVQHAGHTSRTETRTNWLDLLVLR* |
| Ga0075422_103522871 | 3300006196 | Populus Rhizosphere | LSEDEFLRGKERLRRAVRHGGDTASPETRSNSLDLLVLR* |
| Ga0079221_100816473 | 3300006804 | Agricultural Soil | MRGLTEEEFLRGKEQLRRAVQHAGHAAHTEARTNWLDLLVLR* |
| Ga0079220_116479211 | 3300006806 | Agricultural Soil | SLTEDEFLRGKKRLRRAVRRAETTANPETRRSWFDFLVLR* |
| Ga0075420_1008135561 | 3300006853 | Populus Rhizosphere | HLTEDEFLRGKERLRRAVRDAEDTEARSNWLDLLVLR* |
| Ga0075426_104534434 | 3300006903 | Populus Rhizosphere | LTEEEYLRGKEQLRRAVEQAGPAARNEARTSWLELLVLR* |
| Ga0075426_111066181 | 3300006903 | Populus Rhizosphere | FRDADTTMRTLSDDEFLRGKERLRRAARQANPEPRSNVLDLLVLR* |
| Ga0105245_118555621 | 3300009098 | Miscanthus Rhizosphere | TDDQFLRGKDRVRRAVRDATDTEPRSNWLDLLVLRAS* |
| Ga0114129_102621683 | 3300009147 | Populus Rhizosphere | ADTTMRNLTEDEFLRGKERLRRAVRHADDSAHPETRSNRLDLLVLR* |
| Ga0105243_125587162 | 3300009148 | Miscanthus Rhizosphere | DDEFRRGKERLRRAVRHAEAGGARKPHGNWLDLLVLR* |
| Ga0111538_116979151 | 3300009156 | Populus Rhizosphere | SLTEEEFRRGKERIRRAVDAGNLETRNNRLDLLILR* |
| Ga0075423_102218113 | 3300009162 | Populus Rhizosphere | TMRSLTDDEFLRGKERLRRALRHAEAGAAPEPRGNWLELVVLR* |
| Ga0105241_104831693 | 3300009174 | Corn Rhizosphere | ADLLGQVDTFRHADTTMRNLTEGEFLRGKERVRRAARHAETTANREPRSNWLDLLVLR* |
| Ga0105241_111619983 | 3300009174 | Corn Rhizosphere | GLTEDEFLRGKEHLRRAIEQAEGTPSPEPRSNRLDLLVLR* |
| Ga0105238_102535982 | 3300009551 | Corn Rhizosphere | MRSLSDDEFERGKERLRRAIRQADRTGAPEPRGNLLDLLVLR* |
| Ga0126307_109226531 | 3300009789 | Serpentine Soil | MVQVDTFRQADTTMRQLTEEAFLRGKDRLRGAARPAEDTATREPRSNWLDLLVLR* |
| Ga0126307_116052951 | 3300009789 | Serpentine Soil | TNMRGLTEEEFRRGKERLRRAVQHAEHTARTETRTNWLDLLVLR* |
| Ga0126374_106189451 | 3300009792 | Tropical Forest Soil | SDTNLRSLTEEEYLRGKEQLRRAVERAGPAARNEARTSWLELLVLR* |
| Ga0126374_117849532 | 3300009792 | Tropical Forest Soil | RQLTEDEFLRGKERLRRGVRQAEDTANPEIRSNWLDLLVLR* |
| Ga0126305_100671163 | 3300010036 | Serpentine Soil | MVQVDTFRQADTTMRQLTEEEFLRGKDRRRRAVRPAEDTATPEPRSNWLDLLVLR* |
| Ga0126315_110711401 | 3300010038 | Serpentine Soil | MVQVDTFRQADTTMRQLTEEEFLRGKDRLRRAVRPAEDTATPEPRSNWLDLLVLR* |
| Ga0126308_108220663 | 3300010040 | Serpentine Soil | RHLTEDELLRGKERLRRAVRQAENTATPETRSNWLDLLVLR* |
| Ga0126380_114006123 | 3300010043 | Tropical Forest Soil | ADTTLRNLTEDEFLRGKERLRRAVDTGSPALRSNRLDLLVLRRGK* |
| Ga0134062_100233981 | 3300010337 | Grasslands Soil | TMRNLTEDEFRRGKARLRRAVRHAEDTTNPEIRSSWLDLLVLR* |
| Ga0126376_130590732 | 3300010359 | Tropical Forest Soil | LTEDEFLRGQERLRLAVRHAEDAANQGTRSNWLDLLVLR* |
| Ga0126372_103041504 | 3300010360 | Tropical Forest Soil | RSLSEEEFRRGKERLRSAVEAGMREPRTNWLDLLVLR* |
| Ga0126378_116431221 | 3300010361 | Tropical Forest Soil | EFLRGKERLCRAAQDAEKTPSPKPRTSWLDLLVLR* |
| Ga0126379_114988271 | 3300010366 | Tropical Forest Soil | EDEFLRGKERLRRAVRHAGDTANPDTRSNWLDLLVLR* |
| Ga0134125_106467291 | 3300010371 | Terrestrial Soil | DDEFLRGKARLRRAVRRAEAGAAREPRGNWLELLVLR* |
| Ga0134125_125923631 | 3300010371 | Terrestrial Soil | RRADTTMRNLTEEEFLRGTERLRRAAQDAEETPSPEPRTNWLDLLVLR* |
| Ga0126381_1020695161 | 3300010376 | Tropical Forest Soil | TTMRILTDDEFLRGTERLRRAVDDAQSEPRSNTLDLLVLR* |
| Ga0134126_107329821 | 3300010396 | Terrestrial Soil | SLAEFLAQADTFRRADTTMRNLTEEEFLRGTERLRRAAQDAEETPSPEPRTNWLDLLVLR |
| Ga0134127_100757481 | 3300010399 | Terrestrial Soil | DTTMRSLTDDEFRRGKERLRRAVRRAEAGGVREARGNWLDLLVLR* |
| Ga0134127_102011315 | 3300010399 | Terrestrial Soil | VDTFRDADTTMRTLSDDEFVSGKERLRRAVGQANPEPRSNVL |
| Ga0134121_112335552 | 3300010401 | Terrestrial Soil | DTSLRALTEDEFRRGKERLRRAAQQAEDTRSNWLDLLVLR* |
| Ga0137391_104813682 | 3300011270 | Vadose Zone Soil | MRGLTEEEFLPGKQRLRRAVQHAEHTARTETRTSWLDLLVLR* |
| Ga0137364_112498431 | 3300012198 | Vadose Zone Soil | TLRGLTEQEFLRGKERLSRAARHAGDRAKPESRSNWLDLLVLR* |
| Ga0137365_109513981 | 3300012201 | Vadose Zone Soil | HADTTMRNLTEDEFLRGKERLGRAVRQDEEAADPATRSNWLDLLVLR* |
| Ga0137381_113268251 | 3300012207 | Vadose Zone Soil | DQADNFRRADTVMRGLTEEEFLRGKQRLRRAMQHAGHTARTETRTSWLDILVLR* |
| Ga0157292_101071643 | 3300012900 | Soil | FLRGKERLRRAVRQAEDTANPQTRSNSLDLLVLR* |
| Ga0137410_105824651 | 3300012944 | Vadose Zone Soil | DTTMRNLTEDEFLRGKERLRRAIRDAEGTASPETRSNWLDLLVLR* |
| Ga0164300_104307071 | 3300012951 | Soil | RDADTTLRSLTDDQFLRGKDRVRRAVRDATDTEPRRNSLDLLVLRAP* |
| Ga0164301_115388532 | 3300012960 | Soil | MRNLTEEEFLRGKERLRRAAQDAEETPSPEPRTNWLDLLVLR* |
| Ga0164308_100502271 | 3300012985 | Soil | RHADTTLRHLSEDEFQRGKERLRRAVRASEAQADPEPRSNWLDLLVLR* |
| Ga0164307_102845181 | 3300012987 | Soil | SDTNLRSLTEEEYQRGKEQLRRAVERAGPAARNEARTSWLELLVLR* |
| Ga0164307_104986943 | 3300012987 | Soil | LRDADTTMRSLTDDQFLRGKDRVRRAVRDATDTEPRSNWLDLLVLRAS* |
| Ga0157369_111210881 | 3300013105 | Corn Rhizosphere | TFRHADTTMHNLTENEFRRGKERLRRAARDAETTGNGEPRSNWLDLLVLR* |
| Ga0157374_101448481 | 3300013296 | Miscanthus Rhizosphere | FRQADTTMRSLTDDEFVRGKERIRRAIRDGEDTGDPEARSNWLDLLVLR* |
| Ga0157378_119680801 | 3300013297 | Miscanthus Rhizosphere | LGEVDTFRRADTTMRDLTEDEFLRGKQRLRRAVRQTESTANPEPRGNWLDLLVLR* |
| Ga0163162_116873502 | 3300013306 | Switchgrass Rhizosphere | EFRRGKERLRRAVRHAEAGGARKPHGNWLDLLVLR* |
| Ga0157377_108430901 | 3300014745 | Miscanthus Rhizosphere | SDDEFRRGKERLRRAVRHAEAGGARKPHGNWLDLLVLR* |
| Ga0157379_107343671 | 3300014968 | Switchgrass Rhizosphere | RQADTTMRSLTDDEFLRGKARLRRAVRRAEAGAAREPRGNWLELLVLR* |
| Ga0132258_138425382 | 3300015371 | Arabidopsis Rhizosphere | GSLTDLLRQVDTLRLADTTLRNLTDDEFLRGKESLRRAARRGESESTPPSRINWLDLLVLR* |
| Ga0132256_1004869081 | 3300015372 | Arabidopsis Rhizosphere | TMRALTEEEFLRGKDRVRRALRHAEATGSAETRSNWLDLLVLR* |
| Ga0132257_1016445282 | 3300015373 | Arabidopsis Rhizosphere | DQADNLRRADTVMRGLTEEEFLRGRERLRRAVQHAGHTARTETRTNWLDLLILR* |
| Ga0132255_1000692959 | 3300015374 | Arabidopsis Rhizosphere | LTEDEFQRGKKRLRSAVRAGANAEPRSNRLDLLVLR* |
| Ga0132255_1008508221 | 3300015374 | Arabidopsis Rhizosphere | QVDTFRHADTTMRTLTEDEFLRGKKRLRRAARDAESTGIREPRSNWLDLLVLR* |
| Ga0182034_115637491 | 3300016371 | Soil | TMRNLTEDEFLRGKERLHRAVRDAEDTANPETRTNWLDLLVLR |
| Ga0187779_112947992 | 3300017959 | Tropical Peatland | LAEFLAQADTFRRADTTMRNLTEEEFLRGKKRLRRAARAAERPEPRANWLDLLVLR |
| Ga0187776_100515532 | 3300017966 | Tropical Peatland | MGGLTEEEFLRGKERLRRAVQHAGHTARTETRTNWLDLLVLR |
| Ga0187781_102574972 | 3300017972 | Tropical Peatland | LTEEEFLRGKERLRRAVQHAEHTARSQTRTNWLDLLVLR |
| Ga0187777_103371852 | 3300017974 | Tropical Peatland | DEFLRGKERLRRAVRHALDTPNPDARSNRLDLLVLR |
| Ga0187765_106397451 | 3300018060 | Tropical Peatland | DTTMRDLTEDEFLRGKERLRRAVRDAERTPSQETRSNWLDLLVLRAG |
| Ga0184625_101494471 | 3300018081 | Groundwater Sediment | TMRGLTEDEFLRGKERLRRAVRQAEDTANPETRSNSLDLLVLR |
| Ga0066662_120820893 | 3300018468 | Grasslands Soil | DLSEAEFLRGKERLRRAAQDAEHTSDQEPRTNWLDLLVLR |
| Ga0173481_102953892 | 3300019356 | Soil | LTEDEFLRGKERLRHAVRHAEDTANPETRSNWLDLLVLR |
| Ga0179592_103421753 | 3300020199 | Vadose Zone Soil | ADTNMRGLTEEEFLRGKERLRRAVQHAEHSARTETRTNWLDLLVLR |
| Ga0210407_110079691 | 3300020579 | Soil | SLAGFLDQADNFRRADTNMRGLTEEEFLRGKEQLRRAVQHAGHTSRTETRTNWLDLLVLR |
| Ga0210401_106644792 | 3300020583 | Soil | STIRNLTEEEFRRGKERLRRAAQDAEQAPSPEPRTSWLDLLVLR |
| Ga0210402_105169103 | 3300021478 | Soil | EEEFLRGKEQLRRAVQHAGHTSRTETRTNWLDLLVLR |
| Ga0126371_104053744 | 3300021560 | Tropical Forest Soil | DQADDFRRADTNMRGLTEEEFLRGKEQLRRAVRHAGHTASTQTRTNWLDLLVLR |
| Ga0224712_103865891 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | LTDDEFLRGKARLRRAVRRAEAGAAREPRGNWLELLVLR |
| Ga0242662_102394441 | 3300022533 | Soil | MRGLTEEEFLRGKEQLRRAVQHAGHTARTQTRTNWLDLLVLR |
| Ga0247669_10226283 | 3300024182 | Soil | ADTTMRTLSDDEFLRGKERLRRAARQANPEPRSNVLDLLVLR |
| Ga0179589_105262582 | 3300024288 | Vadose Zone Soil | MRGLTEEEFLRGKERLRRAVQHAGHTARPETRTNWLDLLVLR |
| Ga0210142_10418231 | 3300025552 | Natural And Restored Wetlands | RNLTDDEFLRGKDRLRRAVRHAETTGNAEHRSNWLDLLVLR |
| Ga0207654_104835612 | 3300025911 | Corn Rhizosphere | MRSLSDDEFERGKERLRRAIRQADRTGAPEPRGNLLDLLVLR |
| Ga0207693_114742411 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | TTMRSLTDDEFRRGKERLRRAVRHAEASGTGEPRGNRLDLLVLR |
| Ga0207652_101583861 | 3300025921 | Corn Rhizosphere | DDEFEQGKERLRRAMRQAAATGAPEPRGNLLDLLVLR |
| Ga0207694_114522441 | 3300025924 | Corn Rhizosphere | TLRGLTDDEFRRGKQRLRRAVQDSSPEPRSNWLDLLVLRAG |
| Ga0207687_111027482 | 3300025927 | Miscanthus Rhizosphere | SLTEEEYQRGKEQLRRAVERAGPAARNEARTSWLELLVLR |
| Ga0207700_103041864 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LGQIDAFRHADTTMRDLTEAEFLRGRERLRRAVEEAEDAATPETRSNWLDLLVLR |
| Ga0207700_113880721 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LTEEEYQRGKEQLRRAVEQAGPAARNEARTSWLELLVLR |
| Ga0207664_103762331 | 3300025929 | Agricultural Soil | TTMRNLTEDEFARGKERLRRAVRDAEGTPNPETRSNWLDLLVLR |
| Ga0207644_106325761 | 3300025931 | Switchgrass Rhizosphere | DDEFRRGKERLRRAVRRAEAGGVREPRGNWLDLLVLR |
| Ga0207709_117139351 | 3300025935 | Miscanthus Rhizosphere | GLTDEEFLRGKERLRRAVEQERAGAAEHDRSNWLDLLVLR |
| Ga0207669_103593661 | 3300025937 | Miscanthus Rhizosphere | RADTTMRDLTEDEFLRGKQRLRRAVRQTESTANPEPRGNWLDLLVLR |
| Ga0207661_100125988 | 3300025944 | Corn Rhizosphere | MRSLTDEFLRGKARLRRAVRRAEAGAAREPRGNWLELLVLR |
| Ga0207661_110502881 | 3300025944 | Corn Rhizosphere | DTTLRGLTEDEFLRGKERLRRAIEQAEGTPSPEPRSNRLDLLVLR |
| Ga0207639_102071122 | 3300026041 | Corn Rhizosphere | VRDTTMRSLSDDEFERGKERLRRAIRQADRTGAPEPRGNLLDLLVLR |
| Ga0207639_110242182 | 3300026041 | Corn Rhizosphere | TTMRDLTEDEFLRGKERLRSAVRQAEGTAKPEARSNWLDLLVLR |
| Ga0207675_1021334421 | 3300026118 | Switchgrass Rhizosphere | TEEEFLRGRERLRRAVQHAGHTARTETRANWLDLLILR |
| Ga0207852_10226442 | 3300026959 | Tropical Forest Soil | DSTMRTLTEEEFLCGKERLRRAVRDAEKTPSPEPRTSRLDLLVLR |
| Ga0209178_10633891 | 3300027725 | Agricultural Soil | FRRADTTMRNLTEEEFLRGKDRLRRAVQRSDGTGNQESRTNWLDLLVLR |
| Ga0209073_102083852 | 3300027765 | Agricultural Soil | LTEDEFLRGKARLRRAVRHAEDTADPGTRSNWLDLLVLR |
| Ga0209811_104347762 | 3300027821 | Surface Soil | LRRADTTLRGLTEAEFLRGKERLGRAVRKAEETASPEPRSNWLDLLVLR |
| Ga0247675_10480631 | 3300028072 | Soil | LTEEEYQRGKEQLRRAVERAGPAARNEARTSWLELLVLR |
| Ga0247684_10699501 | 3300028138 | Soil | SLTEEEYLRGKEQLRRAVEQAGPAARNEARTSWLELLVLR |
| Ga0302231_105203861 | 3300028775 | Palsa | RNLTEDEPRRGKERLRRALRHAEDTANPETRSNWLDLLVLC |
| Ga0307283_100604302 | 3300028790 | Soil | TEDEFLRGKERLRSAVRQAEDAGTQETRSNWLDLLVLR |
| Ga0307290_102023432 | 3300028791 | Soil | EFLRGKERLRSAVRQAEDAGTQETRSNWLDLLVLR |
| Ga0302326_116498371 | 3300031525 | Palsa | ADTTMRILTDEEFLRGKERLRRAVRKEEESATPEPRTNWLDLLVLR |
| Ga0318516_104726612 | 3300031543 | Soil | TEEEFLRGKERLRRAVRHAGHTARTETRTNWLELLVLR |
| Ga0318571_103774711 | 3300031549 | Soil | EDEFLRGKERLRRAIQHAGDTANQETRSNWLDLLVLR |
| Ga0318515_103108732 | 3300031572 | Soil | TNMRNLTEEEFLRGKERLRRAGYPRGPEPRTNWLDLLVLR |
| Ga0318561_108534491 | 3300031679 | Soil | DTTMRNLTEEEFLSGKERLRRAVRTASPEPRTSWLDLLVLR |
| Ga0318560_107775381 | 3300031682 | Soil | AEFLDQADNFRRSDTNMRGLTEEEFLRGKEQLRRAVQHAGHAAHTETRTNWLDLLVLR |
| Ga0307469_110306391 | 3300031720 | Hardwood Forest Soil | MRGLTEEEFLRGKERLRRAVQHAGHIARTETRTNW |
| Ga0318526_100548603 | 3300031769 | Soil | DEFLRGKERLRRAIQHAGDTANQETRSNWLDLLVLR |
| Ga0318552_104948591 | 3300031782 | Soil | MRNLTEEEFRRGKERLRRAAQHAEEAVGPQTRTSWLDLLVLR |
| Ga0318548_102277251 | 3300031793 | Soil | LTEDEFLRGKERLRRAIRHGEDTANLETRSNWLDLLVLR |
| Ga0318557_105685562 | 3300031795 | Soil | EFLRGKERLRQAALDAEKTSGPEPRTSWLDLLVLR |
| Ga0318497_103277961 | 3300031805 | Soil | RNLTEEEFLRGKERLRRAAQIPGPEPRTNWLDLLVLR |
| Ga0318511_104759951 | 3300031845 | Soil | GQLDTFRRADTTMRNLTEDEFRRGEDRLRRAVRHAEDTPSPDARSNWLDLLVLR |
| Ga0318495_104929083 | 3300031860 | Soil | TEDEFRRGEDRLRRAVRHAEDTPSPDARSNWLDLLVLR |
| Ga0310909_114524271 | 3300031947 | Soil | DEFLRGKERLHRAVRDAEDTANPETRTNWLDLLVLR |
| Ga0318559_101284751 | 3300032039 | Soil | TFRRADTNMRNLTEVEFLRGKERLRRAAQIPGPEPRTNWLDLLVLR |
| Ga0318575_106507891 | 3300032055 | Soil | MRNLTEDEFLRGKERLRRAIRHAEDTANPETRSNWLDLLVLR |
| Ga0318553_100874743 | 3300032068 | Soil | EDEFLRGKERLRRAIRHAGDTANQETRSNWLDLLVLR |
| Ga0308173_103539651 | 3300032074 | Soil | FRAADTTMRKLTDDEFLRGKERLGRAVLDPEHTANREPRHNWLDLLVLR |
| Ga0307415_1007757522 | 3300032126 | Rhizosphere | MVQVDTFRQADTTMRQLTEEEFLRGKDRLRRAVRPAEDTATPEPRSNWLDLLVLR |
| Ga0307470_105023621 | 3300032174 | Hardwood Forest Soil | TDDEFRRGKERLRRAVRDAESAGSPEPRSNWLDLLVLR |
| Ga0335085_106394903 | 3300032770 | Soil | MRGLTEEEFLRGKEQLRRAVQHAGHTAHTQTRTNWLDFLVLR |
| Ga0335081_125518331 | 3300032892 | Soil | VEFLRGKERLRRAVQHAEQASSQEPRTNWLDLLVLR |
| Ga0335074_109648821 | 3300032895 | Soil | NLTEEEFLRGKERLRRAAQDAEQAPSPEPRTSWLDLLVLR |
| Ga0335072_102957701 | 3300032898 | Soil | VDTFRQGDTTMRNLTEEEFRRGKQRLRGAVRTAGPESTTTWLDLLVLR |
| Ga0335073_102291341 | 3300033134 | Soil | RRSDTIMRGLTEEEFLRGKEQLRRAVRSADPAARTEPRTSWLDLLVLR |
| Ga0335073_102508541 | 3300033134 | Soil | LRRADSTMRTLTDDEFRRGKERIRRAVRRAAETGEPETRANWLDLLVLR |
| Ga0335077_102172763 | 3300033158 | Soil | HEFLRGKERLRRAVRQAERRGGAEPRSNWLDLLVLR |
| ⦗Top⦘ |