| Basic Information | |
|---|---|
| Family ID | F046573 |
| Family Type | Metagenome |
| Number of Sequences | 151 |
| Average Sequence Length | 41 residues |
| Representative Sequence | NQTGIRAFCAEEDAVVRVDPAGVCSNTEAGILTFNPLNQ |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.66 % |
| % of genes near scaffold ends (potentially truncated) | 98.68 % |
| % of genes from short scaffolds (< 2000 bps) | 81.46 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.603 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.583 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.477 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.344 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.94% β-sheet: 5.97% Coil/Unstructured: 82.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF07963 | N_methyl | 34.44 |
| PF13544 | Obsolete Pfam Family | 9.93 |
| PF13633 | Obsolete Pfam Family | 5.96 |
| PF00005 | ABC_tran | 4.64 |
| PF00072 | Response_reg | 2.65 |
| PF05977 | MFS_3 | 1.99 |
| PF12679 | ABC2_membrane_2 | 1.99 |
| PF13432 | TPR_16 | 1.32 |
| PF07228 | SpoIIE | 1.32 |
| PF01740 | STAS | 1.32 |
| PF08448 | PAS_4 | 1.32 |
| PF00482 | T2SSF | 0.66 |
| PF07676 | PD40 | 0.66 |
| PF14238 | DUF4340 | 0.66 |
| PF07479 | NAD_Gly3P_dh_C | 0.66 |
| PF00753 | Lactamase_B | 0.66 |
| PF06739 | SBBP | 0.66 |
| PF12838 | Fer4_7 | 0.66 |
| PF08241 | Methyltransf_11 | 0.66 |
| PF01544 | CorA | 0.66 |
| PF13419 | HAD_2 | 0.66 |
| PF11954 | DUF3471 | 0.66 |
| PF00561 | Abhydrolase_1 | 0.66 |
| PF13650 | Asp_protease_2 | 0.66 |
| PF02811 | PHP | 0.66 |
| PF01120 | Alpha_L_fucos | 0.66 |
| PF00563 | EAL | 0.66 |
| PF00180 | Iso_dh | 0.66 |
| PF03992 | ABM | 0.66 |
| PF13643 | DUF4145 | 0.66 |
| PF14559 | TPR_19 | 0.66 |
| PF02371 | Transposase_20 | 0.66 |
| PF07238 | PilZ | 0.66 |
| PF05697 | Trigger_N | 0.66 |
| PF00255 | GSHPx | 0.66 |
| PF14307 | Glyco_tran_WbsX | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.99 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.66 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.66 |
| COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.66 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.66 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.66 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.66 |
| COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 0.66 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.66 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.60 % |
| Unclassified | root | N/A | 40.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0640396 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
| 3300000789|JGI1027J11758_12651845 | Not Available | 551 | Open in IMG/M |
| 3300001867|JGI12627J18819_10028253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2313 | Open in IMG/M |
| 3300004081|Ga0063454_101761017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 541 | Open in IMG/M |
| 3300004152|Ga0062386_100388786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300004152|Ga0062386_101074372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300005526|Ga0073909_10449630 | Not Available | 615 | Open in IMG/M |
| 3300005541|Ga0070733_10058264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2424 | Open in IMG/M |
| 3300005557|Ga0066704_10244919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1217 | Open in IMG/M |
| 3300005591|Ga0070761_10859106 | Not Available | 572 | Open in IMG/M |
| 3300005712|Ga0070764_10493874 | Not Available | 735 | Open in IMG/M |
| 3300005874|Ga0075288_1025182 | Not Available | 857 | Open in IMG/M |
| 3300005879|Ga0075295_1037245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300006028|Ga0070717_10357613 | Not Available | 1306 | Open in IMG/M |
| 3300006052|Ga0075029_100446859 | Not Available | 847 | Open in IMG/M |
| 3300006052|Ga0075029_100660424 | Not Available | 703 | Open in IMG/M |
| 3300006086|Ga0075019_10004728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7762 | Open in IMG/M |
| 3300006086|Ga0075019_10559434 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300006086|Ga0075019_10861180 | Not Available | 580 | Open in IMG/M |
| 3300006162|Ga0075030_101622384 | Not Available | 506 | Open in IMG/M |
| 3300006173|Ga0070716_100568918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300006174|Ga0075014_100219761 | Not Available | 967 | Open in IMG/M |
| 3300006174|Ga0075014_100669556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300009089|Ga0099828_10792988 | Not Available | 849 | Open in IMG/M |
| 3300009520|Ga0116214_1004256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 5201 | Open in IMG/M |
| 3300009524|Ga0116225_1119639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1212 | Open in IMG/M |
| 3300009525|Ga0116220_10005989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4810 | Open in IMG/M |
| 3300009623|Ga0116133_1073883 | Not Available | 853 | Open in IMG/M |
| 3300009624|Ga0116105_1109555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300009628|Ga0116125_1002040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7798 | Open in IMG/M |
| 3300009638|Ga0116113_1167718 | Not Available | 556 | Open in IMG/M |
| 3300009700|Ga0116217_10643974 | Not Available | 658 | Open in IMG/M |
| 3300009824|Ga0116219_10590183 | Not Available | 611 | Open in IMG/M |
| 3300009839|Ga0116223_10184342 | Not Available | 1282 | Open in IMG/M |
| 3300010046|Ga0126384_11818513 | Not Available | 579 | Open in IMG/M |
| 3300010048|Ga0126373_11427436 | Not Available | 758 | Open in IMG/M |
| 3300010048|Ga0126373_12863507 | Not Available | 538 | Open in IMG/M |
| 3300010358|Ga0126370_10632058 | Not Available | 929 | Open in IMG/M |
| 3300010358|Ga0126370_10699517 | Not Available | 890 | Open in IMG/M |
| 3300010359|Ga0126376_12604818 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300010361|Ga0126378_13440444 | Not Available | 502 | Open in IMG/M |
| 3300010371|Ga0134125_10912865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
| 3300010376|Ga0126381_100777744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1373 | Open in IMG/M |
| 3300010379|Ga0136449_100155123 | All Organisms → cellular organisms → Bacteria | 4479 | Open in IMG/M |
| 3300012349|Ga0137387_10396750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 1000 | Open in IMG/M |
| 3300012350|Ga0137372_10470520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300012354|Ga0137366_10175761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1607 | Open in IMG/M |
| 3300012354|Ga0137366_10449912 | Not Available | 934 | Open in IMG/M |
| 3300012357|Ga0137384_11035784 | Not Available | 659 | Open in IMG/M |
| 3300012469|Ga0150984_123229318 | Not Available | 734 | Open in IMG/M |
| 3300012492|Ga0157335_1002000 | Not Available | 1183 | Open in IMG/M |
| 3300012971|Ga0126369_10210863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1881 | Open in IMG/M |
| 3300012971|Ga0126369_11491523 | Not Available | 766 | Open in IMG/M |
| 3300014164|Ga0181532_10000071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 97746 | Open in IMG/M |
| 3300014165|Ga0181523_10092255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1825 | Open in IMG/M |
| 3300014169|Ga0181531_10881031 | Not Available | 560 | Open in IMG/M |
| 3300014200|Ga0181526_10445502 | Not Available | 821 | Open in IMG/M |
| 3300014654|Ga0181525_10198932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300014657|Ga0181522_10803704 | Not Available | 577 | Open in IMG/M |
| 3300014969|Ga0157376_10790135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300015262|Ga0182007_10187259 | Not Available | 718 | Open in IMG/M |
| 3300016319|Ga0182033_10736860 | Not Available | 865 | Open in IMG/M |
| 3300017822|Ga0187802_10450569 | Not Available | 510 | Open in IMG/M |
| 3300017932|Ga0187814_10343072 | Not Available | 576 | Open in IMG/M |
| 3300017942|Ga0187808_10313872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300017943|Ga0187819_10173802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1278 | Open in IMG/M |
| 3300017948|Ga0187847_10045678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2525 | Open in IMG/M |
| 3300017948|Ga0187847_10741545 | Not Available | 554 | Open in IMG/M |
| 3300017955|Ga0187817_10521529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300017961|Ga0187778_10021213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3985 | Open in IMG/M |
| 3300017961|Ga0187778_10107989 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300017961|Ga0187778_10193438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1295 | Open in IMG/M |
| 3300017972|Ga0187781_10471243 | Not Available | 900 | Open in IMG/M |
| 3300017972|Ga0187781_11324912 | Not Available | 531 | Open in IMG/M |
| 3300017973|Ga0187780_10466811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300017975|Ga0187782_10651776 | Not Available | 810 | Open in IMG/M |
| 3300018006|Ga0187804_10013791 | All Organisms → cellular organisms → Bacteria | 2829 | Open in IMG/M |
| 3300018006|Ga0187804_10457689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 570 | Open in IMG/M |
| 3300018007|Ga0187805_10093155 | Not Available | 1361 | Open in IMG/M |
| 3300018038|Ga0187855_10169390 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300018046|Ga0187851_10054138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2608 | Open in IMG/M |
| 3300018047|Ga0187859_10011474 | All Organisms → cellular organisms → Bacteria | 5068 | Open in IMG/M |
| 3300018062|Ga0187784_10065870 | All Organisms → cellular organisms → Bacteria | 2938 | Open in IMG/M |
| 3300018088|Ga0187771_10591950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
| 3300020579|Ga0210407_10343266 | Not Available | 1168 | Open in IMG/M |
| 3300021088|Ga0210404_10036621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2233 | Open in IMG/M |
| 3300021088|Ga0210404_10399325 | Not Available | 768 | Open in IMG/M |
| 3300021088|Ga0210404_10586675 | Not Available | 633 | Open in IMG/M |
| 3300021168|Ga0210406_10895114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300021168|Ga0210406_11093795 | Not Available | 587 | Open in IMG/M |
| 3300021170|Ga0210400_10008512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8387 | Open in IMG/M |
| 3300021170|Ga0210400_11312319 | Not Available | 579 | Open in IMG/M |
| 3300021171|Ga0210405_10248886 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C1TDCM | 1407 | Open in IMG/M |
| 3300021180|Ga0210396_10108043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2513 | Open in IMG/M |
| 3300021401|Ga0210393_10232996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1492 | Open in IMG/M |
| 3300021403|Ga0210397_10090274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2050 | Open in IMG/M |
| 3300021403|Ga0210397_10281799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1215 | Open in IMG/M |
| 3300021404|Ga0210389_10625354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300021420|Ga0210394_11031409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300021559|Ga0210409_10221025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1720 | Open in IMG/M |
| 3300021559|Ga0210409_11021171 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300021559|Ga0210409_11409387 | Not Available | 573 | Open in IMG/M |
| 3300024220|Ga0224568_1038566 | Not Available | 517 | Open in IMG/M |
| 3300025412|Ga0208194_1037268 | Not Available | 761 | Open in IMG/M |
| 3300025414|Ga0208935_1029580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300025434|Ga0208690_1010311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1913 | Open in IMG/M |
| 3300025612|Ga0208691_1012539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2102 | Open in IMG/M |
| 3300025929|Ga0207664_10914975 | Not Available | 787 | Open in IMG/M |
| 3300025929|Ga0207664_11517733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300025939|Ga0207665_11165401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300026215|Ga0209849_1013129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1365 | Open in IMG/M |
| 3300026333|Ga0209158_1084922 | Not Available | 1228 | Open in IMG/M |
| 3300026490|Ga0257153_1092205 | Not Available | 604 | Open in IMG/M |
| 3300027076|Ga0208860_1034872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300027497|Ga0208199_1021912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1426 | Open in IMG/M |
| 3300027568|Ga0208042_1119306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300027604|Ga0208324_1000925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11888 | Open in IMG/M |
| 3300027879|Ga0209169_10387572 | Not Available | 735 | Open in IMG/M |
| 3300027889|Ga0209380_10232922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300027898|Ga0209067_10182999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300027905|Ga0209415_10047721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5594 | Open in IMG/M |
| 3300027911|Ga0209698_10135062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2033 | Open in IMG/M |
| 3300028792|Ga0307504_10023392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1563 | Open in IMG/M |
| 3300029911|Ga0311361_10703923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300029944|Ga0311352_10751888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300029999|Ga0311339_10961102 | Not Available | 805 | Open in IMG/M |
| 3300030053|Ga0302177_10078012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1948 | Open in IMG/M |
| 3300030707|Ga0310038_10094873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1571 | Open in IMG/M |
| 3300031184|Ga0307499_10333725 | Not Available | 509 | Open in IMG/M |
| 3300031231|Ga0170824_104600854 | Not Available | 859 | Open in IMG/M |
| 3300031231|Ga0170824_122793505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300031239|Ga0265328_10173565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300031249|Ga0265339_10076980 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300031344|Ga0265316_10132868 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
| 3300031715|Ga0307476_10560644 | Not Available | 847 | Open in IMG/M |
| 3300031715|Ga0307476_10809982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300031720|Ga0307469_10466829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300031754|Ga0307475_10015940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5155 | Open in IMG/M |
| 3300031754|Ga0307475_10022576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4450 | Open in IMG/M |
| 3300031754|Ga0307475_11511386 | Not Available | 515 | Open in IMG/M |
| 3300031954|Ga0306926_11084616 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300032076|Ga0306924_11406541 | Not Available | 744 | Open in IMG/M |
| 3300032160|Ga0311301_10323569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2443 | Open in IMG/M |
| 3300032770|Ga0335085_11176553 | Not Available | 817 | Open in IMG/M |
| 3300032892|Ga0335081_10049187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6623 | Open in IMG/M |
| 3300032892|Ga0335081_11106372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300032897|Ga0335071_10011693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8969 | Open in IMG/M |
| 3300032897|Ga0335071_10690723 | Not Available | 970 | Open in IMG/M |
| 3300032897|Ga0335071_11072856 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300033134|Ga0335073_10571897 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300033887|Ga0334790_158924 | Not Available | 674 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.58% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.30% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.30% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.64% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.97% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.97% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.99% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.99% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.99% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.32% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.32% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.66% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.66% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.66% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_06403964 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | QTGIRAFCAEEDAVVRVDPAGVGSSTEAGILTFNPLNQ* |
| JGI1027J11758_126518451 | 3300000789 | Soil | PMILNQTGARAFCTEQDAVVRVDPAGVCSNTEAGILTFNALNQ* |
| JGI12627J18819_100282534 | 3300001867 | Forest Soil | VPITINQTGLRGFCAEEDAVVRVDPAGVCSTTEAGILTFNPLNQ* |
| Ga0063454_1017610171 | 3300004081 | Soil | INQTGLRGFCSEEDAVLRVDPAGVCSNTEAGVLTFNPLNQ* |
| Ga0062386_1003887861 | 3300004152 | Bog Forest Soil | NQTGIRGFCAEEDAVVRVDPAGVCSVTEAGILVFNPLNQ* |
| Ga0062386_1010743721 | 3300004152 | Bog Forest Soil | NQTGIRGFCAEEDAVVRVDPAGVCSVTEAGILTFNPLNQ* |
| Ga0073909_104496302 | 3300005526 | Surface Soil | GVQAIPLSINQTGIRAFCAEEDAVVRVDPAGICSTDEAGILTFNPLNQ* |
| Ga0070733_100582641 | 3300005541 | Surface Soil | VVAIPLQINQTGIRAFCAEEDAVVRVDPAGVCSTTEAGILPFNPLNQ* |
| Ga0066704_102449193 | 3300005557 | Soil | VRAFCAEQDAVVRVDPAGVCSNTEAGILTFNPLNQ* |
| Ga0070761_108591061 | 3300005591 | Soil | NQTGIRGFCAEEDAVIRVDPAGACSNTEAGIQGFNPLNQ* |
| Ga0070764_104938742 | 3300005712 | Soil | SVPLSINQTGIRGFCAEEDAVIRVDPAGACSNTEAGIQGFNPLNQ* |
| Ga0075288_10251821 | 3300005874 | Rice Paddy Soil | TINQTGIRAFCAEEDAVVRVDPAGACSNTEAGILVFNPLNQ* |
| Ga0075295_10372451 | 3300005879 | Rice Paddy Soil | VNQTGIRAFCAEEDAVIRVDPAGVCSATEAGILTFNPLNQ* |
| Ga0070717_103576132 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VPITINQTGIRAFCAEEDAVVRVDPAGVCANTEAGILTFNPLNQ* |
| Ga0075029_1004468592 | 3300006052 | Watersheds | VPITINQTGIRAFCAEEDGVVRVDPAGACANTEAGVLTFNPLNQ* |
| Ga0075029_1006604241 | 3300006052 | Watersheds | RGFCAEEDAVVRVDPAGVCSNTEAGIRTFNPLNQ* |
| Ga0075019_100047281 | 3300006086 | Watersheds | RGFCAEEDAVVRVDPAGVCSTTEAGILTFNPLNQ* |
| Ga0075019_105594341 | 3300006086 | Watersheds | VKAVPITINQTGIRGFCAEEDAVVRVDPAGVCSNTEAGIRIFNPLNQ* |
| Ga0075019_108611801 | 3300006086 | Watersheds | NQTGIRAFCAEEDAVVRVDPAGVCSNTEAGIRTFNPLNQ* |
| Ga0075030_1016223841 | 3300006162 | Watersheds | INQTGIRGFCAEEDAVIRVDPAGVCSNTEAGIQTFNPLNQ* |
| Ga0070716_1005689181 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TGLRGFCAEEDAVVRVDPAGVCSTTEAGILTFNPLNQ* |
| Ga0075014_1002197612 | 3300006174 | Watersheds | IQAAPITVNQTGIRAFCAEEDAVIRVDPAGICSNTEAGIQTFNPLNQ* |
| Ga0075014_1006695561 | 3300006174 | Watersheds | TGLRAFCAEEDAVVRVDPAGVCSTTEAGVLTFNPLNQ* |
| Ga0099828_107929882 | 3300009089 | Vadose Zone Soil | QTGIKGFCAEEDAVLRADAAGVCSATEAGILGFNPLNQ* |
| Ga0116214_10042567 | 3300009520 | Peatlands Soil | VNQTGIRAFCAEEDGVVRVDQGGKCGTTEPTVLTFNPLNQ* |
| Ga0116225_11196391 | 3300009524 | Peatlands Soil | IKAIPLSVNQTGIRGFCAEEDAVIRVDPAGACSSAEAALLAFNPLNQ* |
| Ga0116220_100059891 | 3300009525 | Peatlands Soil | IRAFCAEEDGVVRVDQGGKCGTTEPTVLTFNPLNQ* |
| Ga0116133_10738832 | 3300009623 | Peatland | NQTGIRAFCAEEDAVVRVDPAGVCSTTEAGVLTFNPLNQ* |
| Ga0116105_11095552 | 3300009624 | Peatland | RAFCAEEDAVVRVDPAGVCSTTEAGVLTFNPLNQ* |
| Ga0116125_10020409 | 3300009628 | Peatland | VKGVPITINQTGIRAFCAEEDAVVRVDPAGVCSTTEAGIRVFNPLNQ* |
| Ga0116113_11677181 | 3300009638 | Peatland | KGVPITINQTGIRAFCAEEDAVVRVDPAGACSNAEGTILGFNPLNQ* |
| Ga0116217_106439741 | 3300009700 | Peatlands Soil | NQTGIRAFCAEEDAVVRVDPAGACSTAEATILTFNPLNQ* |
| Ga0116219_105901832 | 3300009824 | Peatlands Soil | GIRGFCAEEDAVVRVDPAGACSNTEAAILAFNPLNQ* |
| Ga0116223_101843421 | 3300009839 | Peatlands Soil | KAIPLSVNQTGIRGFCAEEDAVVRVDPGGACSSAEATVLTFNPLNQ* |
| Ga0126384_118185131 | 3300010046 | Tropical Forest Soil | AAPITVNQTGIRAFCAIEDALIRVDPAGVCSNTEAGIVTFNPLNQ* |
| Ga0126373_114274362 | 3300010048 | Tropical Forest Soil | RGFCAEEDGVVRVDPAGKCSTAEATILTFNPLNQ* |
| Ga0126373_128635071 | 3300010048 | Tropical Forest Soil | VPITVNQTGIRAFCAEEDGVVRVDPAGACSNTEAGILVFNPLNQ* |
| Ga0126370_106320581 | 3300010358 | Tropical Forest Soil | IRAFCAEEDAVVRVDPAGACGTDEATILTFDPLNQ* |
| Ga0126370_106995171 | 3300010358 | Tropical Forest Soil | NQTGIRAFCAEEDAVVRVDPAGLCSNTEAGILTFNSLNQQATV* |
| Ga0126376_126048181 | 3300010359 | Tropical Forest Soil | VQATPITINQTGIRGFCAEEDAVVRVDPAGKCSNTEAGVLTFNPLNQ* |
| Ga0126378_134404442 | 3300010361 | Tropical Forest Soil | LAVPITINQTGIRAFCAEEDAVVRVDPAGVCSDTETGVLTFNPLNQ* |
| Ga0134125_109128652 | 3300010371 | Terrestrial Soil | PLTLNQTGIRGFCAEEDAVLRVDPAGVCSTTEAGILAFNPLNQ* |
| Ga0126381_1007777442 | 3300010376 | Tropical Forest Soil | TGIRAFCAEEDAVVRVDPAGVCSTTEAGILTFNPLNQ* |
| Ga0136449_1001551231 | 3300010379 | Peatlands Soil | GIRGFCAEEDAVIRVDPLGVCSNTEAGIAAFNPLNQ* |
| Ga0137387_103967501 | 3300012349 | Vadose Zone Soil | GCCAEEDAVVRVDPAGVCGSPNPSEGAVLGFNPLTQ* |
| Ga0137372_104705202 | 3300012350 | Vadose Zone Soil | IRGFCAEEDAVLRVDPAGVCGSPNPAEGTVLTFNPLNQ* |
| Ga0137366_101757611 | 3300012354 | Vadose Zone Soil | NQTGLRAFCAEEDAVVRVDPAGVCSNTEAGILTFNPLNQ* |
| Ga0137366_104499122 | 3300012354 | Vadose Zone Soil | GLRAFCAEEDAVVRVDPAGVCSNTEAGILTFNPLNQ* |
| Ga0137384_110357841 | 3300012357 | Vadose Zone Soil | GKPISKNQTGVKAFCAEEDALLRVDPAGLCSATEAGIQGFNPLNQ* |
| Ga0150984_1232293181 | 3300012469 | Avena Fatua Rhizosphere | IRAFCAEEDAVVRVDPAGVGSATEAGILAFNPLNQ* |
| Ga0157335_10020002 | 3300012492 | Arabidopsis Rhizosphere | PITINQTGIRAFCAEEDAVVRVDPAGVCSNTEAGVLTFNPLNQ* |
| Ga0126369_102108631 | 3300012971 | Tropical Forest Soil | RAFCTEQDSVIRVDPAGACSNTEAGILTFNPLNQ* |
| Ga0126369_114915231 | 3300012971 | Tropical Forest Soil | IVGVPMTVNQTGIRAFCAEEDAVIRVDPAGVCSNTEAGILTFNPLNQ* |
| Ga0181532_1000007188 | 3300014164 | Bog | NQTGIRAFCAEEDAVVRVDPAGACSSVEATVLTFNPLNQ* |
| Ga0181523_100922554 | 3300014165 | Bog | IRAFCAEEDAVVRVDPAGACSSVEATVLTFNPLNQ* |
| Ga0181531_108810311 | 3300014169 | Bog | NTINQTGIRGFCAEEDAVVRVDPAGVCSITEAGVLVFNPLNQ* |
| Ga0181526_104455022 | 3300014200 | Bog | VPNTINQTGIRGFCAEEDAVVRVDPAGVCSLTEAGILVFNPLNQ* |
| Ga0181525_101989321 | 3300014654 | Bog | KAVPNTINQTGIRGFCAEEDAVVRVDPAGVCSLTEAGILTFNPLNQ* |
| Ga0181522_108037041 | 3300014657 | Bog | IRGFCAEEDAVVRVDPAGVCSLTEAGILTFNPLNQ* |
| Ga0157376_107901352 | 3300014969 | Miscanthus Rhizosphere | LAINQTGIRAFCAEEDAVVRVDPASACSNSEGGILTFNPLNQ* |
| Ga0182007_101872592 | 3300015262 | Rhizosphere | GIRAFCAEEDAVVRVDPAGVCSATEAGILTFNPLNQ* |
| Ga0182033_107368601 | 3300016319 | Soil | NQTGIRAFCAEEDAVVRVDPAGVCANTEAGVLTFNPLNQ |
| Ga0187802_104505692 | 3300017822 | Freshwater Sediment | TGIRAFCAEEDAVVRVDPAGACSNTEAGVLTFNPLNQ |
| Ga0187814_103430721 | 3300017932 | Freshwater Sediment | PITINQTGIRAFCAEEDAVVRVDPAGACSNTEAGVLTFNPLNQ |
| Ga0187808_103138721 | 3300017942 | Freshwater Sediment | INQTGIRGFCAEEDAVVRVDPAGACSNTEAGVLTFNPLNQ |
| Ga0187819_101738021 | 3300017943 | Freshwater Sediment | INQTGIRAFCAEEDAVVRVDPAGACSNTEAGVLTFNPLNQ |
| Ga0187847_100456781 | 3300017948 | Peatland | IRGFCAEEDAVVRVDPAGVCSVTEAGILVFNPLNQ |
| Ga0187847_107415451 | 3300017948 | Peatland | NTINQTGIRGFCAEEDAVVRVDPAGVCSLTEAGILVFNPLNQ |
| Ga0187817_105215291 | 3300017955 | Freshwater Sediment | PTTVNQTGIRAFCSEEDAVVRVDAAGACSNTEAGVLTFNPLNQ |
| Ga0187778_100212131 | 3300017961 | Tropical Peatland | AVPITINQTGIRAFCAEEDAVVRVDPKGACSNVEATILTFNPLNQ |
| Ga0187778_101079893 | 3300017961 | Tropical Peatland | TINQTGIRAFCAEEDAVVRVDPKGACSNVEATILTFNPLNQ |
| Ga0187778_101934383 | 3300017961 | Tropical Peatland | VMLAVPLTINHTGIRAFCAEEDAVVRVDPAGACSNTEAGVLTFSPLNQ |
| Ga0187781_104712431 | 3300017972 | Tropical Peatland | ASPLTINQTGIRGFCAMEDAVVRVDPAGVCSDTEAGVILFNPLNQ |
| Ga0187781_113249121 | 3300017972 | Tropical Peatland | QTGIRAFCAEEDAVVRVDPAGVCSNTEAGILTFNPLNQ |
| Ga0187780_104668112 | 3300017973 | Tropical Peatland | AQPVTINQTGIRAFCAEEDAVVRVDPLGVCSNDEAGILAFNPLNQ |
| Ga0187782_106517761 | 3300017975 | Tropical Peatland | NQTGIRAFCAEEDAVVRVDPAGVCSNTEAGILTFNPLNQ |
| Ga0187804_100137911 | 3300018006 | Freshwater Sediment | VPITINQTGIRAFCAEEDAVVRVDPAGKCSNTEAGVLTFSPLNQ |
| Ga0187804_104576891 | 3300018006 | Freshwater Sediment | LRAFCAEEDAVVRVDPAGVCSLTEAGILTFNPLNQ |
| Ga0187805_100931551 | 3300018007 | Freshwater Sediment | INQTGIRAFCAEKDAVVRVDPAGACSSAEATILTFNPLNQ |
| Ga0187855_101693901 | 3300018038 | Peatland | GIRAFCAEEDAVVRVDPAGVCSTTEAGIRVFNPLNQ |
| Ga0187851_100541384 | 3300018046 | Peatland | VPNTINQTGIRGFCAEEDAVVRVDPAGVCSLTEAGILVFNPLNQ |
| Ga0187859_100114748 | 3300018047 | Peatland | INQTGIRAFCSEEDAVVRVDPAGVCSTTEAGILTFNPLNQ |
| Ga0187784_100658702 | 3300018062 | Tropical Peatland | MPAGPVAINQTGVRAFCAEEDSVVRVDPAGAGFNTEAGVLTFNPLHQ |
| Ga0187771_105919502 | 3300018088 | Tropical Peatland | NQTGIRAFCSEEDAVVRVDPAGSCSNDENGILPFNPLNQ |
| Ga0210407_103432663 | 3300020579 | Soil | NQTGIRGFCAEEDAVIRVDPAGLCSNTEAGIQTFNPLNQ |
| Ga0210404_100366211 | 3300021088 | Soil | ISAVPLSINQTGIRAFCAEEDAVVRVDPLGACSNAEATILTFNPLNQ |
| Ga0210404_103993252 | 3300021088 | Soil | INQTGIRGFCAEEDAVVRVDPAGACSTAEATILTFNPLNQ |
| Ga0210404_105866751 | 3300021088 | Soil | TINQTGVRGFCAEEDAVVRVAPAGVCSNTEAGIRTFNPLNQ |
| Ga0210406_108951141 | 3300021168 | Soil | VSAVPITINQTGLRGFCAEEDAVVRVDPAGVCSLTEAGILTFNPLNQ |
| Ga0210406_110937951 | 3300021168 | Soil | PITVNQTGIRAFCAEEDAVIRVDPAGICSNTEAGIQTFNPLNQ |
| Ga0210400_100085121 | 3300021170 | Soil | TGIRAFCAEEDAVVRVDPAGVCSNTEGGILPFNPLNQ |
| Ga0210400_113123192 | 3300021170 | Soil | SHNQTGIRGFCAEEDAVIRVDPAGVCSATEGGIAGFNPLNQ |
| Ga0210405_102488861 | 3300021171 | Soil | QTGIRAFCGEEDGVVRVDPAGACSSVEATMLTFNPLNQ |
| Ga0210396_101080431 | 3300021180 | Soil | VPLSINQTGIRGFCAEEDAVIRVDPAGVCSNTEAGIQTFNPLNQ |
| Ga0210393_102329961 | 3300021401 | Soil | GIRAFCAEEDAVVRVDPAGKCSATEAGILAFNPLNQ |
| Ga0210397_100902741 | 3300021403 | Soil | LAINQTGSRGFCAEEDAVVRVDPAGACSTAEATILTFNPLNQ |
| Ga0210397_102817991 | 3300021403 | Soil | GIRGFCAEEDAVVRVDPAGACSNTEAGILVFNPLNQ |
| Ga0210389_106253542 | 3300021404 | Soil | VVAVPLSINQTGIRGFCAEEDAVVRVDPAGACSNTEAGVLTFNPLNQ |
| Ga0210394_110314092 | 3300021420 | Soil | TGIRGFCAEEDAVVRVDPAGACSTAEATILTFNPLNQ |
| Ga0210409_102210253 | 3300021559 | Soil | LNETGVRAFCAEQDAVVRVDPAGVCSNTEAGILTFNPLNQ |
| Ga0210409_110211711 | 3300021559 | Soil | NQTGIRGFCAEEDAVVRVDPAGACSTAEATILTFNPLNQ |
| Ga0210409_114093871 | 3300021559 | Soil | TPLAINQTGIRAFCAEEDAVVRVDPNGACSSVEATVLTFNPLNQ |
| Ga0224568_10385661 | 3300024220 | Plant Litter | VRGVPLSINQTGIRGFCAEEDAVIRVDPAGACSNTEAGILAFNPLNQ |
| Ga0208194_10372682 | 3300025412 | Peatland | TINQTGIRGFCAEEDAVVRVDPAGVCSVTEAGILVFNPLNQ |
| Ga0208935_10295801 | 3300025414 | Peatland | KGVPITINQTGIRAFCAEEDAVVRVDPAGVCSTTEAGVLTFNPLNQ |
| Ga0208690_10103113 | 3300025434 | Peatland | KGVPITINQTGIRAFCAEEDAVVRVDPAGVCSTTEAGIRVFNPLNQ |
| Ga0208691_10125393 | 3300025612 | Peatland | AIPLSVNQTGIRGFCAEEDAVIRVDPAGVCSSTEAGILGFNPLNQ |
| Ga0207664_109149751 | 3300025929 | Agricultural Soil | TPITINQTGIRGFCAEEDSVVRVDAAGKCSNTEAGVLTFNPLNQ |
| Ga0207664_115177332 | 3300025929 | Agricultural Soil | TVNQTGIRAFCAEEDAVIRVDPAGVCSNTEAGIPIFNPLNQ |
| Ga0207665_111654012 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | INQTGLRGFCAEEDAVVRVDPAGVCSTTEAGILTFNPLNQ |
| Ga0209849_10131291 | 3300026215 | Soil | NQTGIRAFCSEEDAVVRVDPAGVCSVTEAGVLAFNPLNQ |
| Ga0209158_10849222 | 3300026333 | Soil | TVAAVPITINQTGLRAFCAEEDAVVRVDPAGVCSLTEAGVLTFNPLNQ |
| Ga0257153_10922051 | 3300026490 | Soil | VNQTGIKGFCAEEDGVVRVDTVTNVCSSTEAGVLGFNPLNN |
| Ga0208860_10348721 | 3300027076 | Forest Soil | QAAPITVNQTGIRAFCAEEDAVIRVDPAGICSNTEAGIQTFNPLNQ |
| Ga0208199_10219122 | 3300027497 | Peatlands Soil | VGYVINAVPITVNQTGIRAFCAEEDGVVRVDQGGKCGTTEPTVLTFNPLNQ |
| Ga0208042_11193062 | 3300027568 | Peatlands Soil | YVINAAPITVNQTGIRAFCAEEDGVVRVDQGGKCGTTEPTVLTFNPLNQ |
| Ga0208324_100092515 | 3300027604 | Peatlands Soil | INAVPITVNQTGIRAFCAEEDGVVRVDQGGKCGTTEPTVLTFNPLNQ |
| Ga0209169_103875722 | 3300027879 | Soil | SVPLSINQTGIRGFCAEEDAVIRVDPAGACSNTEAGIQGFNPLNQ |
| Ga0209380_102329222 | 3300027889 | Soil | IRGFCAEEDAVVRVDPAGVCSTTEAGILPFNPLNQ |
| Ga0209067_101829992 | 3300027898 | Watersheds | ALAVPITINQTGIRAFCAEEDGVVRVDPAGACANTEAGVLTFNPLNQ |
| Ga0209415_100477211 | 3300027905 | Peatlands Soil | IRGFCAEEDAVVRVDPAGACSNTEAAILAFNPLNQ |
| Ga0209698_101350622 | 3300027911 | Watersheds | LAVPISINQTGIRAFCSEEDAVVHVDPAGACSNDEAGILTFVPLNQ |
| Ga0307504_100233923 | 3300028792 | Soil | GVRAFCAEQDAVVRVDPAGVCSNTEAGILTFNPLNQ |
| Ga0311361_107039232 | 3300029911 | Bog | TINQTGIRAFCAEEDAVVRVDPAGVCSTTEAGVLTFNPLNQ |
| Ga0311352_107518882 | 3300029944 | Palsa | IKINQTGIRAFCAEEDAVVRVDPLGVCSKTEAGVLGFNPLNQ |
| Ga0311339_109611021 | 3300029999 | Palsa | FTIKGVPNTINQTGIRAFCAEEDAVVRVDPAGACSSTEAGILTFNPLNQ |
| Ga0302177_100780121 | 3300030053 | Palsa | VPLSINQTGIRGFCAEEDAVVRVDPAGVCSNTEAGILAFNPLNQ |
| Ga0310038_100948731 | 3300030707 | Peatlands Soil | AVPLSINQTGIRGFCAEEDAVVRVDPAGACSNTEAGILAFNPLNQ |
| Ga0307499_103337251 | 3300031184 | Soil | VPITINQTGLRGFCSEEDAVVRVDPAGVCSDTEAGVLTFNPLNQ |
| Ga0170824_1046008542 | 3300031231 | Forest Soil | AGIRGFCAEEDAVVRVDPAGICGTPNPAEGTVLTFNPLNQ |
| Ga0170824_1227935051 | 3300031231 | Forest Soil | RGFCAEEDGVLRVDPAGVCGSPNPSEGAVLGFNPLNQ |
| Ga0265328_101735652 | 3300031239 | Rhizosphere | TGIRGFCAEEDAVVRVDPAGVCSNTEAGVLVFNPLNQ |
| Ga0265339_100769801 | 3300031249 | Rhizosphere | SVNQTGIRGFCAVEDAVIRVDPAGACSNTEAGIVVFNPLNQ |
| Ga0265316_101328681 | 3300031344 | Rhizosphere | ITINQTGIRGFCAEEDAVVRVDPLGKCSNSEAGVLTFNPLNQ |
| Ga0307476_105606442 | 3300031715 | Hardwood Forest Soil | ITVNQTGIRAFCAEEDAVIRVDPAGICSNTEAGIQTFNPLNQ |
| Ga0307476_108099821 | 3300031715 | Hardwood Forest Soil | VKAVPITINQTGLRGFCAEEDAVVRVDPAGVCSTTEAGILTFNPLNQ |
| Ga0307469_104668291 | 3300031720 | Hardwood Forest Soil | ARPLILNETGVRAFCAEQDAVVRVDPAGVCSNTEAGILTFNPLNQ |
| Ga0307475_100159407 | 3300031754 | Hardwood Forest Soil | GIRAFCAEEDAVIRVDPAGICSNTEAGIQTFNPLNQ |
| Ga0307475_100225761 | 3300031754 | Hardwood Forest Soil | VRAFCSIEDAVVRVDPAGVASNTEAGCPVFNPLNQ |
| Ga0307475_115113861 | 3300031754 | Hardwood Forest Soil | NQTGIRAFCAEEDAVVRVDPAGACSNVEATILTFNPLNQ |
| Ga0306926_110846161 | 3300031954 | Soil | APISVNQTGKRAFCAEEDALIRVDPAGVCSNTEAGIPSFNPLNQ |
| Ga0306924_114065411 | 3300032076 | Soil | TGIRAFCAEEDAVVRVDPAGVCANTEAGILTFNPLNQ |
| Ga0311301_103235695 | 3300032160 | Peatlands Soil | QTGIRGFCAEEDAVIRVDPLGVCSNTEAGIAAFNPLNQ |
| Ga0335085_111765531 | 3300032770 | Soil | QTGIRAFCAEEDAVVRVDPAGVCSNTEAGVLTFNPLNQN |
| Ga0335081_100491871 | 3300032892 | Soil | GIRAFCAEEDAVVRVDPAGACSNAEATILTFNPLNQ |
| Ga0335081_111063721 | 3300032892 | Soil | INQTGIRAFCAEEDGVVRVDPAGACSNTEAGVLTFNPLNQ |
| Ga0335071_100116931 | 3300032897 | Soil | GIRAFCAEEDAVIRVDPVGKCSNSEAGILTFNPLNQ |
| Ga0335071_106907231 | 3300032897 | Soil | VIQATPITINQTGLRGFCAEEDSVVRVDAAGKCSNTEAGVLTFNPLNQ |
| Ga0335071_110728561 | 3300032897 | Soil | LTINTTGIRGFCAEEDGVVRVDPAGKCSNTEAGILGFNPLNQ |
| Ga0335073_105718971 | 3300033134 | Soil | IRGFCAEEDGVVRVDPAGKCSNTEAGILGFNPLNQ |
| Ga0334790_158924_561_674 | 3300033887 | Soil | TGIRGFCAEEDAVVRVDPAGVCSATEAGVLAFNPLNQ |
| ⦗Top⦘ |