Basic Information | |
---|---|
Family ID | F046535 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 151 |
Average Sequence Length | 41 residues |
Representative Sequence | RLTDVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA |
Number of Associated Samples | 131 |
Number of Associated Scaffolds | 151 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 4.67 % |
% of genes near scaffold ends (potentially truncated) | 95.36 % |
% of genes from short scaffolds (< 2000 bps) | 93.38 % |
Associated GOLD sequencing projects | 126 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.73 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (58.940 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (41.060 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.437 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.344 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.73 |
Powered by PDBe Molstar |
SCOP family | SCOP domain | Representative PDB | TM-score |
---|---|---|---|
f.5.1.0: automated matches | d1yc9a_ | 1yc9 | 0.88461 |
f.5.1.0: automated matches | d3pika_ | 3pik | 0.87347 |
a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain | d3bqoa_ | 3bqo | 0.86337 |
a.204.1.4: HisE-like (PRA-PH) | d1y6xa1 | 1y6x | 0.85825 |
a.30.7.1: BAS1536-like | d2c0sa1 | 2c0s | 0.85636 |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 151 Family Scaffolds |
---|---|---|
PF00732 | GMC_oxred_N | 47.02 |
PF05199 | GMC_oxred_C | 6.62 |
PF13374 | TPR_10 | 1.99 |
PF13424 | TPR_12 | 1.99 |
PF01921 | tRNA-synt_1f | 1.99 |
PF00106 | adh_short | 0.66 |
PF08223 | PaaX_C | 0.66 |
PF05222 | AlaDh_PNT_N | 0.66 |
PF04075 | F420H2_quin_red | 0.66 |
PF07931 | CPT | 0.66 |
COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
---|---|---|---|
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 53.64 |
COG1384 | Lysyl-tRNA synthetase, class I | Translation, ribosomal structure and biogenesis [J] | 1.99 |
COG3327 | DNA-binding transcriptional regulator PaaX (phenylacetic acid degradation) | Transcription [K] | 0.66 |
COG3896 | Chloramphenicol 3-O-phosphotransferase | Defense mechanisms [V] | 0.66 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 58.94 % |
All Organisms | root | All Organisms | 41.06 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001648|JGI20242J16303_103040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 828 | Open in IMG/M |
3300004091|Ga0062387_100821724 | Not Available | 695 | Open in IMG/M |
3300004092|Ga0062389_103508338 | Not Available | 588 | Open in IMG/M |
3300005435|Ga0070714_102470366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
3300005437|Ga0070710_10560170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
3300005533|Ga0070734_10274192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 966 | Open in IMG/M |
3300005537|Ga0070730_10905541 | Not Available | 552 | Open in IMG/M |
3300005541|Ga0070733_10980220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
3300005542|Ga0070732_10679094 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300005554|Ga0066661_10515442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 721 | Open in IMG/M |
3300005591|Ga0070761_10780798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
3300005602|Ga0070762_10373330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
3300005610|Ga0070763_10306329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 874 | Open in IMG/M |
3300005610|Ga0070763_10598809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
3300005764|Ga0066903_109144883 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300006174|Ga0075014_100440292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
3300006176|Ga0070765_100882238 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300006755|Ga0079222_10081526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1633 | Open in IMG/M |
3300006804|Ga0079221_11679823 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300006861|Ga0063777_1453427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
3300009520|Ga0116214_1155997 | Not Available | 851 | Open in IMG/M |
3300009523|Ga0116221_1255501 | Not Available | 757 | Open in IMG/M |
3300009683|Ga0116224_10308527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 753 | Open in IMG/M |
3300009683|Ga0116224_10616657 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300009792|Ga0126374_10782695 | Not Available | 727 | Open in IMG/M |
3300009824|Ga0116219_10771466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
3300009839|Ga0116223_10876312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica | 512 | Open in IMG/M |
3300010366|Ga0126379_13738498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
3300010867|Ga0126347_1086684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
3300011120|Ga0150983_13029446 | Not Available | 641 | Open in IMG/M |
3300011270|Ga0137391_10992361 | Not Available | 684 | Open in IMG/M |
3300012089|Ga0153924_1086333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 627 | Open in IMG/M |
3300012212|Ga0150985_112101327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4158 | Open in IMG/M |
3300012356|Ga0137371_10370165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1113 | Open in IMG/M |
3300012958|Ga0164299_11377905 | Not Available | 544 | Open in IMG/M |
3300012971|Ga0126369_10570132 | Not Available | 1199 | Open in IMG/M |
3300015357|Ga0134072_10383777 | Not Available | 549 | Open in IMG/M |
3300015372|Ga0132256_103784576 | Not Available | 509 | Open in IMG/M |
3300016294|Ga0182041_11899682 | Not Available | 553 | Open in IMG/M |
3300016371|Ga0182034_11282433 | Not Available | 639 | Open in IMG/M |
3300016387|Ga0182040_10650293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 858 | Open in IMG/M |
3300017926|Ga0187807_1324674 | Not Available | 514 | Open in IMG/M |
3300017932|Ga0187814_10321422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
3300017933|Ga0187801_10386083 | Not Available | 580 | Open in IMG/M |
3300017937|Ga0187809_10386038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300017942|Ga0187808_10144305 | Not Available | 1047 | Open in IMG/M |
3300017961|Ga0187778_10109536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1721 | Open in IMG/M |
3300017972|Ga0187781_11395002 | Not Available | 518 | Open in IMG/M |
3300017972|Ga0187781_11493484 | Not Available | 501 | Open in IMG/M |
3300017973|Ga0187780_11183551 | Not Available | 560 | Open in IMG/M |
3300017975|Ga0187782_10991050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
3300017975|Ga0187782_11427317 | Not Available | 544 | Open in IMG/M |
3300018033|Ga0187867_10242933 | Not Available | 1016 | Open in IMG/M |
3300018058|Ga0187766_10618327 | Not Available | 741 | Open in IMG/M |
3300020581|Ga0210399_10249706 | Not Available | 1479 | Open in IMG/M |
3300020582|Ga0210395_10107735 | Not Available | 2062 | Open in IMG/M |
3300020583|Ga0210401_10137658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2285 | Open in IMG/M |
3300020583|Ga0210401_10278578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas humilata | 1532 | Open in IMG/M |
3300020583|Ga0210401_11623545 | Not Available | 504 | Open in IMG/M |
3300021181|Ga0210388_11013403 | Not Available | 711 | Open in IMG/M |
3300021403|Ga0210397_10066638 | Not Available | 2348 | Open in IMG/M |
3300021407|Ga0210383_10245043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1537 | Open in IMG/M |
3300021407|Ga0210383_10400918 | Not Available | 1183 | Open in IMG/M |
3300021474|Ga0210390_10569951 | Not Available | 951 | Open in IMG/M |
3300021477|Ga0210398_10720299 | Not Available | 806 | Open in IMG/M |
3300021559|Ga0210409_10511972 | Not Available | 1064 | Open in IMG/M |
3300022467|Ga0224712_10426868 | Not Available | 634 | Open in IMG/M |
3300022529|Ga0242668_1095857 | Not Available | 596 | Open in IMG/M |
3300022531|Ga0242660_1029847 | Not Available | 1090 | Open in IMG/M |
3300022721|Ga0242666_1099164 | Not Available | 672 | Open in IMG/M |
3300025929|Ga0207664_10159438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1923 | Open in IMG/M |
3300025938|Ga0207704_10141818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1682 | Open in IMG/M |
3300025945|Ga0207679_11734386 | Not Available | 571 | Open in IMG/M |
3300027073|Ga0208366_1016018 | Not Available | 812 | Open in IMG/M |
3300027096|Ga0208099_1041674 | Not Available | 658 | Open in IMG/M |
3300027158|Ga0208725_1060538 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300027568|Ga0208042_1174085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
3300027765|Ga0209073_10523734 | Not Available | 502 | Open in IMG/M |
3300027842|Ga0209580_10413018 | Not Available | 673 | Open in IMG/M |
3300027853|Ga0209274_10468206 | Not Available | 652 | Open in IMG/M |
3300027895|Ga0209624_10073222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2212 | Open in IMG/M |
3300027908|Ga0209006_11104569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
3300028759|Ga0302224_10301930 | Not Available | 643 | Open in IMG/M |
3300028811|Ga0307292_10307215 | Not Available | 665 | Open in IMG/M |
3300028877|Ga0302235_10363401 | Not Available | 622 | Open in IMG/M |
3300029636|Ga0222749_10321660 | Not Available | 804 | Open in IMG/M |
3300029943|Ga0311340_11026323 | Not Available | 676 | Open in IMG/M |
3300030053|Ga0302177_10339980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → environmental samples → uncultured Solirubrobacterales bacterium | 794 | Open in IMG/M |
3300030580|Ga0311355_10841565 | Not Available | 838 | Open in IMG/M |
3300030906|Ga0302314_11488665 | Not Available | 612 | Open in IMG/M |
3300031231|Ga0170824_102537149 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
3300031543|Ga0318516_10339338 | Not Available | 867 | Open in IMG/M |
3300031543|Ga0318516_10435797 | Not Available | 754 | Open in IMG/M |
3300031543|Ga0318516_10558855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
3300031543|Ga0318516_10732618 | Not Available | 560 | Open in IMG/M |
3300031543|Ga0318516_10814134 | Not Available | 527 | Open in IMG/M |
3300031549|Ga0318571_10338011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300031561|Ga0318528_10298447 | Not Available | 865 | Open in IMG/M |
3300031564|Ga0318573_10303735 | Not Available | 854 | Open in IMG/M |
3300031572|Ga0318515_10473857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
3300031572|Ga0318515_10483825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus pulveris | 661 | Open in IMG/M |
3300031640|Ga0318555_10381920 | Not Available | 763 | Open in IMG/M |
3300031640|Ga0318555_10614661 | Not Available | 588 | Open in IMG/M |
3300031640|Ga0318555_10674476 | Not Available | 559 | Open in IMG/M |
3300031679|Ga0318561_10730076 | Not Available | 544 | Open in IMG/M |
3300031681|Ga0318572_10445088 | Not Available | 771 | Open in IMG/M |
3300031681|Ga0318572_10556905 | Not Available | 683 | Open in IMG/M |
3300031715|Ga0307476_11317684 | Not Available | 527 | Open in IMG/M |
3300031718|Ga0307474_10403743 | Not Available | 1064 | Open in IMG/M |
3300031718|Ga0307474_10552191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 905 | Open in IMG/M |
3300031748|Ga0318492_10013136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3447 | Open in IMG/M |
3300031753|Ga0307477_10553633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 778 | Open in IMG/M |
3300031765|Ga0318554_10204445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1124 | Open in IMG/M |
3300031765|Ga0318554_10443849 | Not Available | 735 | Open in IMG/M |
3300031769|Ga0318526_10112331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1094 | Open in IMG/M |
3300031770|Ga0318521_10424936 | Not Available | 794 | Open in IMG/M |
3300031778|Ga0318498_10226784 | Not Available | 845 | Open in IMG/M |
3300031781|Ga0318547_10416956 | Not Available | 825 | Open in IMG/M |
3300031793|Ga0318548_10388179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 685 | Open in IMG/M |
3300031799|Ga0318565_10157745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1101 | Open in IMG/M |
3300031805|Ga0318497_10079860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1731 | Open in IMG/M |
3300031805|Ga0318497_10220584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1049 | Open in IMG/M |
3300031819|Ga0318568_10173591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1324 | Open in IMG/M |
3300031819|Ga0318568_10372177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 890 | Open in IMG/M |
3300031823|Ga0307478_11143061 | Not Available | 649 | Open in IMG/M |
3300031831|Ga0318564_10499338 | Not Available | 528 | Open in IMG/M |
3300031846|Ga0318512_10210997 | Not Available | 951 | Open in IMG/M |
3300031879|Ga0306919_11504536 | Not Available | 507 | Open in IMG/M |
3300031896|Ga0318551_10259609 | Not Available | 972 | Open in IMG/M |
3300031897|Ga0318520_10328457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 925 | Open in IMG/M |
3300031912|Ga0306921_10248698 | Not Available | 2083 | Open in IMG/M |
3300031959|Ga0318530_10497786 | Not Available | 506 | Open in IMG/M |
3300032009|Ga0318563_10562873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
3300032039|Ga0318559_10348219 | Not Available | 689 | Open in IMG/M |
3300032043|Ga0318556_10510991 | Not Available | 628 | Open in IMG/M |
3300032043|Ga0318556_10746624 | Not Available | 509 | Open in IMG/M |
3300032051|Ga0318532_10279750 | Not Available | 592 | Open in IMG/M |
3300032055|Ga0318575_10510269 | Not Available | 610 | Open in IMG/M |
3300032060|Ga0318505_10344308 | Not Available | 704 | Open in IMG/M |
3300032065|Ga0318513_10228565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 899 | Open in IMG/M |
3300032066|Ga0318514_10134216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1276 | Open in IMG/M |
3300032089|Ga0318525_10379833 | Not Available | 724 | Open in IMG/M |
3300032160|Ga0311301_10800398 | Not Available | 1295 | Open in IMG/M |
3300032261|Ga0306920_100353122 | Not Available | 2187 | Open in IMG/M |
3300032805|Ga0335078_10778948 | Not Available | 1170 | Open in IMG/M |
3300032897|Ga0335071_11885114 | Not Available | 541 | Open in IMG/M |
3300032955|Ga0335076_10100870 | All Organisms → cellular organisms → Bacteria | 2814 | Open in IMG/M |
3300033158|Ga0335077_10761818 | Not Available | 990 | Open in IMG/M |
3300033290|Ga0318519_10233623 | Not Available | 1059 | Open in IMG/M |
3300034819|Ga0373958_0174815 | Not Available | 550 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 41.06% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.96% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.64% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.97% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.97% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.97% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.31% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.31% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.31% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.99% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.99% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.32% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.32% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.66% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.66% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.66% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.66% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.66% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.66% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.66% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.66% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.66% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.66% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.66% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001648 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006861 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI20242J16303_1030402 | 3300001648 | Forest Soil | EGVAVLQRALADAERYLGPDHPMTQTVRGSLDAATRT* |
Ga0062387_1008217241 | 3300004091 | Bog Forest Soil | RLMEGVAVLQRALADSERYLGSDHPMTQTVRGNLDAATRT* |
Ga0062389_1035083381 | 3300004092 | Bog Forest Soil | GGRLMEGVAVLQRALADSERYLGSDHPMTQTVRGNLDAATRT* |
Ga0070714_1024703661 | 3300005435 | Agricultural Soil | AYYLAGRLTDVVTVLERALADCREHLGPGHPMTQTVQANLDAALP* |
Ga0070710_105601701 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AAGRLTEVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA* |
Ga0070734_102741922 | 3300005533 | Surface Soil | AGRLADVVAVLQRALTDCERYLGADHQMTQTVRENLDAATQA* |
Ga0070730_109055411 | 3300005537 | Surface Soil | RLMEGVAVLQRALSDAERYLGPDHPMTQTVRADLDAATRT* |
Ga0070733_109802202 | 3300005541 | Surface Soil | AYYTVGRLSDVVAVLQRALSDCERYLGPDHEMTETVRRNLDAATQI* |
Ga0070732_106790941 | 3300005542 | Surface Soil | SDVVAVLQRALSDCERYLGPDHEMTETVRRNLDAATQI* |
Ga0066661_105154421 | 3300005554 | Soil | VVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA* |
Ga0070761_107807982 | 3300005591 | Soil | LSAVVSVLQRALADCEQYLGPDHEMTQTVRENLDAATQA* |
Ga0070762_103733301 | 3300005602 | Soil | YAGGRLTEGVAVLQRALADAERHLGPDHPMTQTVRGNLDAATRT* |
Ga0070763_103063291 | 3300005610 | Soil | MEGVAVLQRALADAERYLGPDHPMTQTVRGSLDAATRT* |
Ga0070763_105988092 | 3300005610 | Soil | VTVLQRALTDCERYLGPDHQMTQTVRENLDAATQA* |
Ga0066903_1091448832 | 3300005764 | Tropical Forest Soil | AVLQRALTDCERYLGPDHQMTDTVRANLDAATQV* |
Ga0075014_1004402921 | 3300006174 | Watersheds | TDVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA* |
Ga0070765_1008822382 | 3300006176 | Soil | VVSVLQRALTDCEWYLGPDHEMTQTVRENLDAATQA* |
Ga0079222_100815261 | 3300006755 | Agricultural Soil | TAGRLADVVSVLQRALTDCERYLGPDHQMTQTVRANLDAATQA* |
Ga0079221_116798231 | 3300006804 | Agricultural Soil | AVFQRALDDCERYLGPGHQMTQAVRENLDAATPS* |
Ga0063777_14534272 | 3300006861 | Peatlands Soil | DVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA* |
Ga0116214_11559972 | 3300009520 | Peatlands Soil | RLTDVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA* |
Ga0116221_12555012 | 3300009523 | Peatlands Soil | SDVVSVLQRALVDCERYLGPDHQMTQTVRENLDAATQA* |
Ga0116224_103085271 | 3300009683 | Peatlands Soil | GRLTDVVAVLQRALTDCERYLGPDDQMTQTVRENLDAATQA* |
Ga0116224_106166572 | 3300009683 | Peatlands Soil | MEVVAVPQRALADSERYLGPDHPMTKTVRDNLEAATRT* |
Ga0126374_107826952 | 3300009792 | Tropical Forest Soil | VAVLQRALTDCERYLGPDHQMTDTVRANLDAATQA* |
Ga0116219_107714661 | 3300009824 | Peatlands Soil | YTAGRLTDVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA* |
Ga0116223_108763122 | 3300009839 | Peatlands Soil | YYTAGRLTEVVVVLRRALTDCERYLGADHQMTQTVRANLDAAIQT* |
Ga0126379_137384982 | 3300010366 | Tropical Forest Soil | YYTAGRLTDVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA* |
Ga0126347_10866841 | 3300010867 | Boreal Forest Soil | DVVSVLQRALTDCERYLGPDHEMTQTVRQNLDAATQA* |
Ga0150983_130294462 | 3300011120 | Forest Soil | RLTEVVAVLQRALTDCERYLGPDDQMTQTVRENLDAATQA* |
Ga0137391_109923611 | 3300011270 | Vadose Zone Soil | TAYYTAGRLADVVAVLQRALSDCEHYLGPDHQMTQTVRENLDAATQA* |
Ga0153924_10863331 | 3300012089 | Attine Ant Fungus Gardens | ASAYYTVGRLSDVVAVLQRALSDCERYLGPDHQMTQTVRENLDAATQV* |
Ga0150985_1121013275 | 3300012212 | Avena Fatua Rhizosphere | LATAYYTAGRLADVVAVLQRALSDCERYLGPDHQMTQTVRENLDAATQA* |
Ga0137371_103701652 | 3300012356 | Vadose Zone Soil | AGRLTEVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA* |
Ga0164299_113779051 | 3300012958 | Soil | VVAVLQRALTDCERYLGPDHQMTDTVRANLEAATQV* |
Ga0126369_105701322 | 3300012971 | Tropical Forest Soil | RLTDVVTVLRRALADCQQYLGPDHPMTSTVRENLQAATELRFR* |
Ga0134072_103837772 | 3300015357 | Grasslands Soil | YYTAGRLAEVVTVLQRALTDCERYLGPDHQMTDTVRANLDAATQV* |
Ga0132256_1037845761 | 3300015372 | Arabidopsis Rhizosphere | DVVTVLERALADCREHLGPGHPMTQTVQENLDAALP* |
Ga0182041_118996821 | 3300016294 | Soil | TAYYAARRLTDVVTVLRRALADCQQYLGPDHPMTSTVRENLQAATE |
Ga0182034_112824331 | 3300016371 | Soil | GRLLEAVAVLQRALADSEHYLGRDHPMTKTVRDNLGAATQT |
Ga0182040_106502931 | 3300016387 | Soil | EAVAVLQRALADSEHYLGLDHPMTKTVRDNLDAATRT |
Ga0187807_13246741 | 3300017926 | Freshwater Sediment | TAGRLSDVVSILQRALTDCEHYLGPDHQMTQTVRENLDAATQT |
Ga0187814_103214221 | 3300017932 | Freshwater Sediment | LSDVVAVLQRALTDCERYLGPDHLMTQTVRENLDEATKT |
Ga0187801_103860831 | 3300017933 | Freshwater Sediment | LMEAVAVLQRALADSERYRGPDHPMTKTMRDNLDAATRT |
Ga0187809_103860382 | 3300017937 | Freshwater Sediment | AGRLSDVVAILQRALSDCERYLGPDHPMTQTVRQNLDAATQA |
Ga0187808_101443051 | 3300017942 | Freshwater Sediment | TVGRLSDVVAVLQRALTDCERYLGPDHPMTQTVRLNLDAATQT |
Ga0187778_101095361 | 3300017961 | Tropical Peatland | SEARRRALADSEHFLGPDHPMTKTVRDNLDEATRT |
Ga0187781_113950021 | 3300017972 | Tropical Peatland | GGRLMEAITALQRALADSERFLGLDHPMTKTVRDNLDEATRT |
Ga0187781_114934841 | 3300017972 | Tropical Peatland | TTRASLASALYAGGRLMEVIAVLQRALADAERYLGPDHLMTKTIRENIDAATQT |
Ga0187780_111835511 | 3300017973 | Tropical Peatland | LTDVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA |
Ga0187782_109910502 | 3300017975 | Tropical Peatland | AYYIVGRLTDVVVVLRHALADCERYLGPDHPMTQTVRVNLDAATQT |
Ga0187782_114273172 | 3300017975 | Tropical Peatland | GRLADVVTVLQRALTDCERYLGPDHHMTQTVRENLDAATQS |
Ga0187867_102429332 | 3300018033 | Peatland | VRTAGRLADVVVVLQRALSDCEKYLGADHQLTQTVRENLDAATQA |
Ga0187766_106183273 | 3300018058 | Tropical Peatland | SDVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQS |
Ga0210399_102497062 | 3300020581 | Soil | AGRLADVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA |
Ga0210395_101077352 | 3300020582 | Soil | AVVSVLQRALTDCEWYLGPDHEMTQTVRENLDAATQA |
Ga0210401_101376583 | 3300020583 | Soil | AGRMTDGVKVLRRALADCERYLGADHPVTSTVRDNLQAATE |
Ga0210401_102785781 | 3300020583 | Soil | VVMILQRVLTDCERYLGPDHPMTQTVRVNLDAATLT |
Ga0210401_116235452 | 3300020583 | Soil | TKEAVKVLRRALADCERYLGPDHAMTSTVRENLQAATE |
Ga0210388_110134031 | 3300021181 | Soil | YYSAGRLADVVAVLQRALTDCERYLGPDDQMTQTVRENLDAATQA |
Ga0210397_100666381 | 3300021403 | Soil | VSVLQRALTDCEWYLGPDHEMTQTVRENLDAATQA |
Ga0210383_102450432 | 3300021407 | Soil | ALYAGGRLMEGVAVLQRALADAERYLGPDHPMTQTVRDSLDAATRT |
Ga0210383_104009181 | 3300021407 | Soil | VAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA |
Ga0210390_105699512 | 3300021474 | Soil | RLTDVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA |
Ga0210398_107202992 | 3300021477 | Soil | LADVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA |
Ga0210409_105119722 | 3300021559 | Soil | VVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA |
Ga0224712_104268682 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VLRRALTDCERYLGPDHPMTSTVKENLQAATELQAL |
Ga0242668_10958572 | 3300022529 | Soil | ASALYAGGRLMEGVAVLQRALADAERYLGPDHPMTQTVRSSLDAATRT |
Ga0242660_10298471 | 3300022531 | Soil | EVVAVLQRTLTDCERYLGPDHQMTQTVRENLDAATQA |
Ga0242666_10991641 | 3300022721 | Soil | RLAVLQRALPHCERYLGPDHQMTHTVRENLDEATKT |
Ga0207664_101594382 | 3300025929 | Agricultural Soil | LTDVVTVLERALADCREHLGPGHPMTQTVQENLDAALP |
Ga0207704_101418181 | 3300025938 | Miscanthus Rhizosphere | AYYTAGRLTDVVAVLQRALTDCERYLGPDHQMTDTVRANLEAATQV |
Ga0207679_117343862 | 3300025945 | Corn Rhizosphere | ADVVAVLRRALADCERYLGPDHQMTQTVRENLDAATQA |
Ga0208366_10160182 | 3300027073 | Forest Soil | VAMLQRALADAERYLGQDHPMTQTVRGNLDAATRT |
Ga0208099_10416741 | 3300027096 | Forest Soil | YAGGRLMEVVAVLQRALADSERYLGPDHPMTKTVRGNLDAATQT |
Ga0208725_10605382 | 3300027158 | Forest Soil | RLTDAVKTLRRTLADCERHLGPDHPMTSTVRDHLQAATR |
Ga0208042_11740852 | 3300027568 | Peatlands Soil | LTDVVAVLQRALTDCERYLGPDDQMTQTVRENLDAATQA |
Ga0209073_105237342 | 3300027765 | Agricultural Soil | AGRLTDVVAVLQRALTDCERYLGPDHQMTDTVRANLEAATQV |
Ga0209580_104130182 | 3300027842 | Surface Soil | SAYYTVGRLSDVVAVLQRALSDCERYLGPDHEMTETVRRNLDAATQI |
Ga0209274_104682062 | 3300027853 | Soil | TVGRLSAVVSVLQRALADCEQYLGPDHEMTQTVRENLDAATQA |
Ga0209624_100732224 | 3300027895 | Forest Soil | RLSEVVTVLQRALSDCERYLGPDHQMTQTVRENLDAATQI |
Ga0209006_111045691 | 3300027908 | Forest Soil | EAVKVLRRALADCERYLGPDHAITRTVRDSLQAATE |
Ga0302224_103019301 | 3300028759 | Palsa | TAGRLSDVVSVLQRALTDCERYLGPDHQMTQTVRQNLDAATQA |
Ga0307292_103072152 | 3300028811 | Soil | DVVAVLQRALTDCERYLGPDHQMTDTVRANLEAATQV |
Ga0302235_103634011 | 3300028877 | Palsa | YAGGRLMEVITVLQRALADAERYLGPDHAMTQAIRGNLEAATQT |
Ga0222749_103216601 | 3300029636 | Soil | RVSLASALYAGGRLMEGVAVLQRALADAERYLGPDHPMTQTVRGSVDAATRT |
Ga0311340_110263231 | 3300029943 | Palsa | RLVEVIAVLQRALADAERYLGPDHPMTQAIRGNLGAATQT |
Ga0302177_103399802 | 3300030053 | Palsa | AVKVLGRTMADCERHLGPDHPMTGTVRDHLRAATQ |
Ga0311355_108415652 | 3300030580 | Palsa | AYYAAGRLNDVVLVLQRALSDCEKYLGPDHQMTQTVRENLDAATQA |
Ga0302314_114886651 | 3300030906 | Palsa | LQLAYYTAGRLTDVVLVLRRALGDCEKYLGPDHQMTQTVRENLDAATQA |
Ga0170824_1025371491 | 3300031231 | Forest Soil | MTDGVKMLRRTLADCERYLGADHPMTKTVRDNLKTAAD |
Ga0318516_103393381 | 3300031543 | Soil | VVSVLRRALADCEQYLGPDHSMTSTVRENLKAASE |
Ga0318516_104357971 | 3300031543 | Soil | GGRLLEAVEVLQRALADSEHYLGPDHPMTKTVRDSLDAATRT |
Ga0318516_105588552 | 3300031543 | Soil | MVSALRRALADAEQYLGPDHPMTGTVRENLRAAAD |
Ga0318516_107326181 | 3300031543 | Soil | SEVVSVLQRALTDCERYLGPDHQMTQTVRVNLDAATQA |
Ga0318516_108141341 | 3300031543 | Soil | LDAVAVLQRALADSEHYLGPDHPMTKTVRDNLDAATQT |
Ga0318571_103380111 | 3300031549 | Soil | YTAGRLTDVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA |
Ga0318528_102984472 | 3300031561 | Soil | RLMEAVAVLQRTLADSEHYLGLDHPMTKTVRDNLDAATRT |
Ga0318573_103037352 | 3300031564 | Soil | SDVVSVLQRALVDCELYLGADHQMTQTVRENLDAATQT |
Ga0318515_104738572 | 3300031572 | Soil | VVTVLRRALADCQRYLGPDHPMTSTVRENLQAATE |
Ga0318515_104838251 | 3300031572 | Soil | LASALYAGGRLMEAVAVLQRTLADSEHYLGLDHPMTKTVRDNLDAATRT |
Ga0318555_103819202 | 3300031640 | Soil | YTVGRLSEVVTVLQRALVDCERYLGPDHQMTQTVRENLDAATQS |
Ga0318555_106146612 | 3300031640 | Soil | YYTAGRLSDVVAILQRALTDCERYLGADHQMTQTVRQNLDAATQA |
Ga0318555_106744761 | 3300031640 | Soil | YAGGRLLEAVEVLQRALADSEHYLGPDHPMTKTVRDSLDAATRT |
Ga0318561_107300761 | 3300031679 | Soil | GRLLEAVAALQRALADSEHYLGRDHPMTKTVRDNLGAATQT |
Ga0318574_109542071 | 3300031680 | Soil | AGRLSDVVGVLRRALADCEQYLGPDHSMTSTVRENLKAASE |
Ga0318572_104450881 | 3300031681 | Soil | DVVAILQRALTDCERYLGPDHQMTQTVRQNLDAATQA |
Ga0318572_105569051 | 3300031681 | Soil | GRLLDAVAVLQRALADSEHYLGPEHPMTKTVRDNLGAATQT |
Ga0307476_113176841 | 3300031715 | Hardwood Forest Soil | VSLASALYAGGRLMEGVAVLQRALADAERYLGPDHPMTQTVRDSLDAATRT |
Ga0307474_104037432 | 3300031718 | Hardwood Forest Soil | LMEVVAVLQRALADSERYLGPDHPLTAAARDNLEAASRN |
Ga0307474_105521911 | 3300031718 | Hardwood Forest Soil | RVSLASALYAGGRLMEGVAVLQRALADAERYLGPDHPMTQTVRDSLDAATRT |
Ga0318492_100131363 | 3300031748 | Soil | ASALYAGGRLLEAVAVLQRALADSEHYLGRDHPMTKTVRDNLGAATQT |
Ga0307477_105536331 | 3300031753 | Hardwood Forest Soil | VSLASALYAGGRLMEGVAVLRRALGDAELYLGPDHPMTQTVRGSLDAATRT |
Ga0318554_102044451 | 3300031765 | Soil | LYAGGRVIEAVAVLQRALADSEHYLGLDHPMTKTVRDNLDAATRT |
Ga0318554_104438492 | 3300031765 | Soil | VVGVLRRALADCEQYLGPDHSMTSTVRENLKAASE |
Ga0318526_101123311 | 3300031769 | Soil | GRLMEAVAALQRSLADSEHYLGPDHPMTKTVRDNLEAARQT |
Ga0318521_104249362 | 3300031770 | Soil | AVAVLQRALADSEHYLGPEHPMTKTVRDNLGAATQT |
Ga0318498_102267841 | 3300031778 | Soil | ALYAGGRLTEVVAVLQRALADSERYLGPDHPMTKTLRDNLGAARS |
Ga0318547_104169562 | 3300031781 | Soil | LEAVAVLQRALADSEHYLGPEHPMTKTVRDNLGAATQT |
Ga0318548_103881791 | 3300031793 | Soil | SDVVSLLQRALTDCEHYLGPDHQMTQTVRVNLDAATQA |
Ga0318565_101577452 | 3300031799 | Soil | LYAGGRLMEAVAVLQRTLADSEHYLGLDHPMTKTVRDNLDAATRT |
Ga0318497_100798602 | 3300031805 | Soil | RTSLASALYAGGRVIEAVAVLHRALADSEHYLGLDHPMTKTVRDNLDAATRT |
Ga0318497_102205842 | 3300031805 | Soil | GGRLMEAVAVLQRALADSEHYLGPDHPMTKTVRDNLDAATQT |
Ga0318568_101735911 | 3300031819 | Soil | LEAVEVLQRALADSEHYLGPDHPMTKTVRDSLDAATRT |
Ga0318568_103721771 | 3300031819 | Soil | SLASALYAGGRLMEAVAVLQRTLADSEHYLGLDHPMTKTVRDNLDAATRT |
Ga0307478_111430611 | 3300031823 | Hardwood Forest Soil | VAVLQRALADAERHLGPDHPMTQTVRGNLDAATRT |
Ga0318564_104993382 | 3300031831 | Soil | VVAVLQRALTDCERHLGPDHQMTDTVRANLEAATQV |
Ga0318512_102109971 | 3300031846 | Soil | GRLSDVVSVLQRALVDCELYLGADHQMTQTVRENLDAATQT |
Ga0306919_115045362 | 3300031879 | Soil | SAYYTVGRLSDVVSVLQRALVDCELYLGADHQMTQTVRENLDAATQT |
Ga0318551_102596092 | 3300031896 | Soil | VLRRALADCQQYLGPDHPMTSTVRENLQAATELRFP |
Ga0318520_103284571 | 3300031897 | Soil | ASALYAGGRLMEAVAVLQRTLADSEHYLGLDHPMTKTVRDNLDAATRT |
Ga0306921_102486982 | 3300031912 | Soil | AGRLSEVVSVLQRALTDCERYLGPDHQMTQTVRVNLDAATQA |
Ga0318530_104977861 | 3300031959 | Soil | LDAVAVLQRALADSEHYLGPEHPMTKTVRDNLGAATQT |
Ga0318563_105628731 | 3300032009 | Soil | YYTAGRLSDVVAILQRALTDCERYLGPDHQMTQTVRENLDAATQA |
Ga0318559_103482191 | 3300032039 | Soil | ALYAGGRLLDAVAVLQRALADSEHYLGPEHPMTKTVRDNLGAATQT |
Ga0318556_105109912 | 3300032043 | Soil | YTAGRLTDVVAILQRALTDCERYLGPDHQMTDTVRANLEAATQV |
Ga0318556_107466242 | 3300032043 | Soil | TEVVAVLQRALADSERYLGPDHPMTKTMRDNLGAATRT |
Ga0318532_102797501 | 3300032051 | Soil | YAGGRLMEAVAVLQRALADSEQYLGADHPMTKTVRDNLGAATQT |
Ga0318575_105102691 | 3300032055 | Soil | AVAVLQRALADSEHYLGPDHPMTKTVRDNLDAAMQT |
Ga0318505_103443082 | 3300032060 | Soil | IREYERALADSEHYLGPDHPMTKTVRDNLGAATQT |
Ga0318513_102285652 | 3300032065 | Soil | YAGGRLMEAVAVLQRALADSEHYLGPDHPMTKTVRDNLDAATQT |
Ga0318514_101342162 | 3300032066 | Soil | VAVLQRALADSEHYLGPDHPMTKTVRDNLDAATQT |
Ga0318525_103798331 | 3300032089 | Soil | GLEAVAVLQRALADSEHYLGPDHPMTKTVRGNLDAATRT |
Ga0311301_108003982 | 3300032160 | Peatlands Soil | MEVVAVPQRALADSERYLGPDHPMTKTVRDNLEAATRI |
Ga0306920_1003531221 | 3300032261 | Soil | RLTDVVAVLQRALTDCERYLGPDHQMTDTVRANLDAATQA |
Ga0335078_107789481 | 3300032805 | Soil | ADVVAVLQRALTDCERYLGPDHQMTQTVRENLDAATQA |
Ga0335071_118851141 | 3300032897 | Soil | VVGVLQRALTDCERYLGPDHQMTQTVRENLDAATQA |
Ga0335076_101008703 | 3300032955 | Soil | RLTDVVTVLQRALTDCERYLGPDHQMTQTVRENLDAATQA |
Ga0335077_107618182 | 3300033158 | Soil | GRLSDVVAVLQRALTDCERYLGPDHSMTQTVRENLDAATQA |
Ga0318519_102336232 | 3300033290 | Soil | YAGGRLLEAVAVLQRALADSEHYLGPEHPMTKTVRDNLGAATQT |
Ga0373958_0174815_412_549 | 3300034819 | Rhizosphere Soil | YYTAGRLTDVVAVLQRALTDCERYLGPDHQMTDTVRANLEAATQV |
⦗Top⦘ |