| Basic Information | |
|---|---|
| Family ID | F046398 |
| Family Type | Metagenome |
| Number of Sequences | 151 |
| Average Sequence Length | 40 residues |
| Representative Sequence | FRTITRTLRNYFLDRKLGEFPVHVSALERRAPLKPELLGAG |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.66 % |
| % of genes near scaffold ends (potentially truncated) | 98.68 % |
| % of genes from short scaffolds (< 2000 bps) | 90.73 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.702 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (5.960 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.318 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.305 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.54% β-sheet: 0.00% Coil/Unstructured: 72.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF16868 | NMT1_3 | 38.41 |
| PF08905 | DUF1850 | 19.87 |
| PF09084 | NMT1 | 6.62 |
| PF06808 | DctM | 6.62 |
| PF04120 | Iron_permease | 3.31 |
| PF01979 | Amidohydro_1 | 2.65 |
| PF13594 | Obsolete Pfam Family | 1.99 |
| PF00291 | PALP | 1.32 |
| PF06127 | Mpo1-like | 1.32 |
| PF03625 | DUF302 | 1.32 |
| PF03401 | TctC | 0.66 |
| PF16697 | Yop-YscD_cpl | 0.66 |
| PF12974 | Phosphonate-bd | 0.66 |
| PF02880 | PGM_PMM_III | 0.66 |
| PF00685 | Sulfotransfer_1 | 0.66 |
| PF13450 | NAD_binding_8 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG4729 | Uncharacterized conserved protein, DUF1850 family | Function unknown [S] | 19.87 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 6.62 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 6.62 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 1.32 |
| COG4539 | 2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids) | Lipid transport and metabolism [I] | 1.32 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.66 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.66 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.70 % |
| Unclassified | root | N/A | 5.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_107496778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 620 | Open in IMG/M |
| 3300002562|JGI25382J37095_10229681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300005177|Ga0066690_10131372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1634 | Open in IMG/M |
| 3300005329|Ga0070683_100064741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum massiliense | 3403 | Open in IMG/M |
| 3300005332|Ga0066388_102221375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 991 | Open in IMG/M |
| 3300005332|Ga0066388_108210440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300005333|Ga0070677_10075644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1428 | Open in IMG/M |
| 3300005334|Ga0068869_100125114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1971 | Open in IMG/M |
| 3300005337|Ga0070682_101564991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300005347|Ga0070668_102270634 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005355|Ga0070671_101740102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300005367|Ga0070667_101555023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300005441|Ga0070700_101866497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300005446|Ga0066686_11051150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 526 | Open in IMG/M |
| 3300005455|Ga0070663_101825696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 545 | Open in IMG/M |
| 3300005468|Ga0070707_100285486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1604 | Open in IMG/M |
| 3300005543|Ga0070672_100078929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2634 | Open in IMG/M |
| 3300005543|Ga0070672_100783895 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005545|Ga0070695_100463883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
| 3300005563|Ga0068855_100430262 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300005564|Ga0070664_100133394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2182 | Open in IMG/M |
| 3300005578|Ga0068854_101187449 | Not Available | 683 | Open in IMG/M |
| 3300005578|Ga0068854_101456182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300005616|Ga0068852_101131240 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300005617|Ga0068859_100109151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2828 | Open in IMG/M |
| 3300005617|Ga0068859_100830054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1011 | Open in IMG/M |
| 3300005617|Ga0068859_102922257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300005618|Ga0068864_100121636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2335 | Open in IMG/M |
| 3300005718|Ga0068866_10773295 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300005718|Ga0068866_11408933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300005719|Ga0068861_101358506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300005840|Ga0068870_10931360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300005841|Ga0068863_101964566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300005842|Ga0068858_102581067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300005994|Ga0066789_10103673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1221 | Open in IMG/M |
| 3300006028|Ga0070717_10524219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1072 | Open in IMG/M |
| 3300006358|Ga0068871_101553264 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006880|Ga0075429_101940206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300007004|Ga0079218_13000406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 568 | Open in IMG/M |
| 3300007076|Ga0075435_101249879 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300009012|Ga0066710_100641670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1614 | Open in IMG/M |
| 3300009092|Ga0105250_10388887 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300009111|Ga0115026_11944254 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009137|Ga0066709_101502407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 972 | Open in IMG/M |
| 3300009162|Ga0075423_10457236 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300009174|Ga0105241_10571467 | Not Available | 1018 | Open in IMG/M |
| 3300009176|Ga0105242_11845242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 644 | Open in IMG/M |
| 3300009177|Ga0105248_10071495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3898 | Open in IMG/M |
| 3300009177|Ga0105248_12854855 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300009792|Ga0126374_11889637 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010043|Ga0126380_11520343 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300010326|Ga0134065_10063184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1166 | Open in IMG/M |
| 3300010337|Ga0134062_10335940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300010361|Ga0126378_11432352 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300010364|Ga0134066_10136171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300010371|Ga0134125_10101449 | All Organisms → cellular organisms → Bacteria | 3204 | Open in IMG/M |
| 3300010399|Ga0134127_10972806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 907 | Open in IMG/M |
| 3300012185|Ga0136619_10289827 | Not Available | 621 | Open in IMG/M |
| 3300012198|Ga0137364_10424373 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300012202|Ga0137363_11537869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
| 3300012207|Ga0137381_10798994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
| 3300012285|Ga0137370_10545042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300012349|Ga0137387_10419011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 971 | Open in IMG/M |
| 3300012353|Ga0137367_11150395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 521 | Open in IMG/M |
| 3300012955|Ga0164298_10314959 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300013297|Ga0157378_11388228 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300013307|Ga0157372_10522697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1383 | Open in IMG/M |
| 3300013308|Ga0157375_10602662 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300014325|Ga0163163_10057467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3847 | Open in IMG/M |
| 3300014326|Ga0157380_10263538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1567 | Open in IMG/M |
| 3300015080|Ga0167639_1021847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
| 3300017792|Ga0163161_10462007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
| 3300017792|Ga0163161_10986579 | Not Available | 718 | Open in IMG/M |
| 3300017994|Ga0187822_10257220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300018051|Ga0184620_10137607 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300018071|Ga0184618_10023468 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
| 3300018078|Ga0184612_10623782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300020167|Ga0194035_1187048 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300021080|Ga0210382_10018467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2489 | Open in IMG/M |
| 3300021478|Ga0210402_11254940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 668 | Open in IMG/M |
| 3300025790|Ga0210075_1103128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas | 504 | Open in IMG/M |
| 3300025906|Ga0207699_10599609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
| 3300025907|Ga0207645_10137829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1589 | Open in IMG/M |
| 3300025907|Ga0207645_10617456 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300025907|Ga0207645_10824585 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300025922|Ga0207646_11763563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 530 | Open in IMG/M |
| 3300025925|Ga0207650_10572202 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300025927|Ga0207687_10458117 | Not Available | 1059 | Open in IMG/M |
| 3300025927|Ga0207687_11087751 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300025927|Ga0207687_11362662 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300025931|Ga0207644_10394730 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300025932|Ga0207690_11127752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 654 | Open in IMG/M |
| 3300025933|Ga0207706_10875946 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300025937|Ga0207669_11735969 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300025942|Ga0207689_10692334 | Not Available | 859 | Open in IMG/M |
| 3300025945|Ga0207679_10055604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2918 | Open in IMG/M |
| 3300025945|Ga0207679_11505301 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300025956|Ga0210104_1007724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1291 | Open in IMG/M |
| 3300025981|Ga0207640_10456601 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300025981|Ga0207640_11160528 | Not Available | 685 | Open in IMG/M |
| 3300025986|Ga0207658_10030065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3842 | Open in IMG/M |
| 3300025986|Ga0207658_10474401 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300026035|Ga0207703_12100537 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300026041|Ga0207639_11928367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300026067|Ga0207678_11281703 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300026078|Ga0207702_12110006 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300026088|Ga0207641_10319376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1472 | Open in IMG/M |
| 3300026089|Ga0207648_11497025 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300026089|Ga0207648_11855980 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300026121|Ga0207683_12161874 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300026142|Ga0207698_10898586 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300027471|Ga0209995_1036739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
| 3300027682|Ga0209971_1067591 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300027885|Ga0209450_10953742 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300028679|Ga0302169_10101213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300028856|Ga0302295_1089363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300030019|Ga0311348_10324375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1148 | Open in IMG/M |
| 3300030114|Ga0311333_10662443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300030294|Ga0311349_11345817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 664 | Open in IMG/M |
| 3300030838|Ga0311335_10666957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300031521|Ga0311364_10784360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 956 | Open in IMG/M |
| 3300031546|Ga0318538_10041277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2216 | Open in IMG/M |
| 3300031640|Ga0318555_10072419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1783 | Open in IMG/M |
| 3300031720|Ga0307469_11331708 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300031768|Ga0318509_10081251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1719 | Open in IMG/M |
| 3300031771|Ga0318546_10853548 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031834|Ga0315290_10658470 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300031846|Ga0318512_10263291 | Not Available | 853 | Open in IMG/M |
| 3300031918|Ga0311367_10222285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1973 | Open in IMG/M |
| 3300031918|Ga0311367_11758867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 603 | Open in IMG/M |
| 3300031939|Ga0308174_10715130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300031939|Ga0308174_11041987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 695 | Open in IMG/M |
| 3300031954|Ga0306926_12363250 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031995|Ga0307409_101860745 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300031996|Ga0308176_10408338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1357 | Open in IMG/M |
| 3300031997|Ga0315278_11808276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 577 | Open in IMG/M |
| 3300032005|Ga0307411_10090353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2136 | Open in IMG/M |
| 3300032008|Ga0318562_10605272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 633 | Open in IMG/M |
| 3300032075|Ga0310890_11199010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300032143|Ga0315292_11023960 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300032173|Ga0315268_10439560 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300032205|Ga0307472_100600963 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300032205|Ga0307472_101166008 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300032954|Ga0335083_10995682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 660 | Open in IMG/M |
| 3300033004|Ga0335084_11074892 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300033413|Ga0316603_11379694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 668 | Open in IMG/M |
| 3300033419|Ga0316601_101825388 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300033480|Ga0316620_10399920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1241 | Open in IMG/M |
| 3300033480|Ga0316620_12268045 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300033482|Ga0316627_102015564 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300034196|Ga0370503_0085647 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 5.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.97% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.99% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.32% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.32% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.32% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.66% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.66% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.66% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.66% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.66% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.66% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.66% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025790 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025956 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028856 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_4 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300034196 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1074967781 | 3300001213 | Wetland | FRTITRTLRNYFLDRRQGAFPLRLSTLERRPPVKPDLVGAG* |
| JGI25382J37095_102296811 | 3300002562 | Grasslands Soil | AFRTITRTLRNYFLDRKLGEFPVRVSALEKRAPLKPELLGAG* |
| Ga0066690_101313723 | 3300005177 | Soil | GDLAFRTITRTLRNYFLDRKLGAFPLHVSALEKRAPREPGLAGAA* |
| Ga0070683_1000647411 | 3300005329 | Corn Rhizosphere | TIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG* |
| Ga0066388_1022213751 | 3300005332 | Tropical Forest Soil | GELAFRTIARTLRNYFLDRKLGAFPTRVSVIERRAARDPALLGAG* |
| Ga0066388_1082104402 | 3300005332 | Tropical Forest Soil | MAFRTITRTLRNFFLDRKRGSFPVHVSALTRRVPLRPELSGAG* |
| Ga0070677_100756441 | 3300005333 | Miscanthus Rhizosphere | AFRTITRTLRTFFLDRKLGEFPVRVSSLERRPPVSPDLRGAA* |
| Ga0068869_1001251143 | 3300005334 | Miscanthus Rhizosphere | FRTIARTLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA* |
| Ga0070682_1015649912 | 3300005337 | Corn Rhizosphere | EVPWESLAFRTIARTLRNFFLDRRLDAFALHVSAIERRPPLTPDLLAAG* |
| Ga0070668_1022706341 | 3300005347 | Switchgrass Rhizosphere | TITRTLRNYFLDRRQRAFPLRVSSLERRPPLPPDLLAAG* |
| Ga0070671_1017401021 | 3300005355 | Switchgrass Rhizosphere | IAFRTIARTLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA* |
| Ga0070667_1015550231 | 3300005367 | Switchgrass Rhizosphere | WAELAFRTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG* |
| Ga0070700_1018664971 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | FRTIGRTLRNYFLDRKLGRFPTRVSVLERRAPRPDLAAAA* |
| Ga0066686_110511502 | 3300005446 | Soil | FRTIARTLRNYFLDRKLQRLRLHVSALEKRTALKPELAGAA* |
| Ga0070663_1018256961 | 3300005455 | Corn Rhizosphere | TIGRTLRRYFLDRRMGRFGLHVSAIERRPPLTPDLLAAG* |
| Ga0070707_1002854862 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LAFRTIARTLRNYFLDRKLGEFPVHVSALERRAPRPELSGAA* |
| Ga0070672_1000789293 | 3300005543 | Miscanthus Rhizosphere | FRTITRTLRNYFLDRRQNAYPVRVSSLERRPPLPPDLLAAG* |
| Ga0070672_1007838952 | 3300005543 | Miscanthus Rhizosphere | RTIGRTLRNYFLDRKLGAFPTRVSVLERRAPRPDLAGAA* |
| Ga0070695_1004638831 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LAFRTIGRTLRNFFLDRRLDAFSLHVSAIERRPPLTPDLLAAG* |
| Ga0068855_1004302621 | 3300005563 | Corn Rhizosphere | LRNYFLDRRLGRFTMHVSAIERRAPLTPDLLAAG* |
| Ga0070664_1001333941 | 3300005564 | Corn Rhizosphere | IARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG* |
| Ga0068854_1011874492 | 3300005578 | Corn Rhizosphere | LAFRTIGRTLRNYFLDRKLGQFPTRVSVLERRAPRPDLAAAA* |
| Ga0068854_1014561821 | 3300005578 | Corn Rhizosphere | RTLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA* |
| Ga0068852_1011312402 | 3300005616 | Corn Rhizosphere | ARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG* |
| Ga0068859_1001091513 | 3300005617 | Switchgrass Rhizosphere | FRTITRTLRNYFLDRRQNAYPVRVSSLERRPPLPPDLLAAA* |
| Ga0068859_1008300542 | 3300005617 | Switchgrass Rhizosphere | FRTITRTLRNFFLDRKLGQFPLHISSIERRPPLPPDLRGAA* |
| Ga0068859_1029222571 | 3300005617 | Switchgrass Rhizosphere | RTITRTLRTYFLDRKLGSFPVRVSALARRPPVGPDLRGAA* |
| Ga0068864_1001216363 | 3300005618 | Switchgrass Rhizosphere | IPWEALAFRTITRTLRNYFLDRRQNAYPVRVSSLERRPPLPPDLLAAG* |
| Ga0068866_107732952 | 3300005718 | Miscanthus Rhizosphere | TRTLRNFFLDRKLGQFPLRVSALQRRPPLPPDLRGAG* |
| Ga0068866_114089331 | 3300005718 | Miscanthus Rhizosphere | TLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA* |
| Ga0068861_1013585061 | 3300005719 | Switchgrass Rhizosphere | AFRTIARTLRNYFMDRRRGGFALHVSAIERRAPLTPDLLAAG* |
| Ga0068870_109313602 | 3300005840 | Miscanthus Rhizosphere | TIGRTLRNYFLDRKLGRFPTHVSVLERRAPRPDLEAAA* |
| Ga0068863_1019645661 | 3300005841 | Switchgrass Rhizosphere | RTLRNYFLDRREGAFPLRLSTLERRPAPPDLRGAA* |
| Ga0068858_1025810671 | 3300005842 | Switchgrass Rhizosphere | TLRNFFLDRKLGAFPIRVSAIERRPPLPPDLRGAA* |
| Ga0066789_101036733 | 3300005994 | Soil | QLAFRTISRSLRNYFLDRKLGRFPVRVSTIDRRVPAKPQVPAPT* |
| Ga0070717_105242191 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TIARTLRNYFLDRKLGTFPVHVSTIERRVPLPPAATGAA* |
| Ga0068871_1015532642 | 3300006358 | Miscanthus Rhizosphere | TLRNYFLDRREGAFPLRLSTLERRPPPPDLGGAA* |
| Ga0075429_1019402061 | 3300006880 | Populus Rhizosphere | FRTIGRTLRNYFLDRKLGHFPTRVSVLERRAPRPDLEAAA* |
| Ga0079218_130004061 | 3300007004 | Agricultural Soil | LAFRTITRTLRNYFLDRKLGAFPVRVSALERRVPARPELSGAG* |
| Ga0075435_1012498791 | 3300007076 | Populus Rhizosphere | RTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG* |
| Ga0066710_1006416703 | 3300009012 | Grasslands Soil | FRTITRTLRNYFLDRKLGEFPVHVSALERRAPLKPELLGAG |
| Ga0105250_103888871 | 3300009092 | Switchgrass Rhizosphere | RTITRTLRNFFLDRKLGRFPLRVSALQRRPPLPPDLRGAG* |
| Ga0115026_119442541 | 3300009111 | Wetland | WEDMAFRTIGRTLRNYFVDRRLGAFPTRVSALERRLPRPDLGGAG* |
| Ga0066709_1015024071 | 3300009137 | Grasslands Soil | IARTLRNYFLDRKLGEFPVHVSALEKRAPRPELSGAA* |
| Ga0075423_104572362 | 3300009162 | Populus Rhizosphere | VPWEAIAFRSIARTLRNYFLDRRQRAFNLHVSALERRPPLTPDLLAAG* |
| Ga0105241_105714671 | 3300009174 | Corn Rhizosphere | DIAFRTIARTLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA* |
| Ga0105242_118452421 | 3300009176 | Miscanthus Rhizosphere | TLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG* |
| Ga0105248_100714951 | 3300009177 | Switchgrass Rhizosphere | RTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG* |
| Ga0105248_128548551 | 3300009177 | Switchgrass Rhizosphere | IGRTLRNYFLDRKLGTLQTRVSALERRAPRPDLSGAG* |
| Ga0126374_118896371 | 3300009792 | Tropical Forest Soil | RTLRNYFLDRKLGAFPTRVSVIERRAARDPALLGAG* |
| Ga0126380_115203431 | 3300010043 | Tropical Forest Soil | TITRTLRNYFLDRKLGAFPTHVSALERRARPQPELQGAG* |
| Ga0134065_100631841 | 3300010326 | Grasslands Soil | SEIAFRTITRTLRNYFLDRKLGDFPVRVSALEKRAPLKPELLGAG* |
| Ga0134062_103359401 | 3300010337 | Grasslands Soil | TLRNYFLDRKLGDFPVRVSALEKRAPLKPELLGAG* |
| Ga0126378_114323521 | 3300010361 | Tropical Forest Soil | RTLRNYFLDRKLGAFPTHVSALERRAPRPDLSGAA* |
| Ga0134066_101361713 | 3300010364 | Grasslands Soil | FRTITRTLRNFFLDRKQGSFPVHVSALTRRVPLRPELSGAG* |
| Ga0134125_101014491 | 3300010371 | Terrestrial Soil | RTIARTLRNYFLDRRLGRFTMHVSAIERRAPLTPDLLAAG* |
| Ga0134127_109728061 | 3300010399 | Terrestrial Soil | IAFRTIARTLRHYFLDRKLGAFPLHVSALFKRSPREPGLQAAA* |
| Ga0136619_102898271 | 3300012185 | Polar Desert Sand | LAFRTITRTLRNFFLDRKLGNEATHVSALVRRAPVPPDLRGAA* |
| Ga0137364_104243731 | 3300012198 | Vadose Zone Soil | RTITRTLRNYFLDRKLGAFPLHVSALEKRAPREPALAGAA* |
| Ga0137363_115378691 | 3300012202 | Vadose Zone Soil | TRTLRNYFLDRKLGGFPVHVSALERRVPVKPDLVGAG* |
| Ga0137381_107989941 | 3300012207 | Vadose Zone Soil | LAFRTIARTLRNYFLDRKLGEFPVHVSALEKRTPRPELSGAA* |
| Ga0137370_105450421 | 3300012285 | Vadose Zone Soil | GDLAFRTITRTLRNYFLDRKRGAFPLHVSALEKRAPREPALAGAA* |
| Ga0137387_104190111 | 3300012349 | Vadose Zone Soil | ARTLRNYFLDRKLGEFPVHVSALEKRTPRPELSGAA* |
| Ga0137367_111503951 | 3300012353 | Vadose Zone Soil | FRTIGRTLRNYFLDRKLGGFPVHVSTLVRRQGVTPALTGAA* |
| Ga0164298_103149592 | 3300012955 | Soil | FRTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG* |
| Ga0157378_113882281 | 3300013297 | Miscanthus Rhizosphere | FRTIGRTLRNYFLDRKLGTLQTRVSALERRAPRPDLSGAG* |
| Ga0157372_105226973 | 3300013307 | Corn Rhizosphere | LRNFFLDRRLGAFALHVSAIERRPPLTPELLAAG* |
| Ga0157375_106026622 | 3300013308 | Miscanthus Rhizosphere | WESLAFRTITRTLRTYFLDRKLGSFPVRVSALARRPPVGPDLRGAA* |
| Ga0163163_100574675 | 3300014325 | Switchgrass Rhizosphere | LRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG* |
| Ga0157380_102635381 | 3300014326 | Switchgrass Rhizosphere | LAFRTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG* |
| Ga0167639_10218472 | 3300015080 | Glacier Forefield Soil | TRTLRNYFLDRKLGAFPVHVSALEKRVPREPALAGAA* |
| Ga0163161_104620071 | 3300017792 | Switchgrass Rhizosphere | RTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG |
| Ga0163161_109865791 | 3300017792 | Switchgrass Rhizosphere | QLAFRTITRTLRNYFLDRKLGAFPVRVSALERRVPAKPELSGAG |
| Ga0187822_102572201 | 3300017994 | Freshwater Sediment | TLRNFFLDRRLDAFALHVSAIERRPPLTPDLLAAG |
| Ga0184620_101376072 | 3300018051 | Groundwater Sediment | IGRTLRNYFHDRKLGTFPTRLSVLERKAPRPDLSGAA |
| Ga0184618_100234683 | 3300018071 | Groundwater Sediment | PWETLAFRTIARTLRNWFLDRRSGAFPLRMSALERRGPPPPDLAAAA |
| Ga0184612_106237822 | 3300018078 | Groundwater Sediment | TRTLRNYFLDRKLGSFPVRLSSLERRPPLPPDLLAAG |
| Ga0194035_11870481 | 3300020167 | Anoxic Zone Freshwater | ALAFRTITRTLRNYFLDRKRGVFPVRVSSLERKAARSG |
| Ga0210382_100184671 | 3300021080 | Groundwater Sediment | TLRNYFLDRKLGAFTVHVSALEKRAPREPALAAAA |
| Ga0210402_112549402 | 3300021478 | Soil | GRTLRNYFLDRKLGAFPLHVSAVDRRLPREASLAAAA |
| Ga0210075_11031282 | 3300025790 | Natural And Restored Wetlands | FRTITRTLRNYFLDRKNGSFPTRVSTLVRKPPPADLSGAG |
| Ga0207699_105996091 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | IARTLRNFFLDRRLGRFSLHVSSIERRAPLPPDLLAAG |
| Ga0207645_101378293 | 3300025907 | Miscanthus Rhizosphere | FRTIGRTLRNYFLDRKLGTFPTRVSALERKAPRPDLAGAA |
| Ga0207645_106174563 | 3300025907 | Miscanthus Rhizosphere | TLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA |
| Ga0207645_108245851 | 3300025907 | Miscanthus Rhizosphere | ESLACRTSARTLRNYFMDRRRGGFALHVSAIERRAPLSPDLLAAG |
| Ga0207646_117635631 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | FRTIARTLRNYFLDRKLGEFPVHVSALERRAPRPELSGAA |
| Ga0207650_105722021 | 3300025925 | Switchgrass Rhizosphere | PWEALAFRTITRTLRNYFLDRRQNAYPVRVSSLERRPPLPPDLLAAA |
| Ga0207687_104581171 | 3300025927 | Miscanthus Rhizosphere | FRTIARTLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA |
| Ga0207687_110877511 | 3300025927 | Miscanthus Rhizosphere | PWAELAFRTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG |
| Ga0207687_113626621 | 3300025927 | Miscanthus Rhizosphere | AFRTITRTLRNYFLDRRQNAYPVRVSSLERRPPLPPDLLAAG |
| Ga0207644_103947301 | 3300025931 | Switchgrass Rhizosphere | TLRTFFLDRKLGEFPVRVSSLERRPPVSPDLRGAA |
| Ga0207690_111277521 | 3300025932 | Corn Rhizosphere | IGRTLRNYFLDRKLGTFPTRLSVLERKAPRPDMSGAA |
| Ga0207706_108759461 | 3300025933 | Corn Rhizosphere | RTIARTLRNFLLDRRLGAFKLHVSSIERRAPLPPDLLAAG |
| Ga0207669_117359692 | 3300025937 | Miscanthus Rhizosphere | RTIGRTLRNYFLDRKLGTFPTRVSALERKAPRPDLAGAA |
| Ga0207689_106923341 | 3300025942 | Miscanthus Rhizosphere | IARTLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA |
| Ga0207679_100556041 | 3300025945 | Corn Rhizosphere | IARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG |
| Ga0207679_115053011 | 3300025945 | Corn Rhizosphere | RTIGRTLRRFFLDRRLGAFGLHVSALERRPPLTPDLVAAG |
| Ga0210104_10077241 | 3300025956 | Natural And Restored Wetlands | GRTLRNYFLDRKLGAFPTRVSVLERKAPQPDLSGAA |
| Ga0207640_104566011 | 3300025981 | Corn Rhizosphere | TLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG |
| Ga0207640_111605282 | 3300025981 | Corn Rhizosphere | LAFRTIGRTLRNYFLDRKLGQFPTRVSVLERRAPRPDLAAAA |
| Ga0207658_100300651 | 3300025986 | Switchgrass Rhizosphere | RTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG |
| Ga0207658_104744011 | 3300025986 | Switchgrass Rhizosphere | DSIPWEDLAFRTIGRTLRNYFLDRKLGTLQTRVSALERKVVRPDLSGAG |
| Ga0207703_121005372 | 3300026035 | Switchgrass Rhizosphere | AFRTIGRTLRNYFLDRKLGTFPTRLSVLERKAPRPDMSGAA |
| Ga0207639_119283672 | 3300026041 | Corn Rhizosphere | EVPWESLAFRTIARTLRNFFLDRRLDAFALHVSAIERRPPLTPDLLAAG |
| Ga0207678_112817032 | 3300026067 | Corn Rhizosphere | IAFRTIGRTLRRYFLDRRMGRFGLHVSAIERRPPLTPDLLAAG |
| Ga0207702_121100062 | 3300026078 | Corn Rhizosphere | FRTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG |
| Ga0207641_103193761 | 3300026088 | Switchgrass Rhizosphere | AFRTITRTLRNYFLDRRYGTFRVHVSALTRRVPLRPELSGAG |
| Ga0207648_114970251 | 3300026089 | Miscanthus Rhizosphere | RTITRTLRNFFLDRKLGAFPIRVSAIERRPPLPPDLRGAA |
| Ga0207648_118559801 | 3300026089 | Miscanthus Rhizosphere | ESLAFRTIARTLRNYFMDRRRGDFTLHVSAIERRAPLTPDLLAAG |
| Ga0207683_121618741 | 3300026121 | Miscanthus Rhizosphere | MAFRTIGRTLRNYFLDRKLGSFPTRVSALERKAPRPDLAGAA |
| Ga0207698_108985861 | 3300026142 | Corn Rhizosphere | LAFRTITRTLRNYFLDRKLGEFPVRVSALERRPESRPRGIPVP |
| Ga0209995_10367391 | 3300027471 | Arabidopsis Thaliana Rhizosphere | FRTIARTLRNYFLDRRMSSFSLHVSSIERRAPLTPDLLAAG |
| Ga0209971_10675912 | 3300027682 | Arabidopsis Thaliana Rhizosphere | IARTLRNYFLDRRRGAFRLHVSALARRSPITPDLLAAG |
| Ga0209450_109537422 | 3300027885 | Freshwater Lake Sediment | LAFRTIARTLRNYFVDRRLGSFPLRVSALERKPPR |
| Ga0302169_101012133 | 3300028679 | Fen | TITRTLRNYFLDRKQGAFPVRVSSLERRPPLPPDLLAAG |
| Ga0302295_10893631 | 3300028856 | Fen | LAFRTITRTLRNYFLDRKQGGFPLRLSALERRPPLPPDLLAAG |
| Ga0311348_103243751 | 3300030019 | Fen | LAFRTIARTLRNYFLDRKLGAFPVHESALERRAPVPPSLSGAG |
| Ga0311333_106624433 | 3300030114 | Fen | WESLAFRTITRTLRNYFLDRKQGAFPVRVSSLERRPPLPPDLLAAG |
| Ga0311349_113458171 | 3300030294 | Fen | IGRTLRNYFLDRKVGAFPTRVSTLIRKPPRPDVIGAA |
| Ga0311335_106669571 | 3300030838 | Fen | ESLAFRTIARTLRNYFLDRKQGGFPLRLSALERRPPLPPDLLAAG |
| Ga0311364_107843603 | 3300031521 | Fen | ARTLRNYFLDRKQGGFPLRLSALERRPPLPPDLLAAG |
| Ga0318538_100412771 | 3300031546 | Soil | IAFRTITRTLRNFFLDRKLGAFPTHVSIIERRAARDPRLSGAG |
| Ga0318555_100724191 | 3300031640 | Soil | NEIAFRTITRTLRNFFLDRKLGAFPTHVSIIERRAARDPRLSGAG |
| Ga0307469_113317081 | 3300031720 | Hardwood Forest Soil | IGRTLRNYFLDRKLGTLRTRVSALERRAPRPDLSGAA |
| Ga0318509_100812511 | 3300031768 | Soil | FRTITRTLRNFFLDRKLGAFPTHVSIIERRAARDPRLSGAG |
| Ga0318546_108535481 | 3300031771 | Soil | LAFRTIGRTLRNYFLDRKLGAFGTHVSALERRAPRPDLSGAG |
| Ga0315290_106584701 | 3300031834 | Sediment | TIGRTLRNYFLDRKLGAFPTRVSVLERKAPRPDLSGAA |
| Ga0318512_102632911 | 3300031846 | Soil | ITRTLRNFFLDRKLGAFPTHVSIIERRAARDPRLSGAG |
| Ga0311367_102222851 | 3300031918 | Fen | TITRTLRNYFLDRKQGGFPLRLSALERRPPLPPDLLAAG |
| Ga0311367_117588672 | 3300031918 | Fen | LAFRTITRTLRNYFLDRKQGACPVRVSSLERRLPLPMDLLAAG |
| Ga0308174_107151303 | 3300031939 | Soil | RTIARTLRNYFLDRRLGAFTMHVSAIERRTALTPDLLAGG |
| Ga0308174_110419873 | 3300031939 | Soil | FRTIGRTLRRYFLDRRLGSFGLHVSSIERRPPLAPDLLAAG |
| Ga0306926_123632501 | 3300031954 | Soil | ITRTLRNYFLDRKLGAFPTHVSALERRARPQPELLGAG |
| Ga0307409_1018607452 | 3300031995 | Rhizosphere | FRTIARTLRTFFLDRKLGAFPVRVSSLERRPPVSPDLRGAA |
| Ga0308176_104083384 | 3300031996 | Soil | ARTLRNYFLDRRLGRFALHVSAIERRSPLTPDLLAAG |
| Ga0315278_118082762 | 3300031997 | Sediment | LAFRTITRTLRSYFLDRKLGAFPVRVSVLERRPPVRPEFAAAG |
| Ga0307411_100903533 | 3300032005 | Rhizosphere | IGRTLRNWFLDRKLGTFGVHVSSLERRPPLPPNLLGAG |
| Ga0318562_106052721 | 3300032008 | Soil | FRTITRTLRNFFLDRKLGAFPTHVSVIERRAARDPRLSGAG |
| Ga0310890_111990102 | 3300032075 | Soil | LAFRTITRTLRTYFLDRKLGSFPVRVSALARRPPVGPDLRGAA |
| Ga0315292_110239601 | 3300032143 | Sediment | GRTLRNYFLDRKLGVFPTRVSVLERRAPRPDLSGAA |
| Ga0315268_104395602 | 3300032173 | Sediment | TIGRTLRNYFLDRKLGVFPTRVSVLERKAPRPDLAGAG |
| Ga0307472_1006009631 | 3300032205 | Hardwood Forest Soil | FRTIGRTLRNFFLDRKLGSFPVRLSTIDRRVPPKPDVAGAA |
| Ga0307472_1011660082 | 3300032205 | Hardwood Forest Soil | RTLRNYFLDRKLGTLQTRVSALERRAPRPELSGAG |
| Ga0335083_109956823 | 3300032954 | Soil | TIGRTLRNYFLDRRRGAFGTHVSALERKAPRPDLSGAG |
| Ga0335084_110748921 | 3300033004 | Soil | EMAFRTIGRTLRNYFLDRKLGHFPMRVSVLERRAPRPDLAGAA |
| Ga0316603_113796941 | 3300033413 | Soil | FRTITRTLRSFFLDRRLGAYPTRVSALERRPQAKPDLSGAG |
| Ga0316601_1018253882 | 3300033419 | Soil | LAFRTITRTLRRYFLDRRHGAYATHVSALERRPADRRADLTGAA |
| Ga0316620_103999203 | 3300033480 | Soil | EELAFRTIARTLRNYFLDRKLGSFPPHVSTLHKHVPLPADLTAAA |
| Ga0316620_122680452 | 3300033480 | Soil | FRTIARTLRNYFLDRRRGSFELQLSALERRPPLPPDLLAAG |
| Ga0316627_1020155642 | 3300033482 | Soil | FRTITRTLRNYFLDRKLGRFGVRVSALERRPPLPPDLRGAG |
| Ga0370503_0085647_915_1046 | 3300034196 | Untreated Peat Soil | MAFRTITRTLRNYFLDRKQGALPLRISALERRPPLPPDLRGAG |
| ⦗Top⦘ |