Metagenome Family F046398

Overview

Basic Information

• Family ID: F046398
• Family Type: Metagenome
• Number of Sequences: 151
• Average Sequence Length: 40 residues
• Representative Sequence: FRTITRTLRNYFLDRKLGEFPVHVSALERRAPLKPELLGAG
• Number of Associated Samples: 131
• Number of Associated Scaffolds: 151

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 0.66 %
• % of genes near scaffold ends (potentially truncated): 98.68 %
• % of genes from short scaffolds (< 2000 bps): 90.73 %
• Associated GOLD sequencing projects: 121
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (94.702 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (5.960 % of family members)
• Environment Ontology (ENVO): Unclassified (52.318 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (54.305 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 27.54%
  β-sheet: 0.00%
  Coil/Unstructured: 72.46%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 151 Family Scaffolds
PF16868	NMT1_3	38.41
PF08905	DUF1850	19.87
PF09084	NMT1	6.62
PF06808	DctM	6.62
PF04120	Iron_permease	3.31
PF01979	Amidohydro_1	2.65
PF13594	Obsolete Pfam Family	1.99
PF00291	PALP	1.32
PF06127	Mpo1-like	1.32
PF03625	DUF302	1.32
PF03401	TctC	0.66
PF16697	Yop-YscD_cpl	0.66
PF12974	Phosphonate-bd	0.66
PF02880	PGM_PMM_III	0.66
PF00685	Sulfotransfer_1	0.66
PF13450	NAD_binding_8	0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 151 Family Scaffolds
COG4729	Uncharacterized conserved protein, DUF1850 family	Function unknown [S]	19.87
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	6.62
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	6.62
COG3439	Uncharacterized conserved protein, DUF302 family	Function unknown [S]	1.32
COG4539	2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids)	Lipid transport and metabolism [I]	1.32
COG0033	Phosphoglucomutase/phosphomannomutase	Carbohydrate transport and metabolism [G]	0.66
COG1109	Phosphomannomutase	Carbohydrate transport and metabolism [G]	0.66
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.66

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	94.70 %
Unclassified	root	N/A	5.30 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	94.70 %
Unclassified	root	N/A	5.30 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	94.70 %
Unclassified	root	N/A	5.30 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	57.62 %
Unclassified	root	N/A	5.30 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.66 %

Level 5

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	16.56 %
Unclassified	root	N/A	5.30 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.32 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.66 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.66 %

Level 6

Name	Rank	Taxonomy	Distribution
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.30 %
Unclassified	root	N/A	5.30 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	1.99 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.66 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.66 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.66 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	5.30 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.99 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	1.32 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.66 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.66 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.66 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.66 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	5.30 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.99 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	0.66 %
Collimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas	0.66 %
Noviherbaspirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum	0.66 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.66 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.66 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.66 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	5.30 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.99 %
Noviherbaspirillum massiliense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum massiliense	0.66 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	0.66 %
Collimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas	0.66 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.66 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.66 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.66 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001213|JGIcombinedJ13530_107496778	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	620
3300002562|JGI25382J37095_10229681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	560
3300005177|Ga0066690_10131372	All Organisms → cellular organisms → Bacteria → Proteobacteria	1634
3300005329|Ga0070683_100064741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum massiliense	3403
3300005332|Ga0066388_102221375	All Organisms → cellular organisms → Bacteria → Proteobacteria	991
3300005332|Ga0066388_108210440	All Organisms → cellular organisms → Bacteria → Proteobacteria	521
3300005333|Ga0070677_10075644	All Organisms → cellular organisms → Bacteria → Proteobacteria	1428
3300005334|Ga0068869_100125114	All Organisms → cellular organisms → Bacteria → Proteobacteria	1971
3300005337|Ga0070682_101564991	All Organisms → cellular organisms → Bacteria → Proteobacteria	569
3300005347|Ga0070668_102270634	All Organisms → cellular organisms → Bacteria	502
3300005355|Ga0070671_101740102	All Organisms → cellular organisms → Bacteria → Proteobacteria	553
3300005367|Ga0070667_101555023	All Organisms → cellular organisms → Bacteria → Proteobacteria	621
3300005441|Ga0070700_101866497	All Organisms → cellular organisms → Bacteria → Proteobacteria	519
3300005446|Ga0066686_11051150	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	526
3300005455|Ga0070663_101825696	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	545
3300005468|Ga0070707_100285486	All Organisms → cellular organisms → Bacteria → Proteobacteria	1604
3300005543|Ga0070672_100078929	All Organisms → cellular organisms → Bacteria → Proteobacteria	2634
3300005543|Ga0070672_100783895	All Organisms → cellular organisms → Bacteria	838
3300005545|Ga0070695_100463883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	973
3300005563|Ga0068855_100430262	All Organisms → cellular organisms → Bacteria	1443
3300005564|Ga0070664_100133394	All Organisms → cellular organisms → Bacteria → Proteobacteria	2182
3300005578|Ga0068854_101187449	Not Available	683
3300005578|Ga0068854_101456182	All Organisms → cellular organisms → Bacteria → Proteobacteria	621
3300005616|Ga0068852_101131240	All Organisms → cellular organisms → Bacteria	803
3300005617|Ga0068859_100109151	All Organisms → cellular organisms → Bacteria → Proteobacteria	2828
3300005617|Ga0068859_100830054	All Organisms → cellular organisms → Bacteria → Proteobacteria	1011
3300005617|Ga0068859_102922257	All Organisms → cellular organisms → Bacteria → Proteobacteria	523
3300005618|Ga0068864_100121636	All Organisms → cellular organisms → Bacteria → Proteobacteria	2335
3300005718|Ga0068866_10773295	All Organisms → cellular organisms → Bacteria	665
3300005718|Ga0068866_11408933	All Organisms → cellular organisms → Bacteria → Proteobacteria	510
3300005719|Ga0068861_101358506	All Organisms → cellular organisms → Bacteria → Proteobacteria	693
3300005840|Ga0068870_10931360	All Organisms → cellular organisms → Bacteria → Proteobacteria	616
3300005841|Ga0068863_101964566	All Organisms → cellular organisms → Bacteria → Proteobacteria	595
3300005842|Ga0068858_102581067	All Organisms → cellular organisms → Bacteria → Proteobacteria	502
3300005994|Ga0066789_10103673	All Organisms → cellular organisms → Bacteria → Proteobacteria	1221
3300006028|Ga0070717_10524219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1072
3300006358|Ga0068871_101553264	All Organisms → cellular organisms → Bacteria	626
3300006880|Ga0075429_101940206	All Organisms → cellular organisms → Bacteria → Proteobacteria	510
3300007004|Ga0079218_13000406	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	568
3300007076|Ga0075435_101249879	All Organisms → cellular organisms → Bacteria	650
3300009012|Ga0066710_100641670	All Organisms → cellular organisms → Bacteria → Proteobacteria	1614
3300009092|Ga0105250_10388887	All Organisms → cellular organisms → Bacteria	617
3300009111|Ga0115026_11944254	All Organisms → cellular organisms → Bacteria	502
3300009137|Ga0066709_101502407	All Organisms → cellular organisms → Bacteria → Proteobacteria	972
3300009162|Ga0075423_10457236	All Organisms → cellular organisms → Bacteria	1342
3300009174|Ga0105241_10571467	Not Available	1018
3300009176|Ga0105242_11845242	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	644
3300009177|Ga0105248_10071495	All Organisms → cellular organisms → Bacteria → Proteobacteria	3898
3300009177|Ga0105248_12854855	All Organisms → cellular organisms → Bacteria	551
3300009792|Ga0126374_11889637	All Organisms → cellular organisms → Bacteria	502
3300010043|Ga0126380_11520343	All Organisms → cellular organisms → Bacteria	594
3300010326|Ga0134065_10063184	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1166
3300010337|Ga0134062_10335940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	724
3300010361|Ga0126378_11432352	All Organisms → cellular organisms → Bacteria	783
3300010364|Ga0134066_10136171	All Organisms → cellular organisms → Bacteria → Proteobacteria	756
3300010371|Ga0134125_10101449	All Organisms → cellular organisms → Bacteria	3204
3300010399|Ga0134127_10972806	All Organisms → cellular organisms → Bacteria → Proteobacteria	907
3300012185|Ga0136619_10289827	Not Available	621
3300012198|Ga0137364_10424373	All Organisms → cellular organisms → Bacteria	996
3300012202|Ga0137363_11537869	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	557
3300012207|Ga0137381_10798994	All Organisms → cellular organisms → Bacteria → Proteobacteria	818
3300012285|Ga0137370_10545042	All Organisms → cellular organisms → Bacteria → Proteobacteria	713
3300012349|Ga0137387_10419011	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	971
3300012353|Ga0137367_11150395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	521
3300012955|Ga0164298_10314959	All Organisms → cellular organisms → Bacteria	975
3300013297|Ga0157378_11388228	All Organisms → cellular organisms → Bacteria	745
3300013307|Ga0157372_10522697	All Organisms → cellular organisms → Bacteria → Proteobacteria	1383
3300013308|Ga0157375_10602662	All Organisms → cellular organisms → Bacteria	1257
3300014325|Ga0163163_10057467	All Organisms → cellular organisms → Bacteria → Proteobacteria	3847
3300014326|Ga0157380_10263538	All Organisms → cellular organisms → Bacteria → Proteobacteria	1567
3300015080|Ga0167639_1021847	All Organisms → cellular organisms → Bacteria → Proteobacteria	898
3300017792|Ga0163161_10462007	All Organisms → cellular organisms → Bacteria → Proteobacteria	1028
3300017792|Ga0163161_10986579	Not Available	718
3300017994|Ga0187822_10257220	All Organisms → cellular organisms → Bacteria → Proteobacteria	602
3300018051|Ga0184620_10137607	All Organisms → cellular organisms → Bacteria	782
3300018071|Ga0184618_10023468	All Organisms → cellular organisms → Bacteria	2048
3300018078|Ga0184612_10623782	All Organisms → cellular organisms → Bacteria → Proteobacteria	508
3300020167|Ga0194035_1187048	All Organisms → cellular organisms → Bacteria	638
3300021080|Ga0210382_10018467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2489
3300021478|Ga0210402_11254940	All Organisms → cellular organisms → Bacteria → Proteobacteria	668
3300025790|Ga0210075_1103128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas	504
3300025906|Ga0207699_10599609	All Organisms → cellular organisms → Bacteria → Proteobacteria	802
3300025907|Ga0207645_10137829	All Organisms → cellular organisms → Bacteria → Proteobacteria	1589
3300025907|Ga0207645_10617456	All Organisms → cellular organisms → Bacteria → Proteobacteria	736
3300025907|Ga0207645_10824585	All Organisms → cellular organisms → Bacteria	631
3300025922|Ga0207646_11763563	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	530
3300025925|Ga0207650_10572202	All Organisms → cellular organisms → Bacteria	948
3300025927|Ga0207687_10458117	Not Available	1059
3300025927|Ga0207687_11087751	All Organisms → cellular organisms → Bacteria	686
3300025927|Ga0207687_11362662	All Organisms → cellular organisms → Bacteria	610
3300025931|Ga0207644_10394730	All Organisms → cellular organisms → Bacteria	1130
3300025932|Ga0207690_11127752	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	654
3300025933|Ga0207706_10875946	All Organisms → cellular organisms → Bacteria	759
3300025937|Ga0207669_11735969	All Organisms → cellular organisms → Bacteria	533
3300025942|Ga0207689_10692334	Not Available	859
3300025945|Ga0207679_10055604	All Organisms → cellular organisms → Bacteria → Proteobacteria	2918
3300025945|Ga0207679_11505301	All Organisms → cellular organisms → Bacteria	617
3300025956|Ga0210104_1007724	All Organisms → cellular organisms → Bacteria → Proteobacteria	1291
3300025981|Ga0207640_10456601	All Organisms → cellular organisms → Bacteria	1054
3300025981|Ga0207640_11160528	Not Available	685
3300025986|Ga0207658_10030065	All Organisms → cellular organisms → Bacteria → Proteobacteria	3842
3300025986|Ga0207658_10474401	All Organisms → cellular organisms → Bacteria	1111
3300026035|Ga0207703_12100537	All Organisms → cellular organisms → Bacteria	541
3300026041|Ga0207639_11928367	All Organisms → cellular organisms → Bacteria → Proteobacteria	552
3300026067|Ga0207678_11281703	All Organisms → cellular organisms → Bacteria	648
3300026078|Ga0207702_12110006	All Organisms → cellular organisms → Bacteria	553
3300026088|Ga0207641_10319376	All Organisms → cellular organisms → Bacteria → Proteobacteria	1472
3300026089|Ga0207648_11497025	All Organisms → cellular organisms → Bacteria	634
3300026089|Ga0207648_11855980	All Organisms → cellular organisms → Bacteria	564
3300026121|Ga0207683_12161874	All Organisms → cellular organisms → Bacteria	505
3300026142|Ga0207698_10898586	All Organisms → cellular organisms → Bacteria	893
3300027471|Ga0209995_1036739	All Organisms → cellular organisms → Bacteria → Proteobacteria	825
3300027682|Ga0209971_1067591	All Organisms → cellular organisms → Bacteria	867
3300027885|Ga0209450_10953742	All Organisms → cellular organisms → Bacteria	611
3300028679|Ga0302169_10101213	All Organisms → cellular organisms → Bacteria → Proteobacteria	699
3300028856|Ga0302295_1089363	All Organisms → cellular organisms → Bacteria → Proteobacteria	677
3300030019|Ga0311348_10324375	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1148
3300030114|Ga0311333_10662443	All Organisms → cellular organisms → Bacteria → Proteobacteria	868
3300030294|Ga0311349_11345817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	664
3300030838|Ga0311335_10666957	All Organisms → cellular organisms → Bacteria → Proteobacteria	730
3300031521|Ga0311364_10784360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	956
3300031546|Ga0318538_10041277	All Organisms → cellular organisms → Bacteria → Proteobacteria	2216
3300031640|Ga0318555_10072419	All Organisms → cellular organisms → Bacteria → Proteobacteria	1783
3300031720|Ga0307469_11331708	All Organisms → cellular organisms → Bacteria	683
3300031768|Ga0318509_10081251	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1719
3300031771|Ga0318546_10853548	All Organisms → cellular organisms → Bacteria	641
3300031834|Ga0315290_10658470	All Organisms → cellular organisms → Bacteria	905
3300031846|Ga0318512_10263291	Not Available	853
3300031918|Ga0311367_10222285	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1973
3300031918|Ga0311367_11758867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	603
3300031939|Ga0308174_10715130	All Organisms → cellular organisms → Bacteria → Proteobacteria	837
3300031939|Ga0308174_11041987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	695
3300031954|Ga0306926_12363250	All Organisms → cellular organisms → Bacteria	587
3300031995|Ga0307409_101860745	All Organisms → cellular organisms → Bacteria	631
3300031996|Ga0308176_10408338	All Organisms → cellular organisms → Bacteria → Proteobacteria	1357
3300031997|Ga0315278_11808276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	577
3300032005|Ga0307411_10090353	All Organisms → cellular organisms → Bacteria → Proteobacteria	2136
3300032008|Ga0318562_10605272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	633
3300032075|Ga0310890_11199010	All Organisms → cellular organisms → Bacteria → Proteobacteria	618
3300032143|Ga0315292_11023960	All Organisms → cellular organisms → Bacteria	685
3300032173|Ga0315268_10439560	All Organisms → cellular organisms → Bacteria	1281
3300032205|Ga0307472_100600963	All Organisms → cellular organisms → Bacteria	971
3300032205|Ga0307472_101166008	All Organisms → cellular organisms → Bacteria	734
3300032954|Ga0335083_10995682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	660
3300033004|Ga0335084_11074892	All Organisms → cellular organisms → Bacteria	808
3300033413|Ga0316603_11379694	All Organisms → cellular organisms → Bacteria → Proteobacteria	668
3300033419|Ga0316601_101825388	All Organisms → cellular organisms → Bacteria	613
3300033480|Ga0316620_10399920	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1241
3300033480|Ga0316620_12268045	All Organisms → cellular organisms → Bacteria	540
3300033482|Ga0316627_102015564	All Organisms → cellular organisms → Bacteria	599
3300034196|Ga0370503_0085647	All Organisms → cellular organisms → Bacteria	1061

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	53.64%
Host-Associated	Host-Associated	46.36%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	46.36%
Terrestrial	Environmental → Terrestrial	43.05%
Aquatic	Environmental → Aquatic	10.60%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	37.09%
Rhizosphere	Host-Associated → Plants → Rhizosphere	25.17%
Rhizoplane	Host-Associated → Plants → Rhizoplane	19.87%
Freshwater	Environmental → Aquatic → Freshwater	6.62%
Peat	Environmental → Terrestrial → Peat	5.96%
Marine	Environmental → Aquatic → Marine	1.99%
Sediment	Environmental → Aquatic → Sediment	1.99%
Roots	Host-Associated → Plants → Roots	1.32%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	24.50%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	19.21%
Soil	Host-Associated → Plants → Rhizosphere → Soil	13.91%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.26%
Loam	Environmental → Terrestrial → Soil → Loam	6.62%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.96%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	5.96%
Lake	Environmental → Aquatic → Freshwater → Lake	3.31%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.99%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.99%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.32%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.32%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.66%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.66%
Ice	Environmental → Aquatic → Freshwater → Ice	0.66%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.66%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	19.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	13.91%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.26%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	10.60%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.28%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	5.96%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.30%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.30%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.31%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	2.65%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.65%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.99%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.32%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.32%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.32%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.32%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.66%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.66%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.66%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.66%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.66%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.66%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.66%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.66%

Habitat

Habitat	Taxonomy	Distribution
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	5.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.64%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.64%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	4.64%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	4.64%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	4.64%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.64%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.97%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.97%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	2.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.65%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.99%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.99%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.99%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.99%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.99%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.99%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.99%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.32%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.32%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.32%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.32%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.32%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.32%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.32%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.66%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.66%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.66%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.66%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.66%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.66%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.66%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.66%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.66%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.66%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.66%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.66%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.66%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.66%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.66%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.66%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.66%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.66%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.66%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental
3300002562	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm	Environmental
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300005994	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049	Environmental
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental
3300010326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG	Environmental
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300012185	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06)	Environmental
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300015080	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary)	Environmental
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental
3300018051	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1	Environmental
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental
3300020167	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m	Environmental
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental
3300025790	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 (SPAdes)	Environmental
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated
3300025956	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 (SPAdes)	Environmental
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated
3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes)	Host-Associated
3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)	Host-Associated
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental
3300028679	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3	Environmental
3300028856	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_4	Environmental
3300030019	II_Fen_E2 coassembly	Environmental
3300030114	I_Fen_E2 coassembly	Environmental
3300030294	II_Fen_E3 coassembly	Environmental
3300030838	I_Fen_N1 coassembly	Environmental
3300031521	III_Fen_E2 coassembly	Environmental
3300031546	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23	Environmental
3300031640	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23	Environmental
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental
3300031768	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22	Environmental
3300031771	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19	Environmental
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental
3300031846	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19	Environmental
3300031918	III_Fen_N3 coassembly	Environmental
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental
3300031997	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0	Environmental
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated
3300032008	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18	Environmental
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental
3300034196	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGIcombinedJ13530_1074967781	3300001213	Wetland	FRTITRTLRNYFLDRRQGAFPLRLSTLERRPPVKPDLVGAG*
JGI25382J37095_102296811	3300002562	Grasslands Soil	AFRTITRTLRNYFLDRKLGEFPVRVSALEKRAPLKPELLGAG*
Ga0066690_101313723	3300005177	Soil	GDLAFRTITRTLRNYFLDRKLGAFPLHVSALEKRAPREPGLAGAA*
Ga0070683_1000647411	3300005329	Corn Rhizosphere	TIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG*
Ga0066388_1022213751	3300005332	Tropical Forest Soil	GELAFRTIARTLRNYFLDRKLGAFPTRVSVIERRAARDPALLGAG*
Ga0066388_1082104402	3300005332	Tropical Forest Soil	MAFRTITRTLRNFFLDRKRGSFPVHVSALTRRVPLRPELSGAG*
Ga0070677_100756441	3300005333	Miscanthus Rhizosphere	AFRTITRTLRTFFLDRKLGEFPVRVSSLERRPPVSPDLRGAA*
Ga0068869_1001251143	3300005334	Miscanthus Rhizosphere	FRTIARTLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA*
Ga0070682_1015649912	3300005337	Corn Rhizosphere	EVPWESLAFRTIARTLRNFFLDRRLDAFALHVSAIERRPPLTPDLLAAG*
Ga0070668_1022706341	3300005347	Switchgrass Rhizosphere	TITRTLRNYFLDRRQRAFPLRVSSLERRPPLPPDLLAAG*
Ga0070671_1017401021	3300005355	Switchgrass Rhizosphere	IAFRTIARTLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA*
Ga0070667_1015550231	3300005367	Switchgrass Rhizosphere	WAELAFRTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG*
Ga0070700_1018664971	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	FRTIGRTLRNYFLDRKLGRFPTRVSVLERRAPRPDLAAAA*
Ga0066686_110511502	3300005446	Soil	FRTIARTLRNYFLDRKLQRLRLHVSALEKRTALKPELAGAA*
Ga0070663_1018256961	3300005455	Corn Rhizosphere	TIGRTLRRYFLDRRMGRFGLHVSAIERRPPLTPDLLAAG*
Ga0070707_1002854862	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	LAFRTIARTLRNYFLDRKLGEFPVHVSALERRAPRPELSGAA*
Ga0070672_1000789293	3300005543	Miscanthus Rhizosphere	FRTITRTLRNYFLDRRQNAYPVRVSSLERRPPLPPDLLAAG*
Ga0070672_1007838952	3300005543	Miscanthus Rhizosphere	RTIGRTLRNYFLDRKLGAFPTRVSVLERRAPRPDLAGAA*
Ga0070695_1004638831	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	LAFRTIGRTLRNFFLDRRLDAFSLHVSAIERRPPLTPDLLAAG*
Ga0068855_1004302621	3300005563	Corn Rhizosphere	LRNYFLDRRLGRFTMHVSAIERRAPLTPDLLAAG*
Ga0070664_1001333941	3300005564	Corn Rhizosphere	IARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG*
Ga0068854_1011874492	3300005578	Corn Rhizosphere	LAFRTIGRTLRNYFLDRKLGQFPTRVSVLERRAPRPDLAAAA*
Ga0068854_1014561821	3300005578	Corn Rhizosphere	RTLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA*
Ga0068852_1011312402	3300005616	Corn Rhizosphere	ARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG*
Ga0068859_1001091513	3300005617	Switchgrass Rhizosphere	FRTITRTLRNYFLDRRQNAYPVRVSSLERRPPLPPDLLAAA*
Ga0068859_1008300542	3300005617	Switchgrass Rhizosphere	FRTITRTLRNFFLDRKLGQFPLHISSIERRPPLPPDLRGAA*
Ga0068859_1029222571	3300005617	Switchgrass Rhizosphere	RTITRTLRTYFLDRKLGSFPVRVSALARRPPVGPDLRGAA*
Ga0068864_1001216363	3300005618	Switchgrass Rhizosphere	IPWEALAFRTITRTLRNYFLDRRQNAYPVRVSSLERRPPLPPDLLAAG*
Ga0068866_107732952	3300005718	Miscanthus Rhizosphere	TRTLRNFFLDRKLGQFPLRVSALQRRPPLPPDLRGAG*
Ga0068866_114089331	3300005718	Miscanthus Rhizosphere	TLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA*
Ga0068861_1013585061	3300005719	Switchgrass Rhizosphere	AFRTIARTLRNYFMDRRRGGFALHVSAIERRAPLTPDLLAAG*
Ga0068870_109313602	3300005840	Miscanthus Rhizosphere	TIGRTLRNYFLDRKLGRFPTHVSVLERRAPRPDLEAAA*
Ga0068863_1019645661	3300005841	Switchgrass Rhizosphere	RTLRNYFLDRREGAFPLRLSTLERRPAPPDLRGAA*
Ga0068858_1025810671	3300005842	Switchgrass Rhizosphere	TLRNFFLDRKLGAFPIRVSAIERRPPLPPDLRGAA*
Ga0066789_101036733	3300005994	Soil	QLAFRTISRSLRNYFLDRKLGRFPVRVSTIDRRVPAKPQVPAPT*
Ga0070717_105242191	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	TIARTLRNYFLDRKLGTFPVHVSTIERRVPLPPAATGAA*
Ga0068871_1015532642	3300006358	Miscanthus Rhizosphere	TLRNYFLDRREGAFPLRLSTLERRPPPPDLGGAA*
Ga0075429_1019402061	3300006880	Populus Rhizosphere	FRTIGRTLRNYFLDRKLGHFPTRVSVLERRAPRPDLEAAA*
Ga0079218_130004061	3300007004	Agricultural Soil	LAFRTITRTLRNYFLDRKLGAFPVRVSALERRVPARPELSGAG*
Ga0075435_1012498791	3300007076	Populus Rhizosphere	RTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG*
Ga0066710_1006416703	3300009012	Grasslands Soil	FRTITRTLRNYFLDRKLGEFPVHVSALERRAPLKPELLGAG
Ga0105250_103888871	3300009092	Switchgrass Rhizosphere	RTITRTLRNFFLDRKLGRFPLRVSALQRRPPLPPDLRGAG*
Ga0115026_119442541	3300009111	Wetland	WEDMAFRTIGRTLRNYFVDRRLGAFPTRVSALERRLPRPDLGGAG*
Ga0066709_1015024071	3300009137	Grasslands Soil	IARTLRNYFLDRKLGEFPVHVSALEKRAPRPELSGAA*
Ga0075423_104572362	3300009162	Populus Rhizosphere	VPWEAIAFRSIARTLRNYFLDRRQRAFNLHVSALERRPPLTPDLLAAG*
Ga0105241_105714671	3300009174	Corn Rhizosphere	DIAFRTIARTLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA*
Ga0105242_118452421	3300009176	Miscanthus Rhizosphere	TLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG*
Ga0105248_100714951	3300009177	Switchgrass Rhizosphere	RTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG*
Ga0105248_128548551	3300009177	Switchgrass Rhizosphere	IGRTLRNYFLDRKLGTLQTRVSALERRAPRPDLSGAG*
Ga0126374_118896371	3300009792	Tropical Forest Soil	RTLRNYFLDRKLGAFPTRVSVIERRAARDPALLGAG*
Ga0126380_115203431	3300010043	Tropical Forest Soil	TITRTLRNYFLDRKLGAFPTHVSALERRARPQPELQGAG*
Ga0134065_100631841	3300010326	Grasslands Soil	SEIAFRTITRTLRNYFLDRKLGDFPVRVSALEKRAPLKPELLGAG*
Ga0134062_103359401	3300010337	Grasslands Soil	TLRNYFLDRKLGDFPVRVSALEKRAPLKPELLGAG*
Ga0126378_114323521	3300010361	Tropical Forest Soil	RTLRNYFLDRKLGAFPTHVSALERRAPRPDLSGAA*
Ga0134066_101361713	3300010364	Grasslands Soil	FRTITRTLRNFFLDRKQGSFPVHVSALTRRVPLRPELSGAG*
Ga0134125_101014491	3300010371	Terrestrial Soil	RTIARTLRNYFLDRRLGRFTMHVSAIERRAPLTPDLLAAG*
Ga0134127_109728061	3300010399	Terrestrial Soil	IAFRTIARTLRHYFLDRKLGAFPLHVSALFKRSPREPGLQAAA*
Ga0136619_102898271	3300012185	Polar Desert Sand	LAFRTITRTLRNFFLDRKLGNEATHVSALVRRAPVPPDLRGAA*
Ga0137364_104243731	3300012198	Vadose Zone Soil	RTITRTLRNYFLDRKLGAFPLHVSALEKRAPREPALAGAA*
Ga0137363_115378691	3300012202	Vadose Zone Soil	TRTLRNYFLDRKLGGFPVHVSALERRVPVKPDLVGAG*
Ga0137381_107989941	3300012207	Vadose Zone Soil	LAFRTIARTLRNYFLDRKLGEFPVHVSALEKRTPRPELSGAA*
Ga0137370_105450421	3300012285	Vadose Zone Soil	GDLAFRTITRTLRNYFLDRKRGAFPLHVSALEKRAPREPALAGAA*
Ga0137387_104190111	3300012349	Vadose Zone Soil	ARTLRNYFLDRKLGEFPVHVSALEKRTPRPELSGAA*
Ga0137367_111503951	3300012353	Vadose Zone Soil	FRTIGRTLRNYFLDRKLGGFPVHVSTLVRRQGVTPALTGAA*
Ga0164298_103149592	3300012955	Soil	FRTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG*
Ga0157378_113882281	3300013297	Miscanthus Rhizosphere	FRTIGRTLRNYFLDRKLGTLQTRVSALERRAPRPDLSGAG*
Ga0157372_105226973	3300013307	Corn Rhizosphere	LRNFFLDRRLGAFALHVSAIERRPPLTPELLAAG*
Ga0157375_106026622	3300013308	Miscanthus Rhizosphere	WESLAFRTITRTLRTYFLDRKLGSFPVRVSALARRPPVGPDLRGAA*
Ga0163163_100574675	3300014325	Switchgrass Rhizosphere	LRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG*
Ga0157380_102635381	3300014326	Switchgrass Rhizosphere	LAFRTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG*
Ga0167639_10218472	3300015080	Glacier Forefield Soil	TRTLRNYFLDRKLGAFPVHVSALEKRVPREPALAGAA*
Ga0163161_104620071	3300017792	Switchgrass Rhizosphere	RTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG
Ga0163161_109865791	3300017792	Switchgrass Rhizosphere	QLAFRTITRTLRNYFLDRKLGAFPVRVSALERRVPAKPELSGAG
Ga0187822_102572201	3300017994	Freshwater Sediment	TLRNFFLDRRLDAFALHVSAIERRPPLTPDLLAAG
Ga0184620_101376072	3300018051	Groundwater Sediment	IGRTLRNYFHDRKLGTFPTRLSVLERKAPRPDLSGAA
Ga0184618_100234683	3300018071	Groundwater Sediment	PWETLAFRTIARTLRNWFLDRRSGAFPLRMSALERRGPPPPDLAAAA
Ga0184612_106237822	3300018078	Groundwater Sediment	TRTLRNYFLDRKLGSFPVRLSSLERRPPLPPDLLAAG
Ga0194035_11870481	3300020167	Anoxic Zone Freshwater	ALAFRTITRTLRNYFLDRKRGVFPVRVSSLERKAARSG
Ga0210382_100184671	3300021080	Groundwater Sediment	TLRNYFLDRKLGAFTVHVSALEKRAPREPALAAAA
Ga0210402_112549402	3300021478	Soil	GRTLRNYFLDRKLGAFPLHVSAVDRRLPREASLAAAA
Ga0210075_11031282	3300025790	Natural And Restored Wetlands	FRTITRTLRNYFLDRKNGSFPTRVSTLVRKPPPADLSGAG
Ga0207699_105996091	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	IARTLRNFFLDRRLGRFSLHVSSIERRAPLPPDLLAAG
Ga0207645_101378293	3300025907	Miscanthus Rhizosphere	FRTIGRTLRNYFLDRKLGTFPTRVSALERKAPRPDLAGAA
Ga0207645_106174563	3300025907	Miscanthus Rhizosphere	TLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA
Ga0207645_108245851	3300025907	Miscanthus Rhizosphere	ESLACRTSARTLRNYFMDRRRGGFALHVSAIERRAPLSPDLLAAG
Ga0207646_117635631	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	FRTIARTLRNYFLDRKLGEFPVHVSALERRAPRPELSGAA
Ga0207650_105722021	3300025925	Switchgrass Rhizosphere	PWEALAFRTITRTLRNYFLDRRQNAYPVRVSSLERRPPLPPDLLAAA
Ga0207687_104581171	3300025927	Miscanthus Rhizosphere	FRTIARTLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA
Ga0207687_110877511	3300025927	Miscanthus Rhizosphere	PWAELAFRTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG
Ga0207687_113626621	3300025927	Miscanthus Rhizosphere	AFRTITRTLRNYFLDRRQNAYPVRVSSLERRPPLPPDLLAAG
Ga0207644_103947301	3300025931	Switchgrass Rhizosphere	TLRTFFLDRKLGEFPVRVSSLERRPPVSPDLRGAA
Ga0207690_111277521	3300025932	Corn Rhizosphere	IGRTLRNYFLDRKLGTFPTRLSVLERKAPRPDMSGAA
Ga0207706_108759461	3300025933	Corn Rhizosphere	RTIARTLRNFLLDRRLGAFKLHVSSIERRAPLPPDLLAAG
Ga0207669_117359692	3300025937	Miscanthus Rhizosphere	RTIGRTLRNYFLDRKLGTFPTRVSALERKAPRPDLAGAA
Ga0207689_106923341	3300025942	Miscanthus Rhizosphere	IARTLRNYFLDRKLGAFPLHVSALFKRSPREPALQAAA
Ga0207679_100556041	3300025945	Corn Rhizosphere	IARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG
Ga0207679_115053011	3300025945	Corn Rhizosphere	RTIGRTLRRFFLDRRLGAFGLHVSALERRPPLTPDLVAAG
Ga0210104_10077241	3300025956	Natural And Restored Wetlands	GRTLRNYFLDRKLGAFPTRVSVLERKAPQPDLSGAA
Ga0207640_104566011	3300025981	Corn Rhizosphere	TLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG
Ga0207640_111605282	3300025981	Corn Rhizosphere	LAFRTIGRTLRNYFLDRKLGQFPTRVSVLERRAPRPDLAAAA
Ga0207658_100300651	3300025986	Switchgrass Rhizosphere	RTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG
Ga0207658_104744011	3300025986	Switchgrass Rhizosphere	DSIPWEDLAFRTIGRTLRNYFLDRKLGTLQTRVSALERKVVRPDLSGAG
Ga0207703_121005372	3300026035	Switchgrass Rhizosphere	AFRTIGRTLRNYFLDRKLGTFPTRLSVLERKAPRPDMSGAA
Ga0207639_119283672	3300026041	Corn Rhizosphere	EVPWESLAFRTIARTLRNFFLDRRLDAFALHVSAIERRPPLTPDLLAAG
Ga0207678_112817032	3300026067	Corn Rhizosphere	IAFRTIGRTLRRYFLDRRMGRFGLHVSAIERRPPLTPDLLAAG
Ga0207702_121100062	3300026078	Corn Rhizosphere	FRTIARTLRNFFLDRRLGAFKLHVSSIERRAPLPPDLLAAG
Ga0207641_103193761	3300026088	Switchgrass Rhizosphere	AFRTITRTLRNYFLDRRYGTFRVHVSALTRRVPLRPELSGAG
Ga0207648_114970251	3300026089	Miscanthus Rhizosphere	RTITRTLRNFFLDRKLGAFPIRVSAIERRPPLPPDLRGAA
Ga0207648_118559801	3300026089	Miscanthus Rhizosphere	ESLAFRTIARTLRNYFMDRRRGDFTLHVSAIERRAPLTPDLLAAG
Ga0207683_121618741	3300026121	Miscanthus Rhizosphere	MAFRTIGRTLRNYFLDRKLGSFPTRVSALERKAPRPDLAGAA
Ga0207698_108985861	3300026142	Corn Rhizosphere	LAFRTITRTLRNYFLDRKLGEFPVRVSALERRPESRPRGIPVP
Ga0209995_10367391	3300027471	Arabidopsis Thaliana Rhizosphere	FRTIARTLRNYFLDRRMSSFSLHVSSIERRAPLTPDLLAAG
Ga0209971_10675912	3300027682	Arabidopsis Thaliana Rhizosphere	IARTLRNYFLDRRRGAFRLHVSALARRSPITPDLLAAG
Ga0209450_109537422	3300027885	Freshwater Lake Sediment	LAFRTIARTLRNYFVDRRLGSFPLRVSALERKPPR
Ga0302169_101012133	3300028679	Fen	TITRTLRNYFLDRKQGAFPVRVSSLERRPPLPPDLLAAG
Ga0302295_10893631	3300028856	Fen	LAFRTITRTLRNYFLDRKQGGFPLRLSALERRPPLPPDLLAAG
Ga0311348_103243751	3300030019	Fen	LAFRTIARTLRNYFLDRKLGAFPVHESALERRAPVPPSLSGAG
Ga0311333_106624433	3300030114	Fen	WESLAFRTITRTLRNYFLDRKQGAFPVRVSSLERRPPLPPDLLAAG
Ga0311349_113458171	3300030294	Fen	IGRTLRNYFLDRKVGAFPTRVSTLIRKPPRPDVIGAA
Ga0311335_106669571	3300030838	Fen	ESLAFRTIARTLRNYFLDRKQGGFPLRLSALERRPPLPPDLLAAG
Ga0311364_107843603	3300031521	Fen	ARTLRNYFLDRKQGGFPLRLSALERRPPLPPDLLAAG
Ga0318538_100412771	3300031546	Soil	IAFRTITRTLRNFFLDRKLGAFPTHVSIIERRAARDPRLSGAG
Ga0318555_100724191	3300031640	Soil	NEIAFRTITRTLRNFFLDRKLGAFPTHVSIIERRAARDPRLSGAG
Ga0307469_113317081	3300031720	Hardwood Forest Soil	IGRTLRNYFLDRKLGTLRTRVSALERRAPRPDLSGAA
Ga0318509_100812511	3300031768	Soil	FRTITRTLRNFFLDRKLGAFPTHVSIIERRAARDPRLSGAG
Ga0318546_108535481	3300031771	Soil	LAFRTIGRTLRNYFLDRKLGAFGTHVSALERRAPRPDLSGAG
Ga0315290_106584701	3300031834	Sediment	TIGRTLRNYFLDRKLGAFPTRVSVLERKAPRPDLSGAA
Ga0318512_102632911	3300031846	Soil	ITRTLRNFFLDRKLGAFPTHVSIIERRAARDPRLSGAG
Ga0311367_102222851	3300031918	Fen	TITRTLRNYFLDRKQGGFPLRLSALERRPPLPPDLLAAG
Ga0311367_117588672	3300031918	Fen	LAFRTITRTLRNYFLDRKQGACPVRVSSLERRLPLPMDLLAAG
Ga0308174_107151303	3300031939	Soil	RTIARTLRNYFLDRRLGAFTMHVSAIERRTALTPDLLAGG
Ga0308174_110419873	3300031939	Soil	FRTIGRTLRRYFLDRRLGSFGLHVSSIERRPPLAPDLLAAG
Ga0306926_123632501	3300031954	Soil	ITRTLRNYFLDRKLGAFPTHVSALERRARPQPELLGAG
Ga0307409_1018607452	3300031995	Rhizosphere	FRTIARTLRTFFLDRKLGAFPVRVSSLERRPPVSPDLRGAA
Ga0308176_104083384	3300031996	Soil	ARTLRNYFLDRRLGRFALHVSAIERRSPLTPDLLAAG
Ga0315278_118082762	3300031997	Sediment	LAFRTITRTLRSYFLDRKLGAFPVRVSVLERRPPVRPEFAAAG
Ga0307411_100903533	3300032005	Rhizosphere	IGRTLRNWFLDRKLGTFGVHVSSLERRPPLPPNLLGAG
Ga0318562_106052721	3300032008	Soil	FRTITRTLRNFFLDRKLGAFPTHVSVIERRAARDPRLSGAG
Ga0310890_111990102	3300032075	Soil	LAFRTITRTLRTYFLDRKLGSFPVRVSALARRPPVGPDLRGAA
Ga0315292_110239601	3300032143	Sediment	GRTLRNYFLDRKLGVFPTRVSVLERRAPRPDLSGAA
Ga0315268_104395602	3300032173	Sediment	TIGRTLRNYFLDRKLGVFPTRVSVLERKAPRPDLAGAG
Ga0307472_1006009631	3300032205	Hardwood Forest Soil	FRTIGRTLRNFFLDRKLGSFPVRLSTIDRRVPPKPDVAGAA
Ga0307472_1011660082	3300032205	Hardwood Forest Soil	RTLRNYFLDRKLGTLQTRVSALERRAPRPELSGAG
Ga0335083_109956823	3300032954	Soil	TIGRTLRNYFLDRRRGAFGTHVSALERKAPRPDLSGAG
Ga0335084_110748921	3300033004	Soil	EMAFRTIGRTLRNYFLDRKLGHFPMRVSVLERRAPRPDLAGAA
Ga0316603_113796941	3300033413	Soil	FRTITRTLRSFFLDRRLGAYPTRVSALERRPQAKPDLSGAG
Ga0316601_1018253882	3300033419	Soil	LAFRTITRTLRRYFLDRRHGAYATHVSALERRPADRRADLTGAA
Ga0316620_103999203	3300033480	Soil	EELAFRTIARTLRNYFLDRKLGSFPPHVSTLHKHVPLPADLTAAA
Ga0316620_122680452	3300033480	Soil	FRTIARTLRNYFLDRRRGSFELQLSALERRPPLPPDLLAAG
Ga0316627_1020155642	3300033482	Soil	FRTITRTLRNYFLDRKLGRFGVRVSALERRPPLPPDLRGAG
Ga0370503_0085647_915_1046	3300034196	Untreated Peat Soil	MAFRTITRTLRNYFLDRKQGALPLRISALERRPPLPPDLRGAG