NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046299

Metagenome / Metatranscriptome Family F046299

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046299
Family Type Metagenome / Metatranscriptome
Number of Sequences 151
Average Sequence Length 40 residues
Representative Sequence NQLGVALPATAAARETYNYVKGSAKEDLDYSAVMKFWKK
Number of Associated Samples 127
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.66 %
% of genes near scaffold ends (potentially truncated) 99.34 %
% of genes from short scaffolds (< 2000 bps) 90.73 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.689 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(25.828 % of family members)
Environment Ontology (ENVO) Unclassified
(31.126 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.033 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 43.28%    β-sheet: 0.00%    Coil/Unstructured: 56.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF01209Ubie_methyltran 8.61
PF00924MS_channel 6.62
PF03544TonB_C 5.96
PF05592Bac_rhamnosid 5.96
PF01113DapB_N 4.64
PF01329Pterin_4a 3.31
PF00561Abhydrolase_1 3.31
PF05899Cupin_3 2.65
PF04389Peptidase_M28 1.99
PF03446NAD_binding_2 1.99
PF01135PCMT 1.32
PF07883Cupin_2 1.32
PF14833NAD_binding_11 1.32
PF06182ABC2_membrane_6 0.66
PF04014MazE_antitoxin 0.66
PF12697Abhydrolase_6 0.66
PF05231MASE1 0.66
PF02687FtsX 0.66
PF13520AA_permease_2 0.66
PF00158Sigma54_activat 0.66
PF00672HAMP 0.66
PF07505DUF5131 0.66
PF01850PIN 0.66
PF01084Ribosomal_S18 0.66
PF08308PEGA 0.66
PF08388GIIM 0.66
PF04191PEMT 0.66
PF07238PilZ 0.66
PF08818DUF1801 0.66
PF13701DDE_Tnp_1_4 0.66
PF02077SURF4 0.66
PF00072Response_reg 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 9.93
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 8.61
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 6.62
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 6.62
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 5.96
COG3408Glycogen debranching enzyme (alpha-1,6-glucosidase)Carbohydrate transport and metabolism [G] 5.96
COG2154Pterin-4a-carbinolamine dehydrataseCoenzyme transport and metabolism [H] 3.31
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 1.32
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 1.32
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 1.32
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.66
COG0238Ribosomal protein S18Translation, ribosomal structure and biogenesis [J] 0.66
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.66
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.66
COG4422Bacteriophage protein gp37Mobilome: prophages, transposons [X] 0.66
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.66
COG3694ABC-type uncharacterized transport system, permease componentGeneral function prediction only [R] 0.66
COG3447Integral membrane sensor domain MASE1Signal transduction mechanisms [T] 0.66
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.66
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.69 %
UnclassifiedrootN/A3.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000731|JGI12381J11899_1010431All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300001593|JGI12635J15846_10175822All Organisms → cellular organisms → Bacteria → Acidobacteria1441Open in IMG/M
3300001661|JGI12053J15887_10574943All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300002560|JGI25383J37093_10104396All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300004633|Ga0066395_10006810All Organisms → cellular organisms → Bacteria4060Open in IMG/M
3300005444|Ga0070694_101234144All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300005468|Ga0070707_100465377All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300005541|Ga0070733_10885711All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300005559|Ga0066700_10192661All Organisms → cellular organisms → Bacteria → Acidobacteria1404Open in IMG/M
3300005569|Ga0066705_10758105Not Available581Open in IMG/M
3300005607|Ga0070740_10027999All Organisms → cellular organisms → Bacteria3230Open in IMG/M
3300005995|Ga0066790_10083236All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300006032|Ga0066696_10686414All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300006755|Ga0079222_11556954All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300006806|Ga0079220_10687172All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300007265|Ga0099794_10649968All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300009038|Ga0099829_11679024All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300009088|Ga0099830_10272692All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300009088|Ga0099830_10409934All Organisms → cellular organisms → Bacteria → Acidobacteria1097Open in IMG/M
3300009088|Ga0099830_11438937All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300009089|Ga0099828_10060367All Organisms → cellular organisms → Bacteria3179Open in IMG/M
3300009089|Ga0099828_11326764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300009090|Ga0099827_10692716All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium880Open in IMG/M
3300009137|Ga0066709_101550599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis952Open in IMG/M
3300009143|Ga0099792_10473576All Organisms → cellular organisms → Bacteria → Acidobacteria779Open in IMG/M
3300009148|Ga0105243_10870034Not Available894Open in IMG/M
3300009176|Ga0105242_10920988All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300009792|Ga0126374_10113268All Organisms → cellular organisms → Bacteria → Acidobacteria1568Open in IMG/M
3300010046|Ga0126384_11045264All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300010303|Ga0134082_10421203All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300010322|Ga0134084_10395820All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300010358|Ga0126370_10059673All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2470Open in IMG/M
3300010359|Ga0126376_10912636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp.870Open in IMG/M
3300010360|Ga0126372_10347340All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1329Open in IMG/M
3300010360|Ga0126372_11516335All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium707Open in IMG/M
3300010360|Ga0126372_12927662All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300010366|Ga0126379_12003141All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium682Open in IMG/M
3300011269|Ga0137392_10816588All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300011269|Ga0137392_11306159All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300011269|Ga0137392_11447679All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300011270|Ga0137391_10697735All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300011271|Ga0137393_10971304All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300012096|Ga0137389_10985686All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300012096|Ga0137389_11252302All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300012202|Ga0137363_10536069Not Available985Open in IMG/M
3300012202|Ga0137363_11698587All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300012205|Ga0137362_11442930All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300012211|Ga0137377_10610378All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1028Open in IMG/M
3300012212|Ga0150985_121290503All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300012285|Ga0137370_10092173All Organisms → cellular organisms → Bacteria1695Open in IMG/M
3300012349|Ga0137387_10151143All Organisms → cellular organisms → Bacteria1653Open in IMG/M
3300012349|Ga0137387_10707002All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300012350|Ga0137372_10540044All Organisms → cellular organisms → Bacteria → Acidobacteria862Open in IMG/M
3300012356|Ga0137371_10342377All Organisms → cellular organisms → Bacteria → Acidobacteria1162Open in IMG/M
3300012356|Ga0137371_10463340All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300012361|Ga0137360_11895635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300012363|Ga0137390_10370273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.1413Open in IMG/M
3300012363|Ga0137390_10595839All Organisms → cellular organisms → Bacteria → Acidobacteria1073Open in IMG/M
3300012363|Ga0137390_10601678All Organisms → cellular organisms → Bacteria → Acidobacteria1067Open in IMG/M
3300012923|Ga0137359_10261994All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1541Open in IMG/M
3300012925|Ga0137419_11314979All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300012927|Ga0137416_10472821All Organisms → cellular organisms → Bacteria → Acidobacteria1075Open in IMG/M
3300012948|Ga0126375_10202951All Organisms → cellular organisms → Bacteria1304Open in IMG/M
3300012971|Ga0126369_11352304All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium802Open in IMG/M
3300015053|Ga0137405_1028983All Organisms → cellular organisms → Bacteria3331Open in IMG/M
3300015242|Ga0137412_10836895All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300015264|Ga0137403_10249235All Organisms → cellular organisms → Bacteria1687Open in IMG/M
3300016270|Ga0182036_11304209All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300016319|Ga0182033_11966087All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300016445|Ga0182038_11304195All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium649Open in IMG/M
3300017926|Ga0187807_1118557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis838Open in IMG/M
3300017929|Ga0187849_1209674All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium757Open in IMG/M
3300017929|Ga0187849_1213652All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium748Open in IMG/M
3300017931|Ga0187877_1213550All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300017934|Ga0187803_10485432All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300017940|Ga0187853_10455852All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300017943|Ga0187819_10451762All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium735Open in IMG/M
3300017955|Ga0187817_10399916All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300018062|Ga0187784_11519080All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300018086|Ga0187769_11117133All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300018090|Ga0187770_10306648All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300019264|Ga0187796_1412516All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300020170|Ga0179594_10107455All Organisms → cellular organisms → Bacteria → Acidobacteria1008Open in IMG/M
3300020579|Ga0210407_11222528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300020581|Ga0210399_11525552All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300020582|Ga0210395_10281550All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300021046|Ga0215015_10035316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium788Open in IMG/M
3300021046|Ga0215015_10113857All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium720Open in IMG/M
3300021168|Ga0210406_10060936All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3273Open in IMG/M
3300021168|Ga0210406_10134119All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2085Open in IMG/M
3300021171|Ga0210405_10007226All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9784Open in IMG/M
3300021178|Ga0210408_10839647All Organisms → cellular organisms → Bacteria → Acidobacteria718Open in IMG/M
3300021178|Ga0210408_11148404All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300021180|Ga0210396_11765917All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300021405|Ga0210387_10288377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1442Open in IMG/M
3300021406|Ga0210386_10317831All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1336Open in IMG/M
3300021420|Ga0210394_11501197All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300021420|Ga0210394_11596361All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300021559|Ga0210409_10321299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1393Open in IMG/M
3300022533|Ga0242662_10287541All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300025941|Ga0207711_10363518All Organisms → cellular organisms → Bacteria1341Open in IMG/M
3300026313|Ga0209761_1307595All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300026320|Ga0209131_1252863All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300026524|Ga0209690_1204718All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300026527|Ga0209059_1287273All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300026530|Ga0209807_1243695All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300026551|Ga0209648_10150750All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1836Open in IMG/M
3300026557|Ga0179587_11000726All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300026845|Ga0207760_111198All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300027014|Ga0207815_1040846All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300027565|Ga0209219_1108829All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300027576|Ga0209003_1037096All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300027654|Ga0209799_1150518All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300027725|Ga0209178_1043575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1430Open in IMG/M
3300027842|Ga0209580_10104087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1375Open in IMG/M
3300027842|Ga0209580_10206798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis974Open in IMG/M
3300027867|Ga0209167_10588094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300028536|Ga0137415_11025469Not Available637Open in IMG/M
3300030739|Ga0302311_10190806All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1561Open in IMG/M
3300030842|Ga0075404_11599868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium1421Open in IMG/M
3300031573|Ga0310915_10039304All Organisms → cellular organisms → Bacteria3005Open in IMG/M
3300031668|Ga0318542_10113541All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300031682|Ga0318560_10220639All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300031715|Ga0307476_10973225All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300031718|Ga0307474_11500744All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300031719|Ga0306917_10519248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis936Open in IMG/M
3300031720|Ga0307469_11946220All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300031744|Ga0306918_10292321All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1253Open in IMG/M
3300031753|Ga0307477_10019451All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4643Open in IMG/M
3300031753|Ga0307477_10337659All Organisms → cellular organisms → Bacteria → Acidobacteria1037Open in IMG/M
3300031765|Ga0318554_10638500All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300031770|Ga0318521_10321987All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis913Open in IMG/M
3300031833|Ga0310917_10094965All Organisms → cellular organisms → Bacteria1911Open in IMG/M
3300031946|Ga0310910_10164464All Organisms → cellular organisms → Bacteria1705Open in IMG/M
3300031947|Ga0310909_10122360All Organisms → cellular organisms → Bacteria2115Open in IMG/M
3300031954|Ga0306926_10047375All Organisms → cellular organisms → Bacteria5129Open in IMG/M
3300031962|Ga0307479_10057185All Organisms → cellular organisms → Bacteria3756Open in IMG/M
3300031962|Ga0307479_10193137All Organisms → cellular organisms → Bacteria → Acidobacteria2004Open in IMG/M
3300031962|Ga0307479_10369551All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1418Open in IMG/M
3300032059|Ga0318533_11037711All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300032066|Ga0318514_10805610All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300032067|Ga0318524_10119233All Organisms → cellular organisms → Bacteria1318Open in IMG/M
3300032089|Ga0318525_10473019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300032180|Ga0307471_100579335All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1279Open in IMG/M
3300032180|Ga0307471_103107069All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300032180|Ga0307471_103716483Not Available540Open in IMG/M
3300032782|Ga0335082_11028789All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300032895|Ga0335074_10266826All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1995Open in IMG/M
3300032955|Ga0335076_10721397All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300033158|Ga0335077_11122551All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium775Open in IMG/M
3300033289|Ga0310914_10882720All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium793Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil25.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil19.21%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.28%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.97%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.31%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.31%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.65%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.99%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.32%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.32%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.66%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.66%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.66%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000731Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005607Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019264Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026845Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24 (SPAdes)EnvironmentalOpen in IMG/M
3300027014Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027576Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030842Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12381J11899_101043123300000731Tropical Forest SoilLALDLANQLGVALPATAAAREVYNYVKGETKEDLDYSAVMRFWEK*
JGI12635J15846_1017582213300001593Forest SoilQIGVALPATAAAREIYSYVKGNAKEDLDYSAVMKFWQR*
JGI12053J15887_1057494313300001661Forest SoilVALPATAAAREIYSYVKGNAKEDLDFSAVMKFWRR*
JGI25383J37093_1010439623300002560Grasslands SoilNQLGVALPATAAARETYNFVKGAAKEDLDYSAVMKFWKR*
Ga0066395_1000681063300004633Tropical Forest SoilANQLGVSLPATAAAREVYNYVKGEAKEDLDYSAVMRFWKK*
Ga0070694_10123414413300005444Corn, Switchgrass And Miscanthus RhizosphereLDLGNQIGVPLPAAAAAREVYNSVKGSCKEDLDYAAVMKFWKR*
Ga0070707_10046537723300005468Corn, Switchgrass And Miscanthus RhizosphereLSLALDLGNQIGVPLPATAAAREIYSSVEGSSKEDLDYAAVFKFWKK*
Ga0070733_1088571123300005541Surface SoilLSLALDLGNQLGVPLPAAAAAREIYNSVKGSSKDDLDYAAVYKFWNR*
Ga0066700_1019266113300005559SoilALPATAAARETYNYVKGAAKEDLDYSAVMRFWKS*
Ga0066705_1075810523300005569SoilALPATAAAREAYNYVKGAAKEDLDYSAVMKFWKR*
Ga0070740_1002799913300005607Surface SoilGVPLPAVAAARETYNAVKGAAKEDLDYSAVMKFWTK*
Ga0066790_1008323613300005995SoilLGVTLPAAKAARETYGSVKAAAKEDLDYSAVMKFWRP*
Ga0066696_1068641413300006032SoilLDLANQLGVALPATAAARETYNYDKGAAKEDLDYSAVMRFWKS*
Ga0079222_1155695413300006755Agricultural SoilQLGVALPATAAAREIYNAVKGAAKEDLDYSAVMKFWKR*
Ga0079220_1068717213300006806Agricultural SoilNQLGVALPATAAAREIYNAVKGAAKEDLDYSAVMRFWKH*
Ga0099794_1064996823300007265Vadose Zone SoilQLGVALPATAAAREVYNYVKGEAKEDLDYSAVMRFWKK*
Ga0099829_1167902413300009038Vadose Zone SoilALPATAAARENYNYVKGAAKEDLDYSAVMKFWKK*
Ga0099830_1027269233300009088Vadose Zone SoilLDLANQLGVALPATAAAREIYNAVKGAAREDLDYSAVMKFWNS*
Ga0099830_1040993413300009088Vadose Zone SoilLGLALDVGNQLGVALPATAAARENYNYVKGAAKEDLDYSAVMKFWKK*
Ga0099830_1143893723300009088Vadose Zone SoilALPATAAAREIYNAVKGAATEDVDYAAVGRFWGSDRR*
Ga0099828_1006036743300009089Vadose Zone SoilGVALPATAAAREVYSYVKSSAKEDLDYSAVMKFWRR*
Ga0099828_1132676413300009089Vadose Zone SoilLALDLANQLGVALPATAAAREIYNAVKGAAKNEDPDYAVVARFWQNR*
Ga0099827_1069271633300009090Vadose Zone SoilALPATAAAREIYNAVKGDAKEDIDYSAVMKFWKP*
Ga0066709_10155059923300009137Grasslands SoilALPATAAAREIYNAVKGAAKEDLDYSAVMKFWKR*
Ga0099792_1047357613300009143Vadose Zone SoilLGNQIGVALPATAAAREIYSYVKGGAKEDLDYSAVMKFWRR*
Ga0105243_1087003413300009148Miscanthus RhizosphereGVPLPAAAAAREVYNSVKGSCKEDLDYAAVMKFWKR*
Ga0105242_1092098813300009176Miscanthus RhizosphereMTSAPAAAAARETYSYVKGASKEDLDYSAVMKFWQR*
Ga0126374_1011326843300009792Tropical Forest SoilLANQLGVPLPTTAAARETYSAVKGTNPEDLDYSAVMKFWKR*
Ga0126384_1104526423300010046Tropical Forest SoilVPLPAAAAAREVYNAVRGSAREDLDYAAVFKFWKG*
Ga0134082_1042120323300010303Grasslands SoilALPATAAARETYNYVKGAAKEDLDYSAVMRFWKN*
Ga0134084_1039582013300010322Grasslands SoilNQLGVALPATAAARETYNYVKGASKEDLDYSAVMKFWKR*
Ga0126370_1005967333300010358Tropical Forest SoilLGVALPATAAAREIYSSVKGAAKEDLDYSAVMRFWKH*
Ga0126376_1091263623300010359Tropical Forest SoilANQLGVPLPATAAAREIYNGVRGAAKEDLDYAAVARFWQKS*
Ga0126372_1034734013300010360Tropical Forest SoilVALPATAAAREIYSAVKGAAKEDLDYSAVMKFWQR*
Ga0126372_1151633513300010360Tropical Forest SoilANQIGVALPATAAARETYSYVKGSTSEDLDYAGVMRFWKK*
Ga0126372_1292766213300010360Tropical Forest SoilSLALELGNQIGVPLPAAAAAREVYNSVKGSWREDLDYAAVMKYWRR*
Ga0126379_1200314113300010366Tropical Forest SoilQIGVALPATAAARETYNYVKGSTSEDLDYAGVMRFWKK*
Ga0137392_1081658833300011269Vadose Zone SoilVALPATAAARETYSYVKGAAREDLDYSAVMKFWKR*
Ga0137392_1130615923300011269Vadose Zone SoilLGNQLGVALPATAAARENYNYVKGAAKEDLDYSAVMKFWKK*
Ga0137392_1144767913300011269Vadose Zone SoilVALPATAAARETYSYVKGAAREDLDYSAVMKFWKH*
Ga0137391_1069773523300011270Vadose Zone SoilQLGVALPATAAARETYNFVKGAAKEDLDYSAVMKFWKR*
Ga0137393_1097130413300011271Vadose Zone SoilLANQIGVALPATAAAREIYSYVKGEAKEDLDYSAVMKFWRR*
Ga0137389_1098568623300012096Vadose Zone SoilGLALDLANQLGVALPATAAAREIYNAVKGAAKNEDPDYAAVARFWQNR*
Ga0137389_1125230213300012096Vadose Zone SoilLANQLGVALPATAAAREIYNAVKGAAKNEDPDYAVVARFWQNR*
Ga0137363_1053606913300012202Vadose Zone SoilPLPAAAASREIYNSVKGASKEDLDYAAVYKYWEK*
Ga0137363_1169858723300012202Vadose Zone SoilGVALPATAAARETYNYVKGSTSEDLDYAGIMRFWKK*
Ga0137362_1144293023300012205Vadose Zone SoilGVALPATAAARENYNYVKGAAKEDLDYSAVMKFWKK*
Ga0137377_1061037823300012211Vadose Zone SoilIPLPAAAAAREIYNSVKGSSKDDLDYAAVYKFWNR*
Ga0150985_12129050313300012212Avena Fatua RhizosphereIGVALPATAAARETYNFVKGASKEDLDYSAVMKFWQR*
Ga0137370_1009217333300012285Vadose Zone SoilVALPATAAARETYNYVKGASKEDLDYSAVMKFWKR*
Ga0137387_1015114313300012349Vadose Zone SoilQLGVALPATAAAREVYNAVKGAAKEDLDYSAVMKFWKR*
Ga0137387_1070700223300012349Vadose Zone SoilNQLGVALPATAAARENYNYVKGAAKEDLDYSAVMKFWKK*
Ga0137372_1054004423300012350Vadose Zone SoilGNQLGVALPATAAARENYNYVKGAAKEDLDYSAVMKFWKK*
Ga0137371_1034237713300012356Vadose Zone SoilLDLGNQLGVALPATAAVRENYNYVKGAAKEDLDYSAVMKFWKK*
Ga0137371_1046334023300012356Vadose Zone SoilSLALDLGNQIGVPLPATAAAREIYSSVEGSSKEDLDYAAVFKFWKK*
Ga0137360_1189563523300012361Vadose Zone SoilPLPAAAAAREIYNSVKGSSKDDLDYAAVYKFWDR*
Ga0137390_1037027313300012363Vadose Zone SoilLANQLGVALPATAAARETYNYVKGTAKEDLDYSAVMKFWKQ*
Ga0137390_1059583923300012363Vadose Zone SoilQIGVALPATAAAREIYSYVKGEAKEDLDYSAVMKFWRR*
Ga0137390_1060167813300012363Vadose Zone SoilLGVALPATAAARETYNYVKGAAREDLDYSAVMKFWNR*
Ga0137359_1026199413300012923Vadose Zone SoilQIGVALPATAAAREIYSYVKGNAKEDLDFSAVMKFWRR*
Ga0137419_1131497913300012925Vadose Zone SoilVALPATAAARETYNYVKGAAKEDLDYSAVMKFWTR*
Ga0137416_1047282113300012927Vadose Zone SoilLDLGNQIGVALPATAAAREIYSYVKGNAKEDLDFSAVMKFWRR*
Ga0126375_1020295113300012948Tropical Forest SoilANQLGVALPATAAARETYNYVKGAAKEDLDYSAVMKFWKL*
Ga0126369_1135230413300012971Tropical Forest SoilALDLGNQIGVPLPAAAAAREVYNSVKGSSKDDLDYAAVYKFWTR*
Ga0137405_102898313300015053Vadose Zone SoilPFPPLPPPAETYNYVKGAAKEDLDYSAVMKFWKP*
Ga0137412_1083689513300015242Vadose Zone SoilLDLASQLGVTLPAASAARETYGTVKAAAKQDLDYSAVMKFWRP*
Ga0137403_1024923513300015264Vadose Zone SoilDLGNQLGVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK*
Ga0182036_1130420913300016270SoilRLALDLANQLGVALPTTAAVREVYNHVKGEATQDVDYSAVIRFYRN
Ga0182033_1196608713300016319SoilLANQLGVALPATAAAREVYNYVKGEAKEDLDYSAVMRFWEK
Ga0182038_1130419513300016445SoilVSLPATAAAREVYNYVKGEAKEDLDYSAVMRFWKK
Ga0187807_111855713300017926Freshwater SedimentGLALELGNQLGVALPTTAAAREVYNYVKGESKEDLDYSAVMKFWKK
Ga0187849_120967413300017929PeatlandNQLGVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK
Ga0187849_121365223300017929PeatlandGVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK
Ga0187877_121355013300017931PeatlandQLGVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK
Ga0187803_1048543223300017934Freshwater SedimentGVPLPATAAAREVYNAVKGEAKEDLDYSAVMRFWKK
Ga0187853_1045585233300017940PeatlandDLANQLGVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK
Ga0187819_1045176223300017943Freshwater SedimentNQLGVALPATAAARETYNYVKGAAKEDLDYSAVMKFWNK
Ga0187817_1039991623300017955Freshwater SedimentGVPLPAAAAAREVYNKVLGAAKEDLDFAAIARFWEK
Ga0187784_1151908023300018062Tropical PeatlandALDLANQLGVALPTTAAAREVYNHVKGETKEDVDYSAVMRFYKK
Ga0187769_1111713313300018086Tropical PeatlandQLGVALPATAAARETYNYVKGAAKEDLDYSAVMKFWKQ
Ga0187770_1030664823300018090Tropical PeatlandGNQTGVPLPAAAAAREVYNYVLGAAKEDLDYAAIARFWEK
Ga0187796_141251623300019264PeatlandLDLANQLGVPLPATAAAREVYNYVRGEAKEDLDYSAVMRFWKK
Ga0179594_1010745523300020170Vadose Zone SoilGVALPATAAAREIYSYVKGNAKEDLDFSAVMKFWRR
Ga0210407_1122252813300020579SoilGNQLGVALPATAAAREVYSYVKGEAKEDLDYSGVMRFWKK
Ga0210399_1152555213300020581SoilGNQIGVALPATAAAREIYSYVKGNAKEDLDYSAVMKFWRRQP
Ga0210395_1028155013300020582SoilGVPLPACAAAREVYSAVKGAAKEDLDYAAVAKFWGKDRK
Ga0215015_1003531613300021046SoilMCIRDSPATAAARERYNYVKCAAKEDLDYSAVMKFWKS
Ga0215015_1011385713300021046SoilLGNQLRVALPATAAARETYNYVKGAAKEDLDYSAVMKFWKK
Ga0210406_1006093643300021168SoilLGNQLGIPLPAAAAAREIYNYVKGSSQDDLDYAAVFKFWDK
Ga0210406_1013411933300021168SoilLYLPVPSGRGLALDLGNQLGIPLPAAAAAREIYNYVKGSSQDDLDYAAVFKFWDK
Ga0210405_1000722613300021171SoilASKLGVTLPAATAARETYGKVKAAAKEDLDYSAVMKFWRP
Ga0210408_1083964723300021178SoilANQLGVALPATAAARETYSYVKGAAKEDLDYSAVMKFWKK
Ga0210408_1114840413300021178SoilGLALDLANQLGVALPATAAAREIYSAVKGAAKQDLDYSAVMQFWKS
Ga0210396_1176591713300021180SoilQLGVALPATAAAREVYNYVKGEAKEDLDYSAVMKFWKK
Ga0210387_1028837733300021405SoilDLGNQLGVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK
Ga0210386_1031783123300021406SoilANQLGVALPTTAAVREVYNFVKGEAKEDVDYSAVMRFYKK
Ga0210394_1150119723300021420SoilLSLALDLGNQIGVALPATAAAREIYNYVKGNAKEDLDYSAVMKFWRR
Ga0210394_1159636123300021420SoilLDLGNQLGVALPTTAAAREVYNQVKGDAKEDLDYSAVMKFWER
Ga0210409_1032129923300021559SoilGVALPATAAAREVYNYVKGASPDDLDYSGIMRFWQKQ
Ga0242662_1028754123300022533SoilGVALPATAAAREVYSYVKGDAKEDLDYSGVMRFWKK
Ga0207711_1036351833300025941Switchgrass RhizosphereLGNQIGVPLPAAAAAREIYNSVKGASKEDLDYAAVYKFWPR
Ga0209761_130759523300026313Grasslands SoilNQLGVPLPATAAAREIYNAVKGSAKEDLDYAAVARFWQRA
Ga0209131_125286323300026320Grasslands SoilDLANQIGVALPATAATRETYNYVKGSTTEDLDYAGVMRFWKK
Ga0209690_120471823300026524SoilNQLGVALPATAAAREVYNAVKGAAKEDLDYSAVMKFWKR
Ga0209059_128727313300026527SoilGVALPATAAAREIYNAVKGAAKEDLDYSAVMQFWKR
Ga0209807_124369513300026530SoilDLSLVLELANQIGVALPAAAAARETYNYVKGASKQDLDYSAVMKFWQP
Ga0209648_1015075023300026551Grasslands SoilGVALPATAAVRETYNYVKGAAKEDLDYSAVMKFWQR
Ga0179587_1100072613300026557Vadose Zone SoilALDLGNQIGVALPATAAAREVYSYVKGNAEEDLDYSAVMKFWQRQP
Ga0207760_11119813300026845Tropical Forest SoilGVALPATAAAREVYNYVKGEAKEDLDYSAVMRFWKK
Ga0207815_104084623300027014Tropical Forest SoilDLANQLGVALPATAAAREVYNYVKGEAKEDLDYSAVMRFWKK
Ga0209219_110882913300027565Forest SoilNQIGVALPATAAARETYNYVKGATKEDLDYSAVMKFWKS
Ga0209003_103709613300027576Forest SoilLGVALPATAAAREIYSAVKGAAKEDLDYSAVMRFWKR
Ga0209799_115051823300027654Tropical Forest SoilGGPLPAAAAAREVYNSVKGSSQEDLDYAAVMKYWKR
Ga0209178_104357533300027725Agricultural SoilANQVGVPLPATASSRETYSYVKGSTKEDLDYAAVMKFWNR
Ga0209580_1010408723300027842Surface SoilVALPATAAARETYNYVKGAAKEDLDYSAVMKFWKS
Ga0209580_1020679823300027842Surface SoilLELGNQLGVALPATAAAREVYNYVKGEAKEDLDYSAVMRFWKK
Ga0209167_1058809423300027867Surface SoilLSLALDLGNQLGVPLPAAAAAREIYNSVKGSSKDDLDYAAVYKFWNR
Ga0137415_1102546923300028536Vadose Zone SoilNQLGVALPATAAARETYNYVKGSTAEDLDYAGVMRFWKK
Ga0302311_1019080613300030739PalsaGVTLPATAAARATYAHVKEAAKEDLDYSGVLKFWSKT
Ga0075404_1159986813300030842SoilLDLANQLGVALPATAAAREVYNYVKGTSPDDLDYSGVMRFWQK
Ga0310915_1003930433300031573SoilLGNQIGVPLPAAAAAREVYNSVKGSSKDDLDYAAVYKFWPR
Ga0318542_1011354113300031668SoilDLGNQLGVPLPAAAAARETYNSVKGSSKDDLDYAAVYKFWPR
Ga0318560_1022063933300031682SoilIGVPLPAAAAAREVYNSVKGSSKDDLDYAAVYKFWPR
Ga0307476_1097322523300031715Hardwood Forest SoilNQLGVALPTTAAAREVYNYVKGEAKEDLDYSGVMRFWKK
Ga0307474_1150074413300031718Hardwood Forest SoilNQLGVALPATAAARETYNYVKGSAKEDLDYSAVMKFWKK
Ga0306917_1051924823300031719SoilLGNQLGVPLPAAAAARETYNSVKGSSRDDLDYAAVYKFWPR
Ga0307469_1194622023300031720Hardwood Forest SoilLLDLANQLGVALPATAAAREVYSYVKGEAKEDLDYSGVMRYWKK
Ga0306918_1029232123300031744SoilLALDLGNQLGVPLPAAAAARETYNSVKGSSRDDLDYAAVYKFWPR
Ga0307477_1001945113300031753Hardwood Forest SoilVALPATAAAREVYNAVKGAAKEDLDYSAVMKFWKR
Ga0307477_1033765923300031753Hardwood Forest SoilVVLPATAAAREVYSYVKGSAKEDLDYSAVMKFWRR
Ga0318554_1063850023300031765SoilDLANQLGVALPATAAAREVYNFVKGEAKEDLDYSAVMRFWKK
Ga0318521_1032198713300031770SoilLDLGNQLGVALPATAAAREVYNAVKGEAKEDLDYSAVMRFWKK
Ga0310917_1009496513300031833SoilGNQIGVPLPAAAAAREVYNSVKGSSKDDLDYAAVYKFWPR
Ga0310910_1016446413300031946SoilNQLGVALPATAAAREVYNFVKGEAKEDLDYSAVMRFWKK
Ga0310909_1012236033300031947SoilVPLPAAAAAREVYNSVKGSSKDDLDYAAVYKFWPR
Ga0306926_1004737573300031954SoilQLGVPLPAAAAARETYNSVKGSSRDDLDYAAVYKFWPR
Ga0307479_1005718513300031962Hardwood Forest SoilGVTLPASSAARETYGKVKAAAKEDLDYSAVMKFWRH
Ga0307479_1019313733300031962Hardwood Forest SoilVALPATAAARETYNYVKGAAKEDLDYSAVMKFWTR
Ga0307479_1036955113300031962Hardwood Forest SoilGNQLGVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK
Ga0318533_1103771123300032059SoilLGVPLPSTAAARETYSAVRGRSQEDLDYSAVMKFWKR
Ga0318514_1080561013300032066SoilVALPATAAARETYNFVKGSTSEDLDYAGVMRFWKR
Ga0318524_1011923313300032067SoilNQIGVPLPAAAAAREVYNSVKGSSKDDLDYAAVYKFWPR
Ga0318525_1047301923300032089SoilNQLGVSLPATAAAREVYNYVKGEAKEDLDYSAVMRFWKE
Ga0307471_10057933513300032180Hardwood Forest SoilLGIPLPATAASREIYNFVKGASKDDLDYAAVFKYWEK
Ga0307471_10310706923300032180Hardwood Forest SoilALDLGNQIGVPLPAAAAAREVYNSVKGSCQEDLDYAAVMKFWKR
Ga0307471_10371648313300032180Hardwood Forest SoilNQLGVALPATAAARETYNYVKGAAKEDLDYSAVMKFWTR
Ga0335082_1102878923300032782SoilQLGVALPATAAAREVYNYVKGESKEDVDYSAVRKFWKK
Ga0335074_1026682643300032895SoilDLANQLGVALPTTAAVREVYSHVKGEATEDVDYSAVMRFYKK
Ga0335076_1072139713300032955SoilLELGNQTGVPLPAAAAAREVYNSVLGAAKEDLDFASIAKFWK
Ga0335077_1112255123300033158SoilMGLLLDLGNQLGVALPTTAAAREVYSYVKGEAKEDLDYSGVMKFWKK
Ga0310914_1088272013300033289SoilLGLALDLANQLGVALPATAAAREVYNYVKGETKEDLDYSAVMRFWEK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.