| Basic Information | |
|---|---|
| Family ID | F046299 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 151 |
| Average Sequence Length | 40 residues |
| Representative Sequence | NQLGVALPATAAARETYNYVKGSAKEDLDYSAVMKFWKK |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.66 % |
| % of genes near scaffold ends (potentially truncated) | 99.34 % |
| % of genes from short scaffolds (< 2000 bps) | 90.73 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.689 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.828 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.126 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.033 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF01209 | Ubie_methyltran | 8.61 |
| PF00924 | MS_channel | 6.62 |
| PF03544 | TonB_C | 5.96 |
| PF05592 | Bac_rhamnosid | 5.96 |
| PF01113 | DapB_N | 4.64 |
| PF01329 | Pterin_4a | 3.31 |
| PF00561 | Abhydrolase_1 | 3.31 |
| PF05899 | Cupin_3 | 2.65 |
| PF04389 | Peptidase_M28 | 1.99 |
| PF03446 | NAD_binding_2 | 1.99 |
| PF01135 | PCMT | 1.32 |
| PF07883 | Cupin_2 | 1.32 |
| PF14833 | NAD_binding_11 | 1.32 |
| PF06182 | ABC2_membrane_6 | 0.66 |
| PF04014 | MazE_antitoxin | 0.66 |
| PF12697 | Abhydrolase_6 | 0.66 |
| PF05231 | MASE1 | 0.66 |
| PF02687 | FtsX | 0.66 |
| PF13520 | AA_permease_2 | 0.66 |
| PF00158 | Sigma54_activat | 0.66 |
| PF00672 | HAMP | 0.66 |
| PF07505 | DUF5131 | 0.66 |
| PF01850 | PIN | 0.66 |
| PF01084 | Ribosomal_S18 | 0.66 |
| PF08308 | PEGA | 0.66 |
| PF08388 | GIIM | 0.66 |
| PF04191 | PEMT | 0.66 |
| PF07238 | PilZ | 0.66 |
| PF08818 | DUF1801 | 0.66 |
| PF13701 | DDE_Tnp_1_4 | 0.66 |
| PF02077 | SURF4 | 0.66 |
| PF00072 | Response_reg | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 9.93 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 8.61 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 6.62 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 6.62 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 5.96 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 5.96 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 3.31 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.32 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 1.32 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 1.32 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.66 |
| COG0238 | Ribosomal protein S18 | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.66 |
| COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.66 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.66 |
| COG3694 | ABC-type uncharacterized transport system, permease component | General function prediction only [R] | 0.66 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.66 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.66 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.69 % |
| Unclassified | root | N/A | 3.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000731|JGI12381J11899_1010431 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300001593|JGI12635J15846_10175822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1441 | Open in IMG/M |
| 3300001661|JGI12053J15887_10574943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300002560|JGI25383J37093_10104396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300004633|Ga0066395_10006810 | All Organisms → cellular organisms → Bacteria | 4060 | Open in IMG/M |
| 3300005444|Ga0070694_101234144 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005468|Ga0070707_100465377 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300005541|Ga0070733_10885711 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005559|Ga0066700_10192661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
| 3300005569|Ga0066705_10758105 | Not Available | 581 | Open in IMG/M |
| 3300005607|Ga0070740_10027999 | All Organisms → cellular organisms → Bacteria | 3230 | Open in IMG/M |
| 3300005995|Ga0066790_10083236 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300006032|Ga0066696_10686414 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300006755|Ga0079222_11556954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300006806|Ga0079220_10687172 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300007265|Ga0099794_10649968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300009038|Ga0099829_11679024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300009088|Ga0099830_10272692 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300009088|Ga0099830_10409934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300009088|Ga0099830_11438937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300009089|Ga0099828_10060367 | All Organisms → cellular organisms → Bacteria | 3179 | Open in IMG/M |
| 3300009089|Ga0099828_11326764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300009090|Ga0099827_10692716 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 880 | Open in IMG/M |
| 3300009137|Ga0066709_101550599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 952 | Open in IMG/M |
| 3300009143|Ga0099792_10473576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300009148|Ga0105243_10870034 | Not Available | 894 | Open in IMG/M |
| 3300009176|Ga0105242_10920988 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300009792|Ga0126374_10113268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1568 | Open in IMG/M |
| 3300010046|Ga0126384_11045264 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300010303|Ga0134082_10421203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300010322|Ga0134084_10395820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300010358|Ga0126370_10059673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2470 | Open in IMG/M |
| 3300010359|Ga0126376_10912636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 870 | Open in IMG/M |
| 3300010360|Ga0126372_10347340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1329 | Open in IMG/M |
| 3300010360|Ga0126372_11516335 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 707 | Open in IMG/M |
| 3300010360|Ga0126372_12927662 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300010366|Ga0126379_12003141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300011269|Ga0137392_10816588 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300011269|Ga0137392_11306159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300011269|Ga0137392_11447679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300011270|Ga0137391_10697735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300011271|Ga0137393_10971304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300012096|Ga0137389_10985686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300012096|Ga0137389_11252302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300012202|Ga0137363_10536069 | Not Available | 985 | Open in IMG/M |
| 3300012202|Ga0137363_11698587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300012205|Ga0137362_11442930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300012211|Ga0137377_10610378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
| 3300012212|Ga0150985_121290503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300012285|Ga0137370_10092173 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
| 3300012349|Ga0137387_10151143 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300012349|Ga0137387_10707002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300012350|Ga0137372_10540044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300012356|Ga0137371_10342377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300012356|Ga0137371_10463340 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300012361|Ga0137360_11895635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300012363|Ga0137390_10370273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 1413 | Open in IMG/M |
| 3300012363|Ga0137390_10595839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300012363|Ga0137390_10601678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300012923|Ga0137359_10261994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1541 | Open in IMG/M |
| 3300012925|Ga0137419_11314979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300012927|Ga0137416_10472821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1075 | Open in IMG/M |
| 3300012948|Ga0126375_10202951 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300012971|Ga0126369_11352304 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 802 | Open in IMG/M |
| 3300015053|Ga0137405_1028983 | All Organisms → cellular organisms → Bacteria | 3331 | Open in IMG/M |
| 3300015242|Ga0137412_10836895 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300015264|Ga0137403_10249235 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300016270|Ga0182036_11304209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300016319|Ga0182033_11966087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300016445|Ga0182038_11304195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300017926|Ga0187807_1118557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 838 | Open in IMG/M |
| 3300017929|Ga0187849_1209674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300017929|Ga0187849_1213652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300017931|Ga0187877_1213550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300017934|Ga0187803_10485432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300017940|Ga0187853_10455852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300017943|Ga0187819_10451762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300017955|Ga0187817_10399916 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300018062|Ga0187784_11519080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300018086|Ga0187769_11117133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300018090|Ga0187770_10306648 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300019264|Ga0187796_1412516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300020170|Ga0179594_10107455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300020579|Ga0210407_11222528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300020581|Ga0210399_11525552 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300020582|Ga0210395_10281550 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300021046|Ga0215015_10035316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300021046|Ga0215015_10113857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300021168|Ga0210406_10060936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3273 | Open in IMG/M |
| 3300021168|Ga0210406_10134119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2085 | Open in IMG/M |
| 3300021171|Ga0210405_10007226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9784 | Open in IMG/M |
| 3300021178|Ga0210408_10839647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300021178|Ga0210408_11148404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300021180|Ga0210396_11765917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300021405|Ga0210387_10288377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1442 | Open in IMG/M |
| 3300021406|Ga0210386_10317831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1336 | Open in IMG/M |
| 3300021420|Ga0210394_11501197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300021420|Ga0210394_11596361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300021559|Ga0210409_10321299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1393 | Open in IMG/M |
| 3300022533|Ga0242662_10287541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300025941|Ga0207711_10363518 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300026313|Ga0209761_1307595 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300026320|Ga0209131_1252863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300026524|Ga0209690_1204718 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300026527|Ga0209059_1287273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300026530|Ga0209807_1243695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300026551|Ga0209648_10150750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1836 | Open in IMG/M |
| 3300026557|Ga0179587_11000726 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300026845|Ga0207760_111198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300027014|Ga0207815_1040846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300027565|Ga0209219_1108829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300027576|Ga0209003_1037096 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300027654|Ga0209799_1150518 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027725|Ga0209178_1043575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1430 | Open in IMG/M |
| 3300027842|Ga0209580_10104087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1375 | Open in IMG/M |
| 3300027842|Ga0209580_10206798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 974 | Open in IMG/M |
| 3300027867|Ga0209167_10588094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300028536|Ga0137415_11025469 | Not Available | 637 | Open in IMG/M |
| 3300030739|Ga0302311_10190806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1561 | Open in IMG/M |
| 3300030842|Ga0075404_11599868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1421 | Open in IMG/M |
| 3300031573|Ga0310915_10039304 | All Organisms → cellular organisms → Bacteria | 3005 | Open in IMG/M |
| 3300031668|Ga0318542_10113541 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300031682|Ga0318560_10220639 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300031715|Ga0307476_10973225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300031718|Ga0307474_11500744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300031719|Ga0306917_10519248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 936 | Open in IMG/M |
| 3300031720|Ga0307469_11946220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300031744|Ga0306918_10292321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1253 | Open in IMG/M |
| 3300031753|Ga0307477_10019451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4643 | Open in IMG/M |
| 3300031753|Ga0307477_10337659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1037 | Open in IMG/M |
| 3300031765|Ga0318554_10638500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300031770|Ga0318521_10321987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 913 | Open in IMG/M |
| 3300031833|Ga0310917_10094965 | All Organisms → cellular organisms → Bacteria | 1911 | Open in IMG/M |
| 3300031946|Ga0310910_10164464 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300031947|Ga0310909_10122360 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
| 3300031954|Ga0306926_10047375 | All Organisms → cellular organisms → Bacteria | 5129 | Open in IMG/M |
| 3300031962|Ga0307479_10057185 | All Organisms → cellular organisms → Bacteria | 3756 | Open in IMG/M |
| 3300031962|Ga0307479_10193137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2004 | Open in IMG/M |
| 3300031962|Ga0307479_10369551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1418 | Open in IMG/M |
| 3300032059|Ga0318533_11037711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300032066|Ga0318514_10805610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300032067|Ga0318524_10119233 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300032089|Ga0318525_10473019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300032180|Ga0307471_100579335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1279 | Open in IMG/M |
| 3300032180|Ga0307471_103107069 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300032180|Ga0307471_103716483 | Not Available | 540 | Open in IMG/M |
| 3300032782|Ga0335082_11028789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300032895|Ga0335074_10266826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1995 | Open in IMG/M |
| 3300032955|Ga0335076_10721397 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300033158|Ga0335077_11122551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300033289|Ga0310914_10882720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.28% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.66% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.66% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000731 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026845 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24 (SPAdes) | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030842 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12381J11899_10104312 | 3300000731 | Tropical Forest Soil | LALDLANQLGVALPATAAAREVYNYVKGETKEDLDYSAVMRFWEK* |
| JGI12635J15846_101758221 | 3300001593 | Forest Soil | QIGVALPATAAAREIYSYVKGNAKEDLDYSAVMKFWQR* |
| JGI12053J15887_105749431 | 3300001661 | Forest Soil | VALPATAAAREIYSYVKGNAKEDLDFSAVMKFWRR* |
| JGI25383J37093_101043962 | 3300002560 | Grasslands Soil | NQLGVALPATAAARETYNFVKGAAKEDLDYSAVMKFWKR* |
| Ga0066395_100068106 | 3300004633 | Tropical Forest Soil | ANQLGVSLPATAAAREVYNYVKGEAKEDLDYSAVMRFWKK* |
| Ga0070694_1012341441 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LDLGNQIGVPLPAAAAAREVYNSVKGSCKEDLDYAAVMKFWKR* |
| Ga0070707_1004653772 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LSLALDLGNQIGVPLPATAAAREIYSSVEGSSKEDLDYAAVFKFWKK* |
| Ga0070733_108857112 | 3300005541 | Surface Soil | LSLALDLGNQLGVPLPAAAAAREIYNSVKGSSKDDLDYAAVYKFWNR* |
| Ga0066700_101926611 | 3300005559 | Soil | ALPATAAARETYNYVKGAAKEDLDYSAVMRFWKS* |
| Ga0066705_107581052 | 3300005569 | Soil | ALPATAAAREAYNYVKGAAKEDLDYSAVMKFWKR* |
| Ga0070740_100279991 | 3300005607 | Surface Soil | GVPLPAVAAARETYNAVKGAAKEDLDYSAVMKFWTK* |
| Ga0066790_100832361 | 3300005995 | Soil | LGVTLPAAKAARETYGSVKAAAKEDLDYSAVMKFWRP* |
| Ga0066696_106864141 | 3300006032 | Soil | LDLANQLGVALPATAAARETYNYDKGAAKEDLDYSAVMRFWKS* |
| Ga0079222_115569541 | 3300006755 | Agricultural Soil | QLGVALPATAAAREIYNAVKGAAKEDLDYSAVMKFWKR* |
| Ga0079220_106871721 | 3300006806 | Agricultural Soil | NQLGVALPATAAAREIYNAVKGAAKEDLDYSAVMRFWKH* |
| Ga0099794_106499682 | 3300007265 | Vadose Zone Soil | QLGVALPATAAAREVYNYVKGEAKEDLDYSAVMRFWKK* |
| Ga0099829_116790241 | 3300009038 | Vadose Zone Soil | ALPATAAARENYNYVKGAAKEDLDYSAVMKFWKK* |
| Ga0099830_102726923 | 3300009088 | Vadose Zone Soil | LDLANQLGVALPATAAAREIYNAVKGAAREDLDYSAVMKFWNS* |
| Ga0099830_104099341 | 3300009088 | Vadose Zone Soil | LGLALDVGNQLGVALPATAAARENYNYVKGAAKEDLDYSAVMKFWKK* |
| Ga0099830_114389372 | 3300009088 | Vadose Zone Soil | ALPATAAAREIYNAVKGAATEDVDYAAVGRFWGSDRR* |
| Ga0099828_100603674 | 3300009089 | Vadose Zone Soil | GVALPATAAAREVYSYVKSSAKEDLDYSAVMKFWRR* |
| Ga0099828_113267641 | 3300009089 | Vadose Zone Soil | LALDLANQLGVALPATAAAREIYNAVKGAAKNEDPDYAVVARFWQNR* |
| Ga0099827_106927163 | 3300009090 | Vadose Zone Soil | ALPATAAAREIYNAVKGDAKEDIDYSAVMKFWKP* |
| Ga0066709_1015505992 | 3300009137 | Grasslands Soil | ALPATAAAREIYNAVKGAAKEDLDYSAVMKFWKR* |
| Ga0099792_104735761 | 3300009143 | Vadose Zone Soil | LGNQIGVALPATAAAREIYSYVKGGAKEDLDYSAVMKFWRR* |
| Ga0105243_108700341 | 3300009148 | Miscanthus Rhizosphere | GVPLPAAAAAREVYNSVKGSCKEDLDYAAVMKFWKR* |
| Ga0105242_109209881 | 3300009176 | Miscanthus Rhizosphere | MTSAPAAAAARETYSYVKGASKEDLDYSAVMKFWQR* |
| Ga0126374_101132684 | 3300009792 | Tropical Forest Soil | LANQLGVPLPTTAAARETYSAVKGTNPEDLDYSAVMKFWKR* |
| Ga0126384_110452642 | 3300010046 | Tropical Forest Soil | VPLPAAAAAREVYNAVRGSAREDLDYAAVFKFWKG* |
| Ga0134082_104212032 | 3300010303 | Grasslands Soil | ALPATAAARETYNYVKGAAKEDLDYSAVMRFWKN* |
| Ga0134084_103958201 | 3300010322 | Grasslands Soil | NQLGVALPATAAARETYNYVKGASKEDLDYSAVMKFWKR* |
| Ga0126370_100596733 | 3300010358 | Tropical Forest Soil | LGVALPATAAAREIYSSVKGAAKEDLDYSAVMRFWKH* |
| Ga0126376_109126362 | 3300010359 | Tropical Forest Soil | ANQLGVPLPATAAAREIYNGVRGAAKEDLDYAAVARFWQKS* |
| Ga0126372_103473401 | 3300010360 | Tropical Forest Soil | VALPATAAAREIYSAVKGAAKEDLDYSAVMKFWQR* |
| Ga0126372_115163351 | 3300010360 | Tropical Forest Soil | ANQIGVALPATAAARETYSYVKGSTSEDLDYAGVMRFWKK* |
| Ga0126372_129276621 | 3300010360 | Tropical Forest Soil | SLALELGNQIGVPLPAAAAAREVYNSVKGSWREDLDYAAVMKYWRR* |
| Ga0126379_120031411 | 3300010366 | Tropical Forest Soil | QIGVALPATAAARETYNYVKGSTSEDLDYAGVMRFWKK* |
| Ga0137392_108165883 | 3300011269 | Vadose Zone Soil | VALPATAAARETYSYVKGAAREDLDYSAVMKFWKR* |
| Ga0137392_113061592 | 3300011269 | Vadose Zone Soil | LGNQLGVALPATAAARENYNYVKGAAKEDLDYSAVMKFWKK* |
| Ga0137392_114476791 | 3300011269 | Vadose Zone Soil | VALPATAAARETYSYVKGAAREDLDYSAVMKFWKH* |
| Ga0137391_106977352 | 3300011270 | Vadose Zone Soil | QLGVALPATAAARETYNFVKGAAKEDLDYSAVMKFWKR* |
| Ga0137393_109713041 | 3300011271 | Vadose Zone Soil | LANQIGVALPATAAAREIYSYVKGEAKEDLDYSAVMKFWRR* |
| Ga0137389_109856862 | 3300012096 | Vadose Zone Soil | GLALDLANQLGVALPATAAAREIYNAVKGAAKNEDPDYAAVARFWQNR* |
| Ga0137389_112523021 | 3300012096 | Vadose Zone Soil | LANQLGVALPATAAAREIYNAVKGAAKNEDPDYAVVARFWQNR* |
| Ga0137363_105360691 | 3300012202 | Vadose Zone Soil | PLPAAAASREIYNSVKGASKEDLDYAAVYKYWEK* |
| Ga0137363_116985872 | 3300012202 | Vadose Zone Soil | GVALPATAAARETYNYVKGSTSEDLDYAGIMRFWKK* |
| Ga0137362_114429302 | 3300012205 | Vadose Zone Soil | GVALPATAAARENYNYVKGAAKEDLDYSAVMKFWKK* |
| Ga0137377_106103782 | 3300012211 | Vadose Zone Soil | IPLPAAAAAREIYNSVKGSSKDDLDYAAVYKFWNR* |
| Ga0150985_1212905031 | 3300012212 | Avena Fatua Rhizosphere | IGVALPATAAARETYNFVKGASKEDLDYSAVMKFWQR* |
| Ga0137370_100921733 | 3300012285 | Vadose Zone Soil | VALPATAAARETYNYVKGASKEDLDYSAVMKFWKR* |
| Ga0137387_101511431 | 3300012349 | Vadose Zone Soil | QLGVALPATAAAREVYNAVKGAAKEDLDYSAVMKFWKR* |
| Ga0137387_107070022 | 3300012349 | Vadose Zone Soil | NQLGVALPATAAARENYNYVKGAAKEDLDYSAVMKFWKK* |
| Ga0137372_105400442 | 3300012350 | Vadose Zone Soil | GNQLGVALPATAAARENYNYVKGAAKEDLDYSAVMKFWKK* |
| Ga0137371_103423771 | 3300012356 | Vadose Zone Soil | LDLGNQLGVALPATAAVRENYNYVKGAAKEDLDYSAVMKFWKK* |
| Ga0137371_104633402 | 3300012356 | Vadose Zone Soil | SLALDLGNQIGVPLPATAAAREIYSSVEGSSKEDLDYAAVFKFWKK* |
| Ga0137360_118956352 | 3300012361 | Vadose Zone Soil | PLPAAAAAREIYNSVKGSSKDDLDYAAVYKFWDR* |
| Ga0137390_103702731 | 3300012363 | Vadose Zone Soil | LANQLGVALPATAAARETYNYVKGTAKEDLDYSAVMKFWKQ* |
| Ga0137390_105958392 | 3300012363 | Vadose Zone Soil | QIGVALPATAAAREIYSYVKGEAKEDLDYSAVMKFWRR* |
| Ga0137390_106016781 | 3300012363 | Vadose Zone Soil | LGVALPATAAARETYNYVKGAAREDLDYSAVMKFWNR* |
| Ga0137359_102619941 | 3300012923 | Vadose Zone Soil | QIGVALPATAAAREIYSYVKGNAKEDLDFSAVMKFWRR* |
| Ga0137419_113149791 | 3300012925 | Vadose Zone Soil | VALPATAAARETYNYVKGAAKEDLDYSAVMKFWTR* |
| Ga0137416_104728211 | 3300012927 | Vadose Zone Soil | LDLGNQIGVALPATAAAREIYSYVKGNAKEDLDFSAVMKFWRR* |
| Ga0126375_102029511 | 3300012948 | Tropical Forest Soil | ANQLGVALPATAAARETYNYVKGAAKEDLDYSAVMKFWKL* |
| Ga0126369_113523041 | 3300012971 | Tropical Forest Soil | ALDLGNQIGVPLPAAAAAREVYNSVKGSSKDDLDYAAVYKFWTR* |
| Ga0137405_10289831 | 3300015053 | Vadose Zone Soil | PFPPLPPPAETYNYVKGAAKEDLDYSAVMKFWKP* |
| Ga0137412_108368951 | 3300015242 | Vadose Zone Soil | LDLASQLGVTLPAASAARETYGTVKAAAKQDLDYSAVMKFWRP* |
| Ga0137403_102492351 | 3300015264 | Vadose Zone Soil | DLGNQLGVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK* |
| Ga0182036_113042091 | 3300016270 | Soil | RLALDLANQLGVALPTTAAVREVYNHVKGEATQDVDYSAVIRFYRN |
| Ga0182033_119660871 | 3300016319 | Soil | LANQLGVALPATAAAREVYNYVKGEAKEDLDYSAVMRFWEK |
| Ga0182038_113041951 | 3300016445 | Soil | VSLPATAAAREVYNYVKGEAKEDLDYSAVMRFWKK |
| Ga0187807_11185571 | 3300017926 | Freshwater Sediment | GLALELGNQLGVALPTTAAAREVYNYVKGESKEDLDYSAVMKFWKK |
| Ga0187849_12096741 | 3300017929 | Peatland | NQLGVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK |
| Ga0187849_12136522 | 3300017929 | Peatland | GVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK |
| Ga0187877_12135501 | 3300017931 | Peatland | QLGVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK |
| Ga0187803_104854322 | 3300017934 | Freshwater Sediment | GVPLPATAAAREVYNAVKGEAKEDLDYSAVMRFWKK |
| Ga0187853_104558523 | 3300017940 | Peatland | DLANQLGVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK |
| Ga0187819_104517622 | 3300017943 | Freshwater Sediment | NQLGVALPATAAARETYNYVKGAAKEDLDYSAVMKFWNK |
| Ga0187817_103999162 | 3300017955 | Freshwater Sediment | GVPLPAAAAAREVYNKVLGAAKEDLDFAAIARFWEK |
| Ga0187784_115190802 | 3300018062 | Tropical Peatland | ALDLANQLGVALPTTAAAREVYNHVKGETKEDVDYSAVMRFYKK |
| Ga0187769_111171331 | 3300018086 | Tropical Peatland | QLGVALPATAAARETYNYVKGAAKEDLDYSAVMKFWKQ |
| Ga0187770_103066482 | 3300018090 | Tropical Peatland | GNQTGVPLPAAAAAREVYNYVLGAAKEDLDYAAIARFWEK |
| Ga0187796_14125162 | 3300019264 | Peatland | LDLANQLGVPLPATAAAREVYNYVRGEAKEDLDYSAVMRFWKK |
| Ga0179594_101074552 | 3300020170 | Vadose Zone Soil | GVALPATAAAREIYSYVKGNAKEDLDFSAVMKFWRR |
| Ga0210407_112225281 | 3300020579 | Soil | GNQLGVALPATAAAREVYSYVKGEAKEDLDYSGVMRFWKK |
| Ga0210399_115255521 | 3300020581 | Soil | GNQIGVALPATAAAREIYSYVKGNAKEDLDYSAVMKFWRRQP |
| Ga0210395_102815501 | 3300020582 | Soil | GVPLPACAAAREVYSAVKGAAKEDLDYAAVAKFWGKDRK |
| Ga0215015_100353161 | 3300021046 | Soil | MCIRDSPATAAARERYNYVKCAAKEDLDYSAVMKFWKS |
| Ga0215015_101138571 | 3300021046 | Soil | LGNQLRVALPATAAARETYNYVKGAAKEDLDYSAVMKFWKK |
| Ga0210406_100609364 | 3300021168 | Soil | LGNQLGIPLPAAAAAREIYNYVKGSSQDDLDYAAVFKFWDK |
| Ga0210406_101341193 | 3300021168 | Soil | LYLPVPSGRGLALDLGNQLGIPLPAAAAAREIYNYVKGSSQDDLDYAAVFKFWDK |
| Ga0210405_100072261 | 3300021171 | Soil | ASKLGVTLPAATAARETYGKVKAAAKEDLDYSAVMKFWRP |
| Ga0210408_108396472 | 3300021178 | Soil | ANQLGVALPATAAARETYSYVKGAAKEDLDYSAVMKFWKK |
| Ga0210408_111484041 | 3300021178 | Soil | GLALDLANQLGVALPATAAAREIYSAVKGAAKQDLDYSAVMQFWKS |
| Ga0210396_117659171 | 3300021180 | Soil | QLGVALPATAAAREVYNYVKGEAKEDLDYSAVMKFWKK |
| Ga0210387_102883773 | 3300021405 | Soil | DLGNQLGVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK |
| Ga0210386_103178312 | 3300021406 | Soil | ANQLGVALPTTAAVREVYNFVKGEAKEDVDYSAVMRFYKK |
| Ga0210394_115011972 | 3300021420 | Soil | LSLALDLGNQIGVALPATAAAREIYNYVKGNAKEDLDYSAVMKFWRR |
| Ga0210394_115963612 | 3300021420 | Soil | LDLGNQLGVALPTTAAAREVYNQVKGDAKEDLDYSAVMKFWER |
| Ga0210409_103212992 | 3300021559 | Soil | GVALPATAAAREVYNYVKGASPDDLDYSGIMRFWQKQ |
| Ga0242662_102875412 | 3300022533 | Soil | GVALPATAAAREVYSYVKGDAKEDLDYSGVMRFWKK |
| Ga0207711_103635183 | 3300025941 | Switchgrass Rhizosphere | LGNQIGVPLPAAAAAREIYNSVKGASKEDLDYAAVYKFWPR |
| Ga0209761_13075952 | 3300026313 | Grasslands Soil | NQLGVPLPATAAAREIYNAVKGSAKEDLDYAAVARFWQRA |
| Ga0209131_12528632 | 3300026320 | Grasslands Soil | DLANQIGVALPATAATRETYNYVKGSTTEDLDYAGVMRFWKK |
| Ga0209690_12047182 | 3300026524 | Soil | NQLGVALPATAAAREVYNAVKGAAKEDLDYSAVMKFWKR |
| Ga0209059_12872731 | 3300026527 | Soil | GVALPATAAAREIYNAVKGAAKEDLDYSAVMQFWKR |
| Ga0209807_12436951 | 3300026530 | Soil | DLSLVLELANQIGVALPAAAAARETYNYVKGASKQDLDYSAVMKFWQP |
| Ga0209648_101507502 | 3300026551 | Grasslands Soil | GVALPATAAVRETYNYVKGAAKEDLDYSAVMKFWQR |
| Ga0179587_110007261 | 3300026557 | Vadose Zone Soil | ALDLGNQIGVALPATAAAREVYSYVKGNAEEDLDYSAVMKFWQRQP |
| Ga0207760_1111981 | 3300026845 | Tropical Forest Soil | GVALPATAAAREVYNYVKGEAKEDLDYSAVMRFWKK |
| Ga0207815_10408462 | 3300027014 | Tropical Forest Soil | DLANQLGVALPATAAAREVYNYVKGEAKEDLDYSAVMRFWKK |
| Ga0209219_11088291 | 3300027565 | Forest Soil | NQIGVALPATAAARETYNYVKGATKEDLDYSAVMKFWKS |
| Ga0209003_10370961 | 3300027576 | Forest Soil | LGVALPATAAAREIYSAVKGAAKEDLDYSAVMRFWKR |
| Ga0209799_11505182 | 3300027654 | Tropical Forest Soil | GGPLPAAAAAREVYNSVKGSSQEDLDYAAVMKYWKR |
| Ga0209178_10435753 | 3300027725 | Agricultural Soil | ANQVGVPLPATASSRETYSYVKGSTKEDLDYAAVMKFWNR |
| Ga0209580_101040872 | 3300027842 | Surface Soil | VALPATAAARETYNYVKGAAKEDLDYSAVMKFWKS |
| Ga0209580_102067982 | 3300027842 | Surface Soil | LELGNQLGVALPATAAAREVYNYVKGEAKEDLDYSAVMRFWKK |
| Ga0209167_105880942 | 3300027867 | Surface Soil | LSLALDLGNQLGVPLPAAAAAREIYNSVKGSSKDDLDYAAVYKFWNR |
| Ga0137415_110254692 | 3300028536 | Vadose Zone Soil | NQLGVALPATAAARETYNYVKGSTAEDLDYAGVMRFWKK |
| Ga0302311_101908061 | 3300030739 | Palsa | GVTLPATAAARATYAHVKEAAKEDLDYSGVLKFWSKT |
| Ga0075404_115998681 | 3300030842 | Soil | LDLANQLGVALPATAAAREVYNYVKGTSPDDLDYSGVMRFWQK |
| Ga0310915_100393043 | 3300031573 | Soil | LGNQIGVPLPAAAAAREVYNSVKGSSKDDLDYAAVYKFWPR |
| Ga0318542_101135411 | 3300031668 | Soil | DLGNQLGVPLPAAAAARETYNSVKGSSKDDLDYAAVYKFWPR |
| Ga0318560_102206393 | 3300031682 | Soil | IGVPLPAAAAAREVYNSVKGSSKDDLDYAAVYKFWPR |
| Ga0307476_109732252 | 3300031715 | Hardwood Forest Soil | NQLGVALPTTAAAREVYNYVKGEAKEDLDYSGVMRFWKK |
| Ga0307474_115007441 | 3300031718 | Hardwood Forest Soil | NQLGVALPATAAARETYNYVKGSAKEDLDYSAVMKFWKK |
| Ga0306917_105192482 | 3300031719 | Soil | LGNQLGVPLPAAAAARETYNSVKGSSRDDLDYAAVYKFWPR |
| Ga0307469_119462202 | 3300031720 | Hardwood Forest Soil | LLDLANQLGVALPATAAAREVYSYVKGEAKEDLDYSGVMRYWKK |
| Ga0306918_102923212 | 3300031744 | Soil | LALDLGNQLGVPLPAAAAARETYNSVKGSSRDDLDYAAVYKFWPR |
| Ga0307477_100194511 | 3300031753 | Hardwood Forest Soil | VALPATAAAREVYNAVKGAAKEDLDYSAVMKFWKR |
| Ga0307477_103376592 | 3300031753 | Hardwood Forest Soil | VVLPATAAAREVYSYVKGSAKEDLDYSAVMKFWRR |
| Ga0318554_106385002 | 3300031765 | Soil | DLANQLGVALPATAAAREVYNFVKGEAKEDLDYSAVMRFWKK |
| Ga0318521_103219871 | 3300031770 | Soil | LDLGNQLGVALPATAAAREVYNAVKGEAKEDLDYSAVMRFWKK |
| Ga0310917_100949651 | 3300031833 | Soil | GNQIGVPLPAAAAAREVYNSVKGSSKDDLDYAAVYKFWPR |
| Ga0310910_101644641 | 3300031946 | Soil | NQLGVALPATAAAREVYNFVKGEAKEDLDYSAVMRFWKK |
| Ga0310909_101223603 | 3300031947 | Soil | VPLPAAAAAREVYNSVKGSSKDDLDYAAVYKFWPR |
| Ga0306926_100473757 | 3300031954 | Soil | QLGVPLPAAAAARETYNSVKGSSRDDLDYAAVYKFWPR |
| Ga0307479_100571851 | 3300031962 | Hardwood Forest Soil | GVTLPASSAARETYGKVKAAAKEDLDYSAVMKFWRH |
| Ga0307479_101931373 | 3300031962 | Hardwood Forest Soil | VALPATAAARETYNYVKGAAKEDLDYSAVMKFWTR |
| Ga0307479_103695511 | 3300031962 | Hardwood Forest Soil | GNQLGVALPATAAAREVYSYVKGEAKEDLDYSAVMRFWKK |
| Ga0318533_110377112 | 3300032059 | Soil | LGVPLPSTAAARETYSAVRGRSQEDLDYSAVMKFWKR |
| Ga0318514_108056101 | 3300032066 | Soil | VALPATAAARETYNFVKGSTSEDLDYAGVMRFWKR |
| Ga0318524_101192331 | 3300032067 | Soil | NQIGVPLPAAAAAREVYNSVKGSSKDDLDYAAVYKFWPR |
| Ga0318525_104730192 | 3300032089 | Soil | NQLGVSLPATAAAREVYNYVKGEAKEDLDYSAVMRFWKE |
| Ga0307471_1005793351 | 3300032180 | Hardwood Forest Soil | LGIPLPATAASREIYNFVKGASKDDLDYAAVFKYWEK |
| Ga0307471_1031070692 | 3300032180 | Hardwood Forest Soil | ALDLGNQIGVPLPAAAAAREVYNSVKGSCQEDLDYAAVMKFWKR |
| Ga0307471_1037164831 | 3300032180 | Hardwood Forest Soil | NQLGVALPATAAARETYNYVKGAAKEDLDYSAVMKFWTR |
| Ga0335082_110287892 | 3300032782 | Soil | QLGVALPATAAAREVYNYVKGESKEDVDYSAVRKFWKK |
| Ga0335074_102668264 | 3300032895 | Soil | DLANQLGVALPTTAAVREVYSHVKGEATEDVDYSAVMRFYKK |
| Ga0335076_107213971 | 3300032955 | Soil | LELGNQTGVPLPAAAAAREVYNSVLGAAKEDLDFASIAKFWK |
| Ga0335077_111225512 | 3300033158 | Soil | MGLLLDLGNQLGVALPTTAAAREVYSYVKGEAKEDLDYSGVMKFWKK |
| Ga0310914_108827201 | 3300033289 | Soil | LGLALDLANQLGVALPATAAAREVYNYVKGETKEDLDYSAVMRFWEK |
| ⦗Top⦘ |