| Basic Information | |
|---|---|
| Family ID | F046279 |
| Family Type | Metagenome |
| Number of Sequences | 151 |
| Average Sequence Length | 45 residues |
| Representative Sequence | PVARVDARTVVLVAARVGKTRLIDNVVLGEGVASDIAVRA |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.32 % |
| % of genes near scaffold ends (potentially truncated) | 97.35 % |
| % of genes from short scaffolds (< 2000 bps) | 86.09 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.338 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.503 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.358 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.318 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.18% β-sheet: 8.82% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF13399 | LytR_C | 29.14 |
| PF01966 | HD | 17.88 |
| PF04055 | Radical_SAM | 9.27 |
| PF02569 | Pantoate_ligase | 5.30 |
| PF01336 | tRNA_anti-codon | 1.99 |
| PF00359 | PTS_EIIA_2 | 1.99 |
| PF02261 | Asp_decarbox | 0.66 |
| PF00465 | Fe-ADH | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 5.30 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.66 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.66 |
| COG0853 | Aspartate 1-decarboxylase | Coenzyme transport and metabolism [H] | 0.66 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.66 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.34 % |
| Unclassified | root | N/A | 0.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002562|JGI25382J37095_10039845 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 1836 | Open in IMG/M |
| 3300002562|JGI25382J37095_10275619 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300002908|JGI25382J43887_10175336 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300002911|JGI25390J43892_10124013 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300002916|JGI25389J43894_1061759 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300003152|Ga0052254_1112938 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300004081|Ga0063454_100698818 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300004778|Ga0062383_10682953 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005166|Ga0066674_10275233 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300005167|Ga0066672_10080550 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1947 | Open in IMG/M |
| 3300005171|Ga0066677_10588416 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005172|Ga0066683_10338531 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300005180|Ga0066685_10322100 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1072 | Open in IMG/M |
| 3300005180|Ga0066685_10322673 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1071 | Open in IMG/M |
| 3300005186|Ga0066676_10083539 | All Organisms → cellular organisms → Bacteria | 1901 | Open in IMG/M |
| 3300005187|Ga0066675_11390610 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 515 | Open in IMG/M |
| 3300005406|Ga0070703_10389844 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005440|Ga0070705_100009203 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4905 | Open in IMG/M |
| 3300005444|Ga0070694_100958109 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005445|Ga0070708_101567995 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005446|Ga0066686_11060123 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005450|Ga0066682_10779908 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005450|Ga0066682_10905373 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005468|Ga0070707_101802699 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005545|Ga0070695_101398825 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005552|Ga0066701_10011560 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 4064 | Open in IMG/M |
| 3300005552|Ga0066701_10623322 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005558|Ga0066698_10092023 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300005560|Ga0066670_10242436 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1091 | Open in IMG/M |
| 3300005576|Ga0066708_10326448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 984 | Open in IMG/M |
| 3300005586|Ga0066691_10096195 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300005888|Ga0075289_1023651 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300006032|Ga0066696_10581970 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300006034|Ga0066656_10313791 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300006034|Ga0066656_10600519 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300006794|Ga0066658_10229375 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300006797|Ga0066659_10103690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1941 | Open in IMG/M |
| 3300006797|Ga0066659_10506462 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 969 | Open in IMG/M |
| 3300006852|Ga0075433_10576943 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300006904|Ga0075424_100206567 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
| 3300007076|Ga0075435_101568395 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300007258|Ga0099793_10151385 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1098 | Open in IMG/M |
| 3300007265|Ga0099794_10253989 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300009012|Ga0066710_103583413 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 586 | Open in IMG/M |
| 3300009012|Ga0066710_104424615 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300009038|Ga0099829_10591769 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 922 | Open in IMG/M |
| 3300009089|Ga0099828_11743426 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 547 | Open in IMG/M |
| 3300009095|Ga0079224_103065629 | Not Available | 666 | Open in IMG/M |
| 3300009137|Ga0066709_103087858 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 609 | Open in IMG/M |
| 3300009143|Ga0099792_10032967 | All Organisms → cellular organisms → Bacteria | 2414 | Open in IMG/M |
| 3300009804|Ga0105063_1086528 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 509 | Open in IMG/M |
| 3300009806|Ga0105081_1050107 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 608 | Open in IMG/M |
| 3300010303|Ga0134082_10525834 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 518 | Open in IMG/M |
| 3300010325|Ga0134064_10003783 | All Organisms → cellular organisms → Bacteria | 3688 | Open in IMG/M |
| 3300010325|Ga0134064_10302244 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 610 | Open in IMG/M |
| 3300010326|Ga0134065_10180649 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300010326|Ga0134065_10411324 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 545 | Open in IMG/M |
| 3300010329|Ga0134111_10343799 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300010333|Ga0134080_10295331 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300010335|Ga0134063_10127820 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1167 | Open in IMG/M |
| 3300010336|Ga0134071_10198461 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 989 | Open in IMG/M |
| 3300010337|Ga0134062_10034925 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300010361|Ga0126378_12791120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 558 | Open in IMG/M |
| 3300010364|Ga0134066_10088642 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 877 | Open in IMG/M |
| 3300010403|Ga0134123_11711937 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_3_65_8 | 680 | Open in IMG/M |
| 3300011271|Ga0137393_11475459 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 570 | Open in IMG/M |
| 3300012160|Ga0137349_1017697 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1103 | Open in IMG/M |
| 3300012189|Ga0137388_11167011 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 707 | Open in IMG/M |
| 3300012189|Ga0137388_11864564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 532 | Open in IMG/M |
| 3300012198|Ga0137364_10038886 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3099 | Open in IMG/M |
| 3300012198|Ga0137364_10229721 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300012205|Ga0137362_11158025 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300012206|Ga0137380_10376376 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300012206|Ga0137380_10499543 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1072 | Open in IMG/M |
| 3300012206|Ga0137380_10524420 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1042 | Open in IMG/M |
| 3300012208|Ga0137376_10060734 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3116 | Open in IMG/M |
| 3300012209|Ga0137379_10354503 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1376 | Open in IMG/M |
| 3300012211|Ga0137377_11968464 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 500 | Open in IMG/M |
| 3300012349|Ga0137387_10994609 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 602 | Open in IMG/M |
| 3300012354|Ga0137366_10019106 | All Organisms → cellular organisms → Bacteria | 5356 | Open in IMG/M |
| 3300012355|Ga0137369_10715911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 687 | Open in IMG/M |
| 3300012357|Ga0137384_10705323 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 819 | Open in IMG/M |
| 3300012360|Ga0137375_10247759 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1647 | Open in IMG/M |
| 3300012361|Ga0137360_10670478 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300012361|Ga0137360_11827724 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 513 | Open in IMG/M |
| 3300012683|Ga0137398_10334056 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1023 | Open in IMG/M |
| 3300012685|Ga0137397_10225585 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1395 | Open in IMG/M |
| 3300012896|Ga0157303_10175841 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012918|Ga0137396_10382099 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1043 | Open in IMG/M |
| 3300012918|Ga0137396_10413217 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1000 | Open in IMG/M |
| 3300012923|Ga0137359_10575410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 989 | Open in IMG/M |
| 3300012930|Ga0137407_11553219 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 630 | Open in IMG/M |
| 3300012931|Ga0153915_10196610 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2210 | Open in IMG/M |
| 3300015356|Ga0134073_10013046 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300017654|Ga0134069_1156529 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 763 | Open in IMG/M |
| 3300017656|Ga0134112_10033475 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1818 | Open in IMG/M |
| 3300017656|Ga0134112_10395513 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 570 | Open in IMG/M |
| 3300017657|Ga0134074_1154883 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 802 | Open in IMG/M |
| 3300017659|Ga0134083_10268019 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300018084|Ga0184629_10237605 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 950 | Open in IMG/M |
| 3300018433|Ga0066667_10014814 | All Organisms → cellular organisms → Bacteria | 3925 | Open in IMG/M |
| 3300018433|Ga0066667_10226406 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1397 | Open in IMG/M |
| 3300018433|Ga0066667_11564381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 585 | Open in IMG/M |
| 3300018482|Ga0066669_10701272 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 892 | Open in IMG/M |
| 3300018482|Ga0066669_12333010 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 511 | Open in IMG/M |
| 3300019789|Ga0137408_1173531 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2016 | Open in IMG/M |
| 3300019878|Ga0193715_1021865 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1389 | Open in IMG/M |
| 3300020170|Ga0179594_10276694 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 634 | Open in IMG/M |
| 3300021081|Ga0210379_10296350 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300021559|Ga0210409_11687126 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 510 | Open in IMG/M |
| 3300024246|Ga0247680_1031552 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300025319|Ga0209520_10348062 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 899 | Open in IMG/M |
| 3300025322|Ga0209641_11059800 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 521 | Open in IMG/M |
| 3300025910|Ga0207684_10639201 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300025910|Ga0207684_11368760 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 580 | Open in IMG/M |
| 3300025910|Ga0207684_11587816 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 530 | Open in IMG/M |
| 3300025922|Ga0207646_10257514 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1577 | Open in IMG/M |
| 3300026089|Ga0207648_10691671 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300026297|Ga0209237_1030420 | All Organisms → cellular organisms → Bacteria | 2954 | Open in IMG/M |
| 3300026298|Ga0209236_1028953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2985 | Open in IMG/M |
| 3300026298|Ga0209236_1114662 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300026300|Ga0209027_1024397 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2291 | Open in IMG/M |
| 3300026300|Ga0209027_1182907 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 685 | Open in IMG/M |
| 3300026301|Ga0209238_1077013 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1166 | Open in IMG/M |
| 3300026307|Ga0209469_1052311 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1284 | Open in IMG/M |
| 3300026307|Ga0209469_1086124 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 923 | Open in IMG/M |
| 3300026310|Ga0209239_1157390 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 892 | Open in IMG/M |
| 3300026318|Ga0209471_1307024 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 526 | Open in IMG/M |
| 3300026324|Ga0209470_1038649 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2378 | Open in IMG/M |
| 3300026324|Ga0209470_1315662 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 572 | Open in IMG/M |
| 3300026326|Ga0209801_1301029 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 572 | Open in IMG/M |
| 3300026328|Ga0209802_1169494 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 894 | Open in IMG/M |
| 3300026329|Ga0209375_1251385 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 593 | Open in IMG/M |
| 3300026524|Ga0209690_1016311 | All Organisms → cellular organisms → Bacteria | 3838 | Open in IMG/M |
| 3300026548|Ga0209161_10035513 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3394 | Open in IMG/M |
| 3300026555|Ga0179593_1254619 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3210 | Open in IMG/M |
| 3300027032|Ga0209877_1023850 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 596 | Open in IMG/M |
| 3300027846|Ga0209180_10217160 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1102 | Open in IMG/M |
| 3300027882|Ga0209590_10444652 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300027882|Ga0209590_10560475 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 736 | Open in IMG/M |
| 3300028536|Ga0137415_10074849 | All Organisms → cellular organisms → Bacteria | 3245 | Open in IMG/M |
| 3300028884|Ga0307308_10246058 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 857 | Open in IMG/M |
| 3300031229|Ga0299913_11254126 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300031576|Ga0247727_10551758 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300031962|Ga0307479_10058370 | All Organisms → cellular organisms → Bacteria | 3718 | Open in IMG/M |
| 3300032180|Ga0307471_101867593 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300032180|Ga0307471_103749137 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 538 | Open in IMG/M |
| 3300033502|Ga0326731_1058233 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 901 | Open in IMG/M |
| 3300033811|Ga0364924_003932 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2594 | Open in IMG/M |
| 3300033812|Ga0364926_036780 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 924 | Open in IMG/M |
| 3300034177|Ga0364932_0284071 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 625 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 13.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.99% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.99% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.66% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.66% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.66% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.66% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.66% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.66% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.66% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.66% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25382J37095_100398452 | 3300002562 | Grasslands Soil | VKRLTAHTVAVVAARVGTTRLIDNVVLGEGIGADPRVAP* |
| JGI25382J37095_102756192 | 3300002562 | Grasslands Soil | LIDENLEPVKRLTAHTVAVVAARVGTTRLIDNVVLGEGIGADPRVTP* |
| JGI25382J43887_101753361 | 3300002908 | Grasslands Soil | LVDDNVQPVSRVTAHTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP* |
| JGI25390J43892_101240132 | 3300002911 | Grasslands Soil | QMRPVARVDARTVVLVAAKVGKTRLIDNVVLGEGIAGDVSVRTT* |
| JGI25389J43894_10617592 | 3300002916 | Grasslands Soil | VDEQMRPVARVDARTAVLVAAKVGTTRLIDNVVLGEGVAADTAVRA* |
| Ga0052254_11129382 | 3300003152 | Sediment | VVPEYLHVLGAELQPITRADAATVVVVAARVGATRLIDNVVLGEGMAHDVAVRSA* |
| Ga0063454_1006988181 | 3300004081 | Soil | SGALPEYCALIDENLQPVTRVTARTVAAVAARVGKTRLLDSVVLGEGIGADPRVSP* |
| Ga0062383_106829531 | 3300004778 | Wetland Sediment | PITRVTPHTVAAVAARVGKTRLIDNVVLGEGVGADPRVTP* |
| Ga0066674_102752332 | 3300005166 | Soil | VARVDARTAVLVAAKVGKTRLIDNVVLGEGVASDISVRALA* |
| Ga0066672_100805504 | 3300005167 | Soil | ALVDEQMRPVARVDARTVVVIAARVGTTRLIDNVVLGEGVAGDVSVRAS* |
| Ga0066677_105884162 | 3300005171 | Soil | VDEQLRPVARADARTVVAIAAHVGATRLIDNVVLGEGVAGDVSVRAS* |
| Ga0066683_103385311 | 3300005172 | Soil | RLRPVARADARTVVVIAARVGTTRLIDNVVLGEGVASDVSVRAS* |
| Ga0066685_103221003 | 3300005180 | Soil | VARADARTVVVVAAAVGGTRLIDNVVLGEGMANDIAVRAS* |
| Ga0066685_103226733 | 3300005180 | Soil | MRPVARVDARTAVLVAAKVGTTRLIDNVVLGEGVAADTAVRA* |
| Ga0066676_100835391 | 3300005186 | Soil | RVGLETMHGPGVIPEYCALIDEDLQAVTRVTARTVAVVAARLGKTRLIDNVVLGEGVGADPRVTP* |
| Ga0066675_113906102 | 3300005187 | Soil | VARADARTVVVIAAHVGATRLIDNVVLGEGVAGDIAVRT* |
| Ga0070703_103898441 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | HLRPVERVTARTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP* |
| Ga0070705_1000092037 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | QMRPVTRVDAKTIALVAARVGAAGTRLIDNVVLGEGIANDVPVRGAVKA* |
| Ga0070694_1009581091 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GVIPEYCALIDENLRPVERVTARTVAVVAARIGKTRLLDNVVLGEGIAADPRTKP* |
| Ga0070708_1015679952 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RPVERLTARTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP* |
| Ga0066686_110601231 | 3300005446 | Soil | PVARVDARTVVLVAARVGKTRLIDNVVLGEGVASDIAVRA* |
| Ga0066682_107799082 | 3300005450 | Soil | VDEQMRPVARVDARTVVVIAARVGTTRLIDNVVLGEGVAGDVSVRAS* |
| Ga0066682_109053731 | 3300005450 | Soil | VDEQLRPVARADARTVVVIAAQVGPTRLIDNVVLGEGVARDVSVRT* |
| Ga0070707_1018026992 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | PVERVTARTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP* |
| Ga0070695_1013988251 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | EAMHAPGVIAEYCSLVDENVQPVSRVTAHTVGVVAALVGKTRLLDNVVLGEGIGADPRVTP* |
| Ga0066701_100115601 | 3300005552 | Soil | RAVVVIAARVGATRLIDNVVLGEGVAGDVAVGGRA* |
| Ga0066701_106233222 | 3300005552 | Soil | VTRVTAHTVGVVAARVGKTRLLDNVVLGEGIGADPRVKP* |
| Ga0066698_100920231 | 3300005558 | Soil | LQPVSRVTAHTVAAVAARVGKTRLLDNVVLGEGIGADPRVTR* |
| Ga0066670_102424364 | 3300005560 | Soil | VARVDARTIVLVAARVGKTRLLDNVVLGEGIAGDVSVRTT* |
| Ga0066708_103264481 | 3300005576 | Soil | EQLRPVARVDARTVVVIAAQVGATRLIDNVVLGEGVGSDIAVRAS* |
| Ga0066691_100961954 | 3300005586 | Soil | EAMRPVKQADARAVVVIAARVGATRLIDNVVLGEGVAGDIAVANRA* |
| Ga0075289_10236511 | 3300005888 | Rice Paddy Soil | ARADARTVVVVAARVGTTRLRVGTTRLIDNVILGEGMAADPTVRV* |
| Ga0066696_105819701 | 3300006032 | Soil | DARTVVVIAAQVGPTRLIDNVVLGEGVARDVSVRT* |
| Ga0066656_103137913 | 3300006034 | Soil | VTAHTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP* |
| Ga0066656_106005191 | 3300006034 | Soil | RADARTVVMIAAQVGTTRLIDNVVLGEGVGGDISVRA* |
| Ga0066658_102293753 | 3300006794 | Soil | ELVDEQLRPVARADARTVVAIAAHVGATRLIDNVVLGEGVAGDVSVRAS* |
| Ga0066659_101036901 | 3300006797 | Soil | ELRAVARADARTVVAVAARVGATRLIDNVVLGEGVASDESVRTT* |
| Ga0066659_105064621 | 3300006797 | Soil | DARTVVLVAAVVGATRLIDNVVLGEGMANDIAVRAS* |
| Ga0075433_105769431 | 3300006852 | Populus Rhizosphere | TQTTVALVAARVGETRLIDNVILGEGVGADPTVSA* |
| Ga0075424_1002065675 | 3300006904 | Populus Rhizosphere | PVTRVTAHTVGVVAARVGKTRLLDNVVLGEGIGADPRVTP* |
| Ga0075435_1015683951 | 3300007076 | Populus Rhizosphere | MRPVARVDARTVVLVAARIGKTRLIDNVVLGEGIAGDIAVRA* |
| Ga0099793_101513851 | 3300007258 | Vadose Zone Soil | LELVDEQIRPVARADARTVVLIAAQVGTTRLIDNVVLGEGVGGDISVRA* |
| Ga0099794_102539893 | 3300007265 | Vadose Zone Soil | VGRATARTIVVVAARVGATRLIDNVVLGEGLAADPAVRP* |
| Ga0066710_1035834131 | 3300009012 | Grasslands Soil | PVSRITARTVAVVAARIGKTRLLDNVVLGEGIGADPRVSP |
| Ga0066710_1044246152 | 3300009012 | Grasslands Soil | VDEELRPVERVTARTVVLVATRVGATRLIDNVVLGEGIAADPTVRS |
| Ga0099829_105917691 | 3300009038 | Vadose Zone Soil | NAKTIVVVAARVGSTRLIDNVVLGEGVGADPTVRA* |
| Ga0099828_117434261 | 3300009089 | Vadose Zone Soil | EYCALVDENLQPVSRVTAHTVAVVAARVGKTRLLDNVVLGEGIGADPRVTR* |
| Ga0079224_1030656293 | 3300009095 | Agricultural Soil | ARVDVRTIVAVAARVGSTRLIDNIVLGEGLRAGSA* |
| Ga0066709_1030878582 | 3300009137 | Grasslands Soil | ARTVVVIAARVGTTRLIDNVVLGEGVAADTAVRT* |
| Ga0099792_100329671 | 3300009143 | Vadose Zone Soil | PGYLELVDEQIRAVARADARTVVMIAAQVGTTRLIDNVVLGEGVGGDISVRA* |
| Ga0105063_10865281 | 3300009804 | Groundwater Sand | IPEYCALVDEDVRPVARVTARTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP* |
| Ga0105081_10501071 | 3300009806 | Groundwater Sand | RVTQKTIAVVAARVGRTRLIDNVVLGDGLGADPTIRS* |
| Ga0134082_105258342 | 3300010303 | Grasslands Soil | LRHVARVDARTVVVIAAQVGPTRLIDNVVLGEGVARDVSVRA* |
| Ga0134064_100037836 | 3300010325 | Grasslands Soil | VDEQMRPVARVDARTVVLVAARVGKTRLIDNVVLGEGVASDIAVRA* |
| Ga0134064_103022441 | 3300010325 | Grasslands Soil | PEYLALVDDQMRPVARVDARTAVLVAAKVGKTRLIDNVVLGEGVAADPAVRA* |
| Ga0134065_101806492 | 3300010326 | Grasslands Soil | DARTVVLVAAKVGKTRLIDNVVLGEGVASDTSVRA* |
| Ga0134065_104113242 | 3300010326 | Grasslands Soil | TARTVAVVAARIGKTRLLDNVVLGEGIGADPRVAP* |
| Ga0134111_103437992 | 3300010329 | Grasslands Soil | EELQPVARVTARTVVVVAARVGNTRLIDNVALGEGIAADPTVRP* |
| Ga0134080_102953312 | 3300010333 | Grasslands Soil | VDDQMRPVARVDARTAVLVAAKVGKTRLIDNVVLGEGVAADPAVRA* |
| Ga0134063_101278201 | 3300010335 | Grasslands Soil | ARTVVVIAARVGTTRLIDNVVLGEGVAGDVSVRAS* |
| Ga0134071_101984611 | 3300010336 | Grasslands Soil | ENLQPVSRVTAHTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP* |
| Ga0134062_100349251 | 3300010337 | Grasslands Soil | DARTVVVVAARVGTTRLIDNVVLGEGVASDVSVRAS* |
| Ga0126378_127911201 | 3300010361 | Tropical Forest Soil | EYLALVDDHLRPVERVTQATVALVAARVGTTRLIDNVVLGEGVGADPTVAP* |
| Ga0134066_100886421 | 3300010364 | Grasslands Soil | QRVGLETMHDPGVIPEYCALIDEDLQAVTRVTARAVAVVAARLGKTRLIDNVVLGEGVGADPRVTP* |
| Ga0134123_117119371 | 3300010403 | Terrestrial Soil | ALIDENLRPVERVTARTVAVVAARIGKTRLLDNVVLGEGIAADPRTKP* |
| Ga0137393_114754591 | 3300011271 | Vadose Zone Soil | LMAPGVTPGYLELVDEQIRAVARADARTVVMIAAQVGTTRLIDNVVLGEGVGGDISVRA* |
| Ga0137349_10176973 | 3300012160 | Soil | PNHGAGPRSILAGAIRVGPRRLIDNVVLGEGVAADPVVRG* |
| Ga0137388_111670111 | 3300012189 | Vadose Zone Soil | PVSRVTARTVAVVAARVGKTRLLDNVVLGEGIGADPRVAP* |
| Ga0137388_118645642 | 3300012189 | Vadose Zone Soil | VDDHLRPVERVTQATVALVAARLGTTRLIDNVVLGEGVGADPTVDA* |
| Ga0137364_100388861 | 3300012198 | Vadose Zone Soil | KLQRAGLEAMHAPGVIPEYCALVDEHVQPVTRVTAHAIGVVAARVGKTRLLDNVVLGEGIGADPRVAR* |
| Ga0137364_102297213 | 3300012198 | Vadose Zone Soil | VDARTVVVIAARVGTTRLIDNVVLGEGVAADTAVRT* |
| Ga0137362_111580252 | 3300012205 | Vadose Zone Soil | LVDENVQPVTRVKAHTVGVVAARVGRTRLLDNVVLGEGIGADPRVTP* |
| Ga0137380_103763763 | 3300012206 | Vadose Zone Soil | EYLALVDEELRPVARVDARTVVLVAARVGPTRLIDHVVLGEGVASDVPVRGS* |
| Ga0137380_104995431 | 3300012206 | Vadose Zone Soil | RPVARVDARTVVVIAARVGTTRLIDNVVLGEGVASDVSVRAS* |
| Ga0137380_105244203 | 3300012206 | Vadose Zone Soil | VDEQMRPVARVDARTVVVIAARVGTTRLIDNVVLGEGVAADTAVRT* |
| Ga0137376_100607341 | 3300012208 | Vadose Zone Soil | LRPVARADARTVVVIAAQVGPTRLIDNVVLGEGVAGDITVPAS* |
| Ga0137379_103545031 | 3300012209 | Vadose Zone Soil | DARTVVVIAARVGTTRLIDNVVLGEGVAGDVSVRAS* |
| Ga0137377_119684642 | 3300012211 | Vadose Zone Soil | LRPVARADARTVVVIAAQVGPTRLIDNVVLGEGVARDVSVRAS* |
| Ga0137387_109946091 | 3300012349 | Vadose Zone Soil | DEQMRSVARVDARTVVLVAAKVGTTRLIDNVVLGEGVAADPAVRA* |
| Ga0137366_100191061 | 3300012354 | Vadose Zone Soil | PEYCALVDEDVQPVSRVTARTVAVVAARIGKTRLLDNVVLGEGIGADPRVGP* |
| Ga0137369_107159112 | 3300012355 | Vadose Zone Soil | LEVLKAPGVTPAYLALVDDELHSVARADARTVVVVAAKVGATRLIDNVVLGEGVASDISVRG* |
| Ga0137384_107053231 | 3300012357 | Vadose Zone Soil | ENLQPVSRVTAHTVGVVAARVGKTRLLDNVVLGEGIGADPRVTP* |
| Ga0137375_102477594 | 3300012360 | Vadose Zone Soil | VARADARTVVVVAARVGATRLIDNVVLGEGVASDISVRA* |
| Ga0137360_106704783 | 3300012361 | Vadose Zone Soil | EYLALVDDQMRPVSRADARSVVVIAARVGTTRLIDNVVLGEGVANDIAVRAS* |
| Ga0137360_118277242 | 3300012361 | Vadose Zone Soil | DEDVHPVSRVTARTVAVVAARVGKTRLLDNVVLGEGIGADPRVKP* |
| Ga0137398_103340563 | 3300012683 | Vadose Zone Soil | MSRADARSVVVIAARVGTTRLIDNVVLGEGVANDIAVRAS* |
| Ga0137397_102255851 | 3300012685 | Vadose Zone Soil | MRASGALPEYCALIDEELRPVERVTARTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP* |
| Ga0157303_101758412 | 3300012896 | Soil | VIPEYCALIDEHLRPVERVTARTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP* |
| Ga0137396_103820993 | 3300012918 | Vadose Zone Soil | TAHTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP* |
| Ga0137396_104132171 | 3300012918 | Vadose Zone Soil | LVDENVQPVSRVTAHTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP* |
| Ga0137359_105754101 | 3300012923 | Vadose Zone Soil | QTLMAPGVTPGYLELVDEQIRAVARADARTVVMIAAQVGTTRLIDNVVLGEGVGGDISVRA* |
| Ga0137407_115532191 | 3300012930 | Vadose Zone Soil | YLALVDEELQPVTRVTARSVAILAARLGATRLIDNVVLGEGVAADATVRA* |
| Ga0153915_101966101 | 3300012931 | Freshwater Wetlands | EYFALVDGGLTPVDRVTQTTVVLVAARVGTTRLIDNVVLGEGVGADPTVRG* |
| Ga0134073_100130463 | 3300015356 | Grasslands Soil | ARVDARTVVLVAAKVGKTRLIDNVVLGEGVAADPAVRA* |
| Ga0134069_11565291 | 3300017654 | Grasslands Soil | DEQMRPVARVDARTVVVIAARVGTTRLIDNVVLGEGVAADTAVRT |
| Ga0134112_100334751 | 3300017656 | Grasslands Soil | DARTVVVIAAKIGATRLIDNVVLGEGIASDVAVRGM |
| Ga0134112_103955132 | 3300017656 | Grasslands Soil | PVTRVDARTVVVIAARVGTTRLIDNVVLGEGVAGDIAVRA |
| Ga0134074_11548831 | 3300017657 | Grasslands Soil | LIDENLQPVTRVTAHTIGVVAARVGKTRLLDNVVLGEGIGADPRVTP |
| Ga0134083_102680191 | 3300017659 | Grasslands Soil | ETMHGPGVIPEYCALIDEALQAVTRVTARTVAVVAARLGKTRLIDNVVLGEGVGADPRVT |
| Ga0184629_102376053 | 3300018084 | Groundwater Sediment | DRVTQKTIAVVAARVGRTRLIDNVVLGDGLGADPTIRS |
| Ga0066667_100148147 | 3300018433 | Grasslands Soil | LRPVARVDARTVVVIAAQVGATRLIDNVVLGEGVGSDIAVRV |
| Ga0066667_102264061 | 3300018433 | Grasslands Soil | CALVDENVQPVTRVTAHTVGVVAARVGKTRLLDNVVLGEGIGADPRVKP |
| Ga0066667_115643811 | 3300018433 | Grasslands Soil | LVDEQMRPVARVDARTVVVIAARVGTTRLIDNVVLGEGVAGDVSVRAS |
| Ga0066669_107012723 | 3300018482 | Grasslands Soil | PVARVDARTVVVIAAQVGATRLIDNVVLGEGVGSDIAVRAS |
| Ga0066669_123330102 | 3300018482 | Grasslands Soil | ALVDEALAPVERVTARTIVLVAARVGATRLIDNVVLGEGLAADPAVRA |
| Ga0137408_11735314 | 3300019789 | Vadose Zone Soil | VARADARTVVLIAAQVGTTRLIDNVVLGEGVGGDISVRA |
| Ga0193715_10218651 | 3300019878 | Soil | LRPAARVDAHTVVAVAARVGTTRLIDNVVLGEGIAADTAVRA |
| Ga0179594_102766942 | 3300020170 | Vadose Zone Soil | RVDARSVVLVAGRVGKTRLIDNVVLGEGVAGDIAVRP |
| Ga0210379_102963501 | 3300021081 | Groundwater Sediment | LALIDEGCRPVERATAATIVVTAARVGPVRLIDNVILGEGVAADPTVSA |
| Ga0210409_116871262 | 3300021559 | Soil | GEHLRPLTRPDARTVVLVAARVGATRLIDNVVLGEGLAGDVSVRGS |
| Ga0247680_10315523 | 3300024246 | Soil | VTAKTVVVLAGRVGATRLIDNVVIADGVSSDPTVRS |
| Ga0209520_103480621 | 3300025319 | Soil | RPVTRATPRTVTVVAARVGATRLIDNVVLGEGVAADPTVRP |
| Ga0209641_110598001 | 3300025322 | Soil | LVDEDLRPVTRATPRTVTVVAARVGATRLIDNVVLGEGVAADPTVRP |
| Ga0207684_106392011 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ERVTQATVALVAARLGTTRLIDNVVLGEGVGADPTVDA |
| Ga0207684_113687602 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RVDARTVVLIAARVGTTRLIDNVVLGEGVAGDVSVRAS |
| Ga0207684_115878161 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DIQPVNRVTARTVAVIAARVGKTRLLDNVVLGEGIGADPRVRA |
| Ga0207646_102575144 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PVERVTARTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP |
| Ga0207648_106916711 | 3300026089 | Miscanthus Rhizosphere | PEYCALIDEHLRPVERVTARTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP |
| Ga0209237_10304201 | 3300026297 | Grasslands Soil | DARTVVVIAARVGTTRLIDNVVLGEGVAADTAVRT |
| Ga0209236_10289535 | 3300026298 | Grasslands Soil | GVSPGYLELVDEQLRPVARVDARTVVVIAAQVGATRLIDNVVLGEGVASDIAVRTS |
| Ga0209236_11146621 | 3300026298 | Grasslands Soil | VDEQMRSVARVDARTVVLVAAKVGKTRLIDNVVLGEGVAADPAVRA |
| Ga0209027_10243971 | 3300026300 | Grasslands Soil | QMRPVARVDARTVVVIAARVGTTRLIDNVVLGEGVAADTAVRT |
| Ga0209027_11829072 | 3300026300 | Grasslands Soil | RPVARVDARTVVLVAAKIGKTRLIDNVVLGEGIAGDVSVRTT |
| Ga0209238_10770133 | 3300026301 | Grasslands Soil | LVDEQMRPVARVDARTVVLVAARVGKTRLIDNVVLGEGVASDIAVRA |
| Ga0209469_10523111 | 3300026307 | Soil | LQPVSRVTAHTVAAVAARVGKTRLLDNVVLGEGIGADPRVTR |
| Ga0209469_10861243 | 3300026307 | Soil | VSPGYLELVDEQLRPVARVDARSVVVIAAQVGATRLIDNVVLGEGIAGDVAVRGP |
| Ga0209239_11573901 | 3300026310 | Grasslands Soil | ARVDARTVVLVAAKVGKTRLIDNVVLGEGVAADPAVRA |
| Ga0209471_13070241 | 3300026318 | Soil | RVAARTVVLVAAKVGRTRLIDNVVLGEGIANDVSVRTA |
| Ga0209470_10386491 | 3300026324 | Soil | CALIDEDLQAVTRVTARTVAVVAARLGKTRLIDNVVLGEGVGADPRVTP |
| Ga0209470_13156621 | 3300026324 | Soil | AIVGEAVRPVKQADARAVVVIAARVGATRLIDNVVLGEGVAGDVAVGGRA |
| Ga0209801_13010291 | 3300026326 | Soil | YLALVDEQMRPVARVDARTVVVIAARVGTTRLIDNVVLGEGVAADTAVRT |
| Ga0209802_11694941 | 3300026328 | Soil | LALVDEQMRPVARVDARTVVVIAARVGTTRLIDNVVLGEGVAADTAVRT |
| Ga0209375_12513851 | 3300026329 | Soil | LALVDEQMRPVARVDARTVVVIAARVGTTRLIDNVVLGEGVAGDVSVRAS |
| Ga0209690_10163116 | 3300026524 | Soil | ALVDEQMRPVARVDARTVVVIAARVGTTRLIDNVVLGEGVAADTAVRT |
| Ga0209161_100355131 | 3300026548 | Soil | VTARTVVLVATRVGATRLIDNVVLGEGIAADPTVRS |
| Ga0179593_12546196 | 3300026555 | Vadose Zone Soil | SVTRVDARSVVLVAWRVGKTRLIDNVVLGEGVAGDIAVRP |
| Ga0209877_10238501 | 3300027032 | Groundwater Sand | EDVRPVARVTARTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP |
| Ga0209180_102171604 | 3300027846 | Vadose Zone Soil | GVTPEYLVLVDRSLRPVSRVDARTVALVAAKVGSTRLIDNVVLGDGMAADTAVRA |
| Ga0209590_104446521 | 3300027882 | Vadose Zone Soil | ALVDEHVQPVRRVTAHTVAVVAARVGKTRLLDNVVLGEGIGADPRVKP |
| Ga0209590_105604751 | 3300027882 | Vadose Zone Soil | DQMRPVSRADAHSVVVIAARVGTTRLIDNVVLGEGVANDIAVRAS |
| Ga0137415_100748496 | 3300028536 | Vadose Zone Soil | VSRVTAHTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP |
| Ga0307308_102460581 | 3300028884 | Soil | ALVDENVQPVGRVTAHTVAVVAARVGKTRLLDNVVLGEGIGADPRVTP |
| Ga0299913_112541261 | 3300031229 | Soil | PEYLALVDEGLQPVDRADARSIALIAGRVGSARLIDNVVLGAGVAADPVVSG |
| Ga0247727_105517583 | 3300031576 | Biofilm | LRPVGRATARTIVVLAARVGGTRLIDNVVLGDGLAADPTVGR |
| Ga0307479_100583706 | 3300031962 | Hardwood Forest Soil | LRPVTRADARTAVLLAARVGRTRLIDNVVLGEGVAADPAVRTS |
| Ga0307471_1018675931 | 3300032180 | Hardwood Forest Soil | RVTARTVAVVAARLGKTRLIDNVVLGDGVGADPRVTP |
| Ga0307471_1037491371 | 3300032180 | Hardwood Forest Soil | CALVDENVQPVTRVTAHTIGVVAARVGKTRLLDNVVLGEGIGADPRVTP |
| Ga0326731_10582331 | 3300033502 | Peat Soil | LADGGLARVDRVTQTTVALVAARVGTTRLIDNVVLGAGVGADPTVRG |
| Ga0364924_003932_2487_2594 | 3300033811 | Sediment | TQKTIAVVAARVGPTRLIDNVVLGDGLGADPTIRS |
| Ga0364926_036780_766_924 | 3300033812 | Sediment | PEYCALVDEGLQGVSRVTARTVAVVAARVGKTRLLDNVVLGEGIGADPRVAP |
| Ga0364932_0284071_2_142 | 3300034177 | Sediment | VDEELKPVDRVTQKTIAVVAARVGPTRLIDNVVLGDGIGADPSIRS |
| ⦗Top⦘ |