| Basic Information | |
|---|---|
| Family ID | F046267 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 151 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MARQRLVLKDPGRFSDPANLTWERYVALQARERERYLAERATI |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.78 % |
| % of genes near scaffold ends (potentially truncated) | 99.34 % |
| % of genes from short scaffolds (< 2000 bps) | 89.40 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.040 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.907 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.530 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.033 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.21% β-sheet: 0.00% Coil/Unstructured: 64.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF02826 | 2-Hacid_dh_C | 33.77 |
| PF00296 | Bac_luciferase | 7.95 |
| PF13193 | AMP-binding_C | 4.64 |
| PF00970 | FAD_binding_6 | 3.97 |
| PF00496 | SBP_bac_5 | 3.31 |
| PF00111 | Fer2 | 3.31 |
| PF01314 | AFOR_C | 2.65 |
| PF00355 | Rieske | 1.99 |
| PF13185 | GAF_2 | 1.99 |
| PF02515 | CoA_transf_3 | 1.99 |
| PF13561 | adh_short_C2 | 1.32 |
| PF08240 | ADH_N | 1.32 |
| PF01019 | G_glu_transpept | 1.32 |
| PF05378 | Hydant_A_N | 1.32 |
| PF04199 | Cyclase | 1.32 |
| PF00561 | Abhydrolase_1 | 0.66 |
| PF14588 | YjgF_endoribonc | 0.66 |
| PF02653 | BPD_transp_2 | 0.66 |
| PF13544 | Obsolete Pfam Family | 0.66 |
| PF03130 | HEAT_PBS | 0.66 |
| PF02779 | Transket_pyr | 0.66 |
| PF02630 | SCO1-SenC | 0.66 |
| PF13785 | DUF4178 | 0.66 |
| PF13518 | HTH_28 | 0.66 |
| PF07992 | Pyr_redox_2 | 0.66 |
| PF01738 | DLH | 0.66 |
| PF05598 | DUF772 | 0.66 |
| PF00275 | EPSP_synthase | 0.66 |
| PF13458 | Peripla_BP_6 | 0.66 |
| PF04392 | ABC_sub_bind | 0.66 |
| PF00072 | Response_reg | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 7.95 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 2.65 |
| COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 2.65 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.99 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 1.32 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.32 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.04 % |
| Unclassified | root | N/A | 5.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0837901 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 882 | Open in IMG/M |
| 3300004114|Ga0062593_100343850 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1300 | Open in IMG/M |
| 3300004633|Ga0066395_10062322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1689 | Open in IMG/M |
| 3300005171|Ga0066677_10036187 | All Organisms → cellular organisms → Bacteria | 2397 | Open in IMG/M |
| 3300005171|Ga0066677_10453556 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 734 | Open in IMG/M |
| 3300005174|Ga0066680_10264566 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1094 | Open in IMG/M |
| 3300005180|Ga0066685_10898575 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005186|Ga0066676_10840685 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 619 | Open in IMG/M |
| 3300005294|Ga0065705_10528896 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005332|Ga0066388_105781916 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
| 3300005334|Ga0068869_100412952 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1112 | Open in IMG/M |
| 3300005353|Ga0070669_101182442 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 660 | Open in IMG/M |
| 3300005444|Ga0070694_101314188 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 608 | Open in IMG/M |
| 3300005445|Ga0070708_100223649 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300005447|Ga0066689_10935312 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 535 | Open in IMG/M |
| 3300005468|Ga0070707_101185051 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 730 | Open in IMG/M |
| 3300005529|Ga0070741_10466555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 1148 | Open in IMG/M |
| 3300005536|Ga0070697_100129939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2112 | Open in IMG/M |
| 3300005536|Ga0070697_100403863 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1186 | Open in IMG/M |
| 3300005545|Ga0070695_101786671 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
| 3300005558|Ga0066698_10788366 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005559|Ga0066700_10444562 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 910 | Open in IMG/M |
| 3300005561|Ga0066699_10887889 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 623 | Open in IMG/M |
| 3300005575|Ga0066702_10022501 | All Organisms → cellular organisms → Bacteria | 3104 | Open in IMG/M |
| 3300005586|Ga0066691_10727245 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 587 | Open in IMG/M |
| 3300005617|Ga0068859_102931270 | Not Available | 522 | Open in IMG/M |
| 3300005618|Ga0068864_100998645 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 830 | Open in IMG/M |
| 3300005713|Ga0066905_101058001 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 718 | Open in IMG/M |
| 3300005764|Ga0066903_104376676 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005876|Ga0075300_1048807 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 607 | Open in IMG/M |
| 3300005880|Ga0075298_1002383 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300005887|Ga0075292_1026728 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 780 | Open in IMG/M |
| 3300006047|Ga0075024_100547515 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006796|Ga0066665_10859350 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 708 | Open in IMG/M |
| 3300006800|Ga0066660_11534841 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 525 | Open in IMG/M |
| 3300006806|Ga0079220_11068090 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 649 | Open in IMG/M |
| 3300006845|Ga0075421_101752507 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 670 | Open in IMG/M |
| 3300006846|Ga0075430_100332056 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300006846|Ga0075430_100371289 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1181 | Open in IMG/M |
| 3300006847|Ga0075431_102009786 | Not Available | 533 | Open in IMG/M |
| 3300006852|Ga0075433_11579468 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 566 | Open in IMG/M |
| 3300006894|Ga0079215_10156739 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1096 | Open in IMG/M |
| 3300006894|Ga0079215_10366440 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 833 | Open in IMG/M |
| 3300006904|Ga0075424_101831624 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 642 | Open in IMG/M |
| 3300006918|Ga0079216_10397895 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300006969|Ga0075419_10182072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1385 | Open in IMG/M |
| 3300007255|Ga0099791_10547948 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 563 | Open in IMG/M |
| 3300009012|Ga0066710_101682934 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 967 | Open in IMG/M |
| 3300009012|Ga0066710_101692008 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 963 | Open in IMG/M |
| 3300009137|Ga0066709_104005643 | Not Available | 535 | Open in IMG/M |
| 3300009143|Ga0099792_10109561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1465 | Open in IMG/M |
| 3300009147|Ga0114129_11283303 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300009147|Ga0114129_12667146 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 596 | Open in IMG/M |
| 3300009147|Ga0114129_13389753 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 513 | Open in IMG/M |
| 3300009808|Ga0105071_1035649 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300009809|Ga0105089_1054289 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 628 | Open in IMG/M |
| 3300009810|Ga0105088_1010431 | Not Available | 1371 | Open in IMG/M |
| 3300009815|Ga0105070_1067223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
| 3300009818|Ga0105072_1079482 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 644 | Open in IMG/M |
| 3300010043|Ga0126380_10122210 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300010047|Ga0126382_10213702 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300010047|Ga0126382_11367448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 644 | Open in IMG/M |
| 3300010141|Ga0127499_1152804 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
| 3300010303|Ga0134082_10244143 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 743 | Open in IMG/M |
| 3300010322|Ga0134084_10321507 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 581 | Open in IMG/M |
| 3300010322|Ga0134084_10389577 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300010335|Ga0134063_10280656 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 798 | Open in IMG/M |
| 3300010358|Ga0126370_10005775 | All Organisms → cellular organisms → Bacteria | 6250 | Open in IMG/M |
| 3300010358|Ga0126370_12324056 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 531 | Open in IMG/M |
| 3300010359|Ga0126376_10734921 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300010361|Ga0126378_11254234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 838 | Open in IMG/M |
| 3300010366|Ga0126379_10606138 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300010376|Ga0126381_103836935 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010398|Ga0126383_10788381 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300010399|Ga0134127_10853550 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300011269|Ga0137392_11554207 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300011271|Ga0137393_10635839 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300012096|Ga0137389_10621591 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 928 | Open in IMG/M |
| 3300012206|Ga0137380_10010546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8378 | Open in IMG/M |
| 3300012207|Ga0137381_11471552 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
| 3300012355|Ga0137369_10073143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2895 | Open in IMG/M |
| 3300012363|Ga0137390_11964115 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012582|Ga0137358_10323158 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300012907|Ga0157283_10352754 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 530 | Open in IMG/M |
| 3300012917|Ga0137395_10025867 | All Organisms → cellular organisms → Bacteria | 3481 | Open in IMG/M |
| 3300012918|Ga0137396_11162162 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 547 | Open in IMG/M |
| 3300012922|Ga0137394_10422209 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300012925|Ga0137419_10199246 | Not Available | 1481 | Open in IMG/M |
| 3300012929|Ga0137404_10061955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2905 | Open in IMG/M |
| 3300012948|Ga0126375_10791512 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 750 | Open in IMG/M |
| 3300012971|Ga0126369_12506141 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 601 | Open in IMG/M |
| 3300012976|Ga0134076_10587621 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 518 | Open in IMG/M |
| 3300014154|Ga0134075_10440603 | Not Available | 578 | Open in IMG/M |
| 3300014265|Ga0075314_1075164 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 698 | Open in IMG/M |
| 3300015241|Ga0137418_10144554 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300015358|Ga0134089_10024203 | All Organisms → cellular organisms → Bacteria | 2099 | Open in IMG/M |
| 3300015374|Ga0132255_102311430 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 820 | Open in IMG/M |
| 3300016422|Ga0182039_10890413 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300017656|Ga0134112_10449283 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
| 3300017657|Ga0134074_1292389 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
| 3300018032|Ga0187788_10027849 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1836 | Open in IMG/M |
| 3300018074|Ga0184640_10424462 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300018089|Ga0187774_10073635 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1602 | Open in IMG/M |
| 3300018433|Ga0066667_10484551 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1016 | Open in IMG/M |
| 3300018433|Ga0066667_10652349 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 880 | Open in IMG/M |
| 3300018433|Ga0066667_12332388 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300019361|Ga0173482_10540299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 574 | Open in IMG/M |
| 3300019458|Ga0187892_10333370 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300020580|Ga0210403_10199515 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300021080|Ga0210382_10512152 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300021560|Ga0126371_11582656 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300025791|Ga0210115_1078766 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 680 | Open in IMG/M |
| 3300025911|Ga0207654_10183825 | Not Available | 1365 | Open in IMG/M |
| 3300025922|Ga0207646_11001754 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 738 | Open in IMG/M |
| 3300025933|Ga0207706_11338217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 590 | Open in IMG/M |
| 3300026029|Ga0208002_1021567 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
| 3300026075|Ga0207708_11499734 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 592 | Open in IMG/M |
| 3300026324|Ga0209470_1145058 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300026324|Ga0209470_1170719 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300026497|Ga0257164_1069660 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 584 | Open in IMG/M |
| 3300026524|Ga0209690_1226372 | Not Available | 588 | Open in IMG/M |
| 3300026547|Ga0209156_10431653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
| 3300027273|Ga0209886_1022587 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300027643|Ga0209076_1146690 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 661 | Open in IMG/M |
| 3300027654|Ga0209799_1103898 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300027655|Ga0209388_1077924 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300027873|Ga0209814_10020674 | All Organisms → cellular organisms → Bacteria | 2666 | Open in IMG/M |
| 3300027873|Ga0209814_10517818 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300027874|Ga0209465_10637276 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
| 3300027875|Ga0209283_10190946 | Not Available | 1361 | Open in IMG/M |
| 3300027903|Ga0209488_10123274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1951 | Open in IMG/M |
| 3300027909|Ga0209382_10125191 | All Organisms → cellular organisms → Bacteria | 2995 | Open in IMG/M |
| 3300027909|Ga0209382_11239726 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 760 | Open in IMG/M |
| 3300027952|Ga0209889_1070902 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 713 | Open in IMG/M |
| 3300028536|Ga0137415_10622378 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 891 | Open in IMG/M |
| 3300030505|Ga0268245_10317468 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031720|Ga0307469_10503964 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300031720|Ga0307469_11240720 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 706 | Open in IMG/M |
| 3300031740|Ga0307468_100415934 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300031764|Ga0318535_10137718 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300031779|Ga0318566_10106288 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300031799|Ga0318565_10020965 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2870 | Open in IMG/M |
| 3300031831|Ga0318564_10286709 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 728 | Open in IMG/M |
| 3300031879|Ga0306919_10072940 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300031903|Ga0307407_11643726 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300032025|Ga0318507_10462698 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
| 3300032068|Ga0318553_10291351 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300032126|Ga0307415_102295665 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 529 | Open in IMG/M |
| 3300032180|Ga0307471_100175394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2106 | Open in IMG/M |
| 3300032205|Ga0307472_100093780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2042 | Open in IMG/M |
| 3300032205|Ga0307472_100727252 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.30% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.65% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.32% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.32% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.66% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.66% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.66% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.66% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026029 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030505 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_08379011 | 3300000033 | Soil | MAPERITLKDPARFRDPANLTWERYIELQARERERYLAERAAIPAEALAYRTVGPRYLER |
| Ga0062593_1003438503 | 3300004114 | Soil | MAPERITLKDPTRFRDPANLTWERYIALQARERERYLAERAAIPPEALAYR |
| Ga0066395_100623221 | 3300004633 | Tropical Forest Soil | MARKRLVLKNTALFVDPANLSWERYVTMQARERERYLAERATIPDDALSYKTVSPRYLEN |
| Ga0066677_100361871 | 3300005171 | Soil | MARSITLKHPERFKDPANLTWERYVALQARERERYLAERATIP |
| Ga0066677_104535561 | 3300005171 | Soil | MARTITLKHPERFKDPANLTWERYVALQARERERYLAERATIP |
| Ga0066680_102645661 | 3300005174 | Soil | MAHAPIVLNDPGRFKDPANLTWERYIALQTRERERYLTERATIPQGALDFTTV |
| Ga0066685_108985752 | 3300005180 | Soil | MARRTIGLEDPSRFKDPAGLTWEPHIGLQARERERYLAERA |
| Ga0066676_108406851 | 3300005186 | Soil | MARQRLVLKDPGRFSDPANLTWERYVALQARERERYLAERATI |
| Ga0065705_105288962 | 3300005294 | Switchgrass Rhizosphere | MARKRLVLKDPGRFSDPANLTWERYVALQARERERYLAERATISPEALSYR |
| Ga0066388_1057819161 | 3300005332 | Tropical Forest Soil | MARRRVTLNDPSRFKDPSNLSWERYIALQARERERYLAERDALPPAALDFSGVKPGYLER |
| Ga0068869_1004129521 | 3300005334 | Miscanthus Rhizosphere | MAPERITLKDPTRFRDPANLTWERYIALQARERERYLAERAAIPPEALAYRTVSPRYVER |
| Ga0070669_1011824422 | 3300005353 | Switchgrass Rhizosphere | MARPRVELKDPSRFKDPANLTFERYIALQARERERYQAERAALPAEALEFRTVSPRYLER |
| Ga0070694_1013141881 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MASQRLTLEDPTRFKDPAGLTWERYVALQARERERYLAERAAIPAEALAYRTVS |
| Ga0070708_1002236491 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MARERLTLRDTSRFKDPAGLTWERYVALQARERERYLAERAALPAEALAFR |
| Ga0066689_109353121 | 3300005447 | Soil | MASQRLTLNDPTRFKDPAGLTWERYIALQARERERYLAER |
| Ga0070707_1011850512 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPERITLKDPARFRDPANLTWERYIELQARERERYLAERAAIPAEALAYKTVGPRY |
| Ga0070741_104665553 | 3300005529 | Surface Soil | MSRRRIVLKDPGLFKDPANLSWERYVALQARERERYLAERATLPQEALEYRSVSRRY |
| Ga0070697_1001299391 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MARTITLKHPERFKDPANLTWERYVALQARERERYLAERATIPA |
| Ga0070697_1004038631 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MARQRLTLRDTSRFKDPAGLTWERYVALQARERERYLAERAALP |
| Ga0070695_1017866711 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MARKRLVLKNTGLFSDPANLSWERYVSMQARERERYLAERTSIPDDAL |
| Ga0066698_107883661 | 3300005558 | Soil | MVRRTIGLEDPSRFKDPAGLTWERYIGLQARERERYLAERA |
| Ga0066700_104445621 | 3300005559 | Soil | MARTITLKNPERFKDPANLTWERYVALQARERERYLAERASIPADALAY |
| Ga0066699_108878892 | 3300005561 | Soil | MLRKPITLKDPGRFKDPANLTWERYVALQARERERY |
| Ga0066702_100225011 | 3300005575 | Soil | MARTITLKHPERFKDPANLTWERYVALQARERERYLA |
| Ga0066691_107272452 | 3300005586 | Soil | MARQRQRLVLKDPGRFSDPANLTWERYVALQARERERYLAERATIS |
| Ga0068859_1029312702 | 3300005617 | Switchgrass Rhizosphere | MARPRVELKDPSRFKDPANLTFERYIALQARERERYQAERAAIPDDVLNF |
| Ga0068864_1009986451 | 3300005618 | Switchgrass Rhizosphere | MAPERITLKDPARFRDPANLTWERYIALQARERDRYLAERGAIPPEALAFRTVGPRYVER |
| Ga0066905_1010580011 | 3300005713 | Tropical Forest Soil | MARKRLVLKNTALFSDPANLSWERYVMMQARERERYLTERGAIPDDAL |
| Ga0066903_1043766761 | 3300005764 | Tropical Forest Soil | MARKRLVLKNTALFVDPANLNWERYVTMQARERERYLVEKATI |
| Ga0075300_10488072 | 3300005876 | Rice Paddy Soil | MARARITLRNPERFKDPANLTWERYIALQARERERYLAERAAI |
| Ga0075298_10023832 | 3300005880 | Rice Paddy Soil | MARARITLRKPERFKDPANLTWERYIALQARERERYLAERAAI |
| Ga0075292_10267282 | 3300005887 | Rice Paddy Soil | MAGKRIVLTDPSRFKDPANLNWERYVALQARERERYLAEK |
| Ga0075024_1005475151 | 3300006047 | Watersheds | MARARITLREPERFKDPANLSWERYIALQARERERY |
| Ga0066665_108593502 | 3300006796 | Soil | MTRKRLVLKNTALFSEPANLSWERYVVMQARERERYLPERATIPDDALNYKTVSPPHLH |
| Ga0066660_115348411 | 3300006800 | Soil | MARQQISLKDPGRFKDPANLTWERYVALQARERERYLAERATIPADAMAYR |
| Ga0079220_110680902 | 3300006806 | Agricultural Soil | MARKRLVLNNTALFSDPANLSWERYVVMQARERERYLAERATIPDDALSYKTVS |
| Ga0075421_1017525072 | 3300006845 | Populus Rhizosphere | MARTITLKNPERFKDPANLTWERYVALQARERERYLAERATIPAEAMAYKTVSPRYLERA |
| Ga0075430_1003320562 | 3300006846 | Populus Rhizosphere | MARRHITLKDPSRFKDPAGLTWERYIALQARERERYLAERAAIPADALAFRSVSPRYLE |
| Ga0075430_1003712891 | 3300006846 | Populus Rhizosphere | MARTITLKNPERFKDPANLTWERYVALQARERERY |
| Ga0075431_1020097862 | 3300006847 | Populus Rhizosphere | MARKRIVLKDPTRFKDPANLTWERYVSLQARERERYLAE |
| Ga0075433_115794681 | 3300006852 | Populus Rhizosphere | MPHSRIVLNDPSRFKDPANLTWERYVALQARERERYLAER |
| Ga0079215_101567391 | 3300006894 | Agricultural Soil | MARTRIVLNDPSRFKDPANLSWERYVALQARERERYLAERAALPA |
| Ga0079215_103664401 | 3300006894 | Agricultural Soil | MARPRIVLRDPSRFKDPANLSWERYVALQARERERYLADRAALPEDALAYRTVSPRYL |
| Ga0075424_1018316242 | 3300006904 | Populus Rhizosphere | MAHTPIVLRDPGRFKDPANLTWERYIALQTRERERYLAERATIPQGALD |
| Ga0079216_103978951 | 3300006918 | Agricultural Soil | MATKRITLHDPTRFKDPANLSWERYVAMQARERERYLAEKATIPQEALEFKTVGPKYRERAI |
| Ga0075419_101820723 | 3300006969 | Populus Rhizosphere | MARTRIVLNDPSRFKDPANLSWERYVALQARERERYQAERAAL |
| Ga0099791_105479482 | 3300007255 | Vadose Zone Soil | MPSVRIVLRDPSRFKDPANLTWERYIALQARERERYLADRATIPPDAL |
| Ga0066710_1016829341 | 3300009012 | Grasslands Soil | MARSITLKHPERFKDPANLTWERYVALQARERERYLAERATIPA |
| Ga0066710_1016920082 | 3300009012 | Grasslands Soil | MQITLNDLSRFKDPASLTWERYVALQARERERYLAERAAIPAEAMAYQTVSRRYLE |
| Ga0066709_1040056432 | 3300009137 | Grasslands Soil | MRIELKDPSRFKDPANLTWERYITMQARERERYLAEKATIPD |
| Ga0099792_101095613 | 3300009143 | Vadose Zone Soil | MAETITLKNPERFKDPANLTWERYVALQARERERYLAE |
| Ga0114129_112833032 | 3300009147 | Populus Rhizosphere | MARRHITLKDPSRFKDPAGLTWERYIALQARERER |
| Ga0114129_126671462 | 3300009147 | Populus Rhizosphere | MARTITLKNPERFKDPANLTWERYVALQARERERYLAERATIPA |
| Ga0114129_133897532 | 3300009147 | Populus Rhizosphere | MARHTITLEDPSRFKDPAGLTWERYIALQARERERYLTERASLPPDVLAFRSVTPR |
| Ga0105071_10356491 | 3300009808 | Groundwater Sand | MARKKITLKDPSRFSDPANLTWERYVALQARERERYLAERAAIPPEALSYQTV |
| Ga0105089_10542891 | 3300009809 | Groundwater Sand | MARKRLVLKDPGRFSDPASLTWERYVAMQARERERYMAERAAISQDALNYKTVSPQYLER |
| Ga0105088_10104313 | 3300009810 | Groundwater Sand | MARKRLVLKDPGRFSDPAGLTWERYVAMQARERERYMAERAAISQDALNYK |
| Ga0105070_10672232 | 3300009815 | Groundwater Sand | MARKRLVLKDPGRFSDPASLTWERYVAMQARERERYMAERAAISQDALNYKT |
| Ga0105072_10794821 | 3300009818 | Groundwater Sand | MARKKITLKDPSLFADPANLTWERYVALQARERERYLAERATIPEDALNYK |
| Ga0126380_101222101 | 3300010043 | Tropical Forest Soil | MARKRLVLENPALFVDPANLSWERYVTMQARERERYLAERATISDDA |
| Ga0126382_102137022 | 3300010047 | Tropical Forest Soil | MARRRLVLKDTALFSDPASLSWERYVVMQARERERYLAERATIPDDALRY |
| Ga0126382_113674482 | 3300010047 | Tropical Forest Soil | MARKRLVLENTALFSDPASLSWERYVVMQARERERYLAERATIPDDALRY |
| Ga0127499_11528042 | 3300010141 | Grasslands Soil | MARRRLVLKDPGRFSDPANLTWERYVALQARERERYLAERATISPEALSY |
| Ga0134082_102441432 | 3300010303 | Grasslands Soil | MAHAPIVLNDPGRFKDPANLTWERYIALQTRERERYLAERATIPQDALDFKSVNPRYLER |
| Ga0134084_103215071 | 3300010322 | Grasslands Soil | MARQQITLNDPSRFKDPANLTWERYVALQARERERYLAERAAIPADAMAYQ |
| Ga0134084_103895771 | 3300010322 | Grasslands Soil | MARRTIGLEDPSRFKDPAGLTWERYIALQARERERYLAERAAIPADAL |
| Ga0134063_102806562 | 3300010335 | Grasslands Soil | MARQQITLNDPSRFKDPANLTWERYVALQARERERYLADRAAI |
| Ga0126370_100057759 | 3300010358 | Tropical Forest Soil | MARKRLVLKNTALFVDPANLNWERYVTMQARERERYLAERATIPD |
| Ga0126370_123240561 | 3300010358 | Tropical Forest Soil | MARERLTLRDTSRFKDPAGLTWERYVALQARERERYLAERAALPAEALAFRTVSPHYLDR |
| Ga0126376_107349211 | 3300010359 | Tropical Forest Soil | MARKPLVLKNTALFVDPANLSWERYVTMQARERERYLAERATISDDALN |
| Ga0126378_112542342 | 3300010361 | Tropical Forest Soil | MLERLILRDPALFKDPANLSWERYVALQARERERYQAARAALPADA |
| Ga0126379_106061381 | 3300010366 | Tropical Forest Soil | MARKRLVLKNTLLFVDPANLSWERYVTMQARERER |
| Ga0126381_1038369352 | 3300010376 | Tropical Forest Soil | MARTITLKTPERFKDPANLTWERYVALQARERERYLAERATIPAEAMAYKTVSPRYLERA |
| Ga0126383_107883811 | 3300010398 | Tropical Forest Soil | MARKRLVLKDPGRFSDPANLSWERYIALQARERERYLAERATISPEALSYRT |
| Ga0134127_108535502 | 3300010399 | Terrestrial Soil | MARKRLVLKNTGLFSDPANLSWERYVSMQARERERYLAER |
| Ga0137392_115542072 | 3300011269 | Vadose Zone Soil | MATERLTLKDPSRFKDPAGLTWERYIALQARERERYLA |
| Ga0137393_106358392 | 3300011271 | Vadose Zone Soil | MARRQITLRDPSRFKDPAGLTWERYIALQARERERYLAERALIP |
| Ga0137389_106215911 | 3300012096 | Vadose Zone Soil | MPRLRIVLRDPSRFRDPANLTWERYIALQTRERERYLAERATIPQGAL |
| Ga0137380_100105469 | 3300012206 | Vadose Zone Soil | MAHAPIVLNDPGRFKDPANLTWERYIALQTRERERYLAERATIPQDALDF |
| Ga0137381_114715522 | 3300012207 | Vadose Zone Soil | MARKRLILKNTGLFSDPANLSWERYVSMQARERERYL |
| Ga0137369_100731431 | 3300012355 | Vadose Zone Soil | MARKRLVLKDPGRFSDPAGLTWERYIAMQARERERDMAERAAISQDV |
| Ga0137390_119641152 | 3300012363 | Vadose Zone Soil | MARVRISLREPGRFKDPANLNWERYIALQARERERYL |
| Ga0137358_103231581 | 3300012582 | Vadose Zone Soil | MARQRLVLKNTALFSDPANLSWERYVIMQARERERYLAERATIPADALNYKNVS |
| Ga0157283_103527541 | 3300012907 | Soil | MAPERITLKDPTRFRDPATLTWERYIALQARERERYLAERAAIPPEALAYRTVSPRY |
| Ga0137395_100258671 | 3300012917 | Vadose Zone Soil | MARVRISLREPGRFKDPANLNWERYIALQARERERYLADR |
| Ga0137396_111621621 | 3300012918 | Vadose Zone Soil | MARTITLKHPERFKDPANLTWERYVALQARERERYLAERATI |
| Ga0137394_104222091 | 3300012922 | Vadose Zone Soil | MARRRLVLKDPGRFSDPANLTWERYVALQARERERYLAERATISP |
| Ga0137419_101992463 | 3300012925 | Vadose Zone Soil | MARQRLVLKDPGRFSDPANLTWERYVALQARERERYLA |
| Ga0137404_100619554 | 3300012929 | Vadose Zone Soil | MARRRLVLKDPGRFSDPANLTWERYVALQARERERYLAERATISPEA |
| Ga0126375_107915122 | 3300012948 | Tropical Forest Soil | MPRYRIALRDPSRFRDPANLTWERYIVLQARERERYLAERD |
| Ga0126369_125061411 | 3300012971 | Tropical Forest Soil | MADKRLVLRDPARFKDPANLTWERYVALQARERERYHVERATLPAEALTF |
| Ga0134076_105876211 | 3300012976 | Grasslands Soil | MQITLNDLSRFKDPANLTWERYVALQARERERYLAERAAIPAEAMAYQT |
| Ga0134075_104406032 | 3300014154 | Grasslands Soil | MARKRITLENPALFSDPANLTWERYVALQARERERYLAERATIPQDALDYKDVSPRYLEN |
| Ga0075314_10751642 | 3300014265 | Natural And Restored Wetlands | MARPRIVLRDPNRFKDPANLSWERYVALQARERERYLAERATLPEDALAYRTVS |
| Ga0137418_101445541 | 3300015241 | Vadose Zone Soil | MARQRLVLKDPGRFSDPANLTWERYVALQARERERYLAERATISPEALSYRTVS |
| Ga0134089_100242031 | 3300015358 | Grasslands Soil | MARTITLKNPERFKDPASLTWERYVALQARERERYLAERASIPADAL |
| Ga0132255_1023114302 | 3300015374 | Arabidopsis Rhizosphere | MPRQEIRLRDPSRFKDPANLSWERYVALQARERERYLADRAAIP |
| Ga0182039_108904131 | 3300016422 | Soil | MARKRLVLKNTALFVDPANLSWERYVTMQARERERY |
| Ga0134112_104492832 | 3300017656 | Grasslands Soil | MARRRLVLKNTALFSDPANLSWERYVVMQARERERYLAER |
| Ga0134074_12923891 | 3300017657 | Grasslands Soil | VARKRLVLKDPGRFSDPAGLTWERYVAMQARERERYMAERAAISQDALNYKTVSQQY |
| Ga0187788_100278494 | 3300018032 | Tropical Peatland | MVTRITLRDPGRFRDPAGLAWERYIALQARERERYLAERAAI |
| Ga0184640_104244621 | 3300018074 | Groundwater Sediment | MARTRIVLKDPDRFKDPANLTWERYIALQARERERYLAERAAIPDDALAYRTVSPRYL |
| Ga0187774_100736353 | 3300018089 | Tropical Peatland | MARRRVVLKDPSRFRDPANLTWERYIALQARERARYLAERDGLPPGALD |
| Ga0066667_104845512 | 3300018433 | Grasslands Soil | MTRKQISLKDPGRFKDPANLTWERYVALQARERERYLAERATIPAEAMAY |
| Ga0066667_106523492 | 3300018433 | Grasslands Soil | MARTITLKNPERFKDPANLMWERYVALQARERERYLAERASIPADARAYRTV |
| Ga0066667_123323882 | 3300018433 | Grasslands Soil | MARKRLVLKNTALFNDPANLSWERYVVMQSRERERYLADRAN |
| Ga0173482_105402991 | 3300019361 | Soil | MARKRLVLRNTGLFSDPANLSWERYVSMQARERERYLAERASIPD |
| Ga0187892_103333701 | 3300019458 | Bio-Ooze | MARRKLVLKDLTRFRDPANLTWERYIALQARERERYLAERDALPPEALDFSGVKPGYLP |
| Ga0210403_101995151 | 3300020580 | Soil | MARARITLRRPERFKDPANLTWERYIALQARERERYLAERAAIPADALAYRTVGPRYPER |
| Ga0210382_105121521 | 3300021080 | Groundwater Sediment | MASPGVVLRDPDRFRDPANLSWERYIALQARERERH |
| Ga0126371_115826562 | 3300021560 | Tropical Forest Soil | MADKRLVLRDPALFKDPANLTWERYVALQARERERYHV |
| Ga0210115_10787662 | 3300025791 | Natural And Restored Wetlands | MARPRIVLRDPNRFKDPANLSWERYVALQARERERYLAER |
| Ga0207654_101838252 | 3300025911 | Corn Rhizosphere | MAPERITLKDPARFRDPANLTWERYIELQARERERYLAERAAIPAEALAYKTV |
| Ga0207646_110017541 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MARERLTLRDTSRFKDPAGLTWERYVALQARERERYLAERAALPAEALAFRTVSPRYL |
| Ga0207706_113382172 | 3300025933 | Corn Rhizosphere | MARKRLVLKDPGRFSDPANLTWERYVALQARERER |
| Ga0208002_10215671 | 3300026029 | Natural And Restored Wetlands | MARPRIVLRDPNRFKDPANLSWERYVALQARERERYLAERATLPEN |
| Ga0207708_114997341 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPERITLKDPARFRDPANLTWERYIALQARERERYLAER |
| Ga0209470_11450581 | 3300026324 | Soil | MARQRLVLKDPGRFSDPANLTWERYVALQARERERY |
| Ga0209470_11707191 | 3300026324 | Soil | MARKRLVLKNTALFSDPANLSWERYVVMQARERERYLAERATIPDDALNYKTV |
| Ga0257164_10696602 | 3300026497 | Soil | MARKRLVLKDPGRFSDPAGLTWERYVAMQARERERYM |
| Ga0209690_12263721 | 3300026524 | Soil | MRIELKDPSRFKDPANLTWERYITMQARERERYLAEKATIPDDVLNFKHVSPRYLTNA |
| Ga0209156_104316532 | 3300026547 | Soil | MARTITLKHPERFKDPANLTWERYVALQARERERYLAERATIPAD |
| Ga0209886_10225871 | 3300027273 | Groundwater Sand | MARKKITLKDPSRFVDPANLTWERYVAMQARERERYLAERAAIPEDTLNYKNVS |
| Ga0209076_11466902 | 3300027643 | Vadose Zone Soil | MARTITLTHPERFKDPANLTWERYVALQARERERYLAERATIPADALAYKTVSPR |
| Ga0209799_11038981 | 3300027654 | Tropical Forest Soil | MARTITLKHPERFKDPANLSWERYVALQARERERY |
| Ga0209388_10779241 | 3300027655 | Vadose Zone Soil | MARRRLVLKDPGRFSDPANLTWERYVALQARERERYLAERATISPEALSYRT |
| Ga0209814_100206741 | 3300027873 | Populus Rhizosphere | MARTITLKTPERFKDPANLTWERYVALQARERERYLAERATIPAEAMAYKTVSPRY |
| Ga0209814_105178182 | 3300027873 | Populus Rhizosphere | MGRTPIVLNDPSRFKDPANLSWERYVALQARERERYLAERAALPADALAYK |
| Ga0209465_106372762 | 3300027874 | Tropical Forest Soil | MARKRLVLKDPGRFSDPANLTWERYVALQARERERYLAERATISPEALSYRTVSPQYL |
| Ga0209283_101909463 | 3300027875 | Vadose Zone Soil | MARKRLVLKDPGRFSDPAGLTWERYVAMQARERERYMAER |
| Ga0209488_101232743 | 3300027903 | Vadose Zone Soil | MARKHIVLKNTGLFSDPANLTWERYVAMQARERERYMAERAAISQDALNFKTVSP |
| Ga0209382_101251911 | 3300027909 | Populus Rhizosphere | MARTQIVLNDPSRFKDPANLSWDRYVALQARERERYQAERAALPPAALTYE |
| Ga0209382_112397261 | 3300027909 | Populus Rhizosphere | MAQQRIVLKDPDRFKDPANLSWERYVALQARERERYLAERAALPPEALTYATVSPR |
| Ga0209889_10709021 | 3300027952 | Groundwater Sand | MARKPITLKDPGRFKDPANLTWERYVALQARERERYLAERATIPADALAYKTV |
| Ga0137415_106223781 | 3300028536 | Vadose Zone Soil | MARTITLKDPGRFKDPANLTWERYVALQARERERYLAERTAIPEDALNYRTVSPRYL |
| Ga0268245_103174682 | 3300030505 | Agave | MPRPRINLKDPSRFKDPANLSWERYVALQARERERYLTERAALPDDALSY |
| Ga0307469_105039641 | 3300031720 | Hardwood Forest Soil | MARRRLVLKDPGRFSDPANLSWERYVALQARERERYLAERATISPEALGYRTV |
| Ga0307469_112407201 | 3300031720 | Hardwood Forest Soil | MAPERITLKDPARFRDPANLTWERYIALQARERERYLAERAAIPPEALAYKTVGP |
| Ga0307468_1004159342 | 3300031740 | Hardwood Forest Soil | MARKRLVLKNTALFSDPANLSWERYVVMQARERERYLAE |
| Ga0318535_101377181 | 3300031764 | Soil | MARKRLVLENPALFVDPANLSWERYVTVQARERERYLAEK |
| Ga0318566_101062881 | 3300031779 | Soil | MARKRLVLENPALFVDPANLSWERYVTVQARERERYLAEKATISDDTLNYRHVSPRYLE |
| Ga0318565_100209653 | 3300031799 | Soil | MARKRLVLKNTALFVDPANLSWERYVTMQARERER |
| Ga0318564_102867091 | 3300031831 | Soil | MARKRLVLENPALFVDPANLSWERYVTVQARERERYLAEKAT |
| Ga0306919_100729403 | 3300031879 | Soil | MARKRLVLKNTALFVDPANLSWERYVTMQARERERYL |
| Ga0307407_116437262 | 3300031903 | Rhizosphere | MARTPIVLKDPSRFKDPANLSWERYIALQARERERY |
| Ga0318507_104626981 | 3300032025 | Soil | MARKRLVLENPALFVDPANLSWERYVTVQARERERYLAEKATISDDTLNYRHVSPR |
| Ga0318553_102913511 | 3300032068 | Soil | MARKRLVLKNKALFVDPANLSWERYVTMQARERERYLAERATISDDALNYRS |
| Ga0307415_1022956652 | 3300032126 | Rhizosphere | MARARVTLNDPSRFKDPANLSWERYVGLQARERERYLAERATIP |
| Ga0307471_1001753943 | 3300032180 | Hardwood Forest Soil | MAHAPIVLRDPGRFKDPANLTWERYIALQTRERERYLAERATIPQ |
| Ga0307472_1000937803 | 3300032205 | Hardwood Forest Soil | MARKRLVLKNTALFSDPANLSWERYVTMQARERERYLAERAAIPDDALNYRSVSPRY |
| Ga0307472_1007272521 | 3300032205 | Hardwood Forest Soil | MARKRLVLKDPGRFSDPANLTWERYVALQARERERY |
| ⦗Top⦘ |