| Basic Information | |
|---|---|
| Family ID | F046229 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 151 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 28.67 % |
| % of genes near scaffold ends (potentially truncated) | 43.71 % |
| % of genes from short scaffolds (< 2000 bps) | 76.82 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.781 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.218 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.517 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.358 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.67% β-sheet: 0.00% Coil/Unstructured: 41.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF02811 | PHP | 39.07 |
| PF07733 | DNA_pol3_alpha | 11.26 |
| PF00005 | ABC_tran | 9.93 |
| PF14579 | HHH_6 | 5.30 |
| PF12071 | DUF3551 | 4.64 |
| PF09084 | NMT1 | 2.65 |
| PF03129 | HGTP_anticodon | 2.65 |
| PF02687 | FtsX | 1.32 |
| PF03401 | TctC | 0.66 |
| PF00696 | AA_kinase | 0.66 |
| PF12704 | MacB_PCD | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 11.26 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 11.26 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.65 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 2.65 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.65 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.65 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.65 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.65 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.44 % |
| Unclassified | root | N/A | 16.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17191044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3411 | Open in IMG/M |
| 2189573000|GPBTN7E02I67EF | Not Available | 519 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10124732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 538 | Open in IMG/M |
| 3300001867|JGI12627J18819_10069065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1470 | Open in IMG/M |
| 3300001978|JGI24747J21853_1010863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 915 | Open in IMG/M |
| 3300002911|JGI25390J43892_10042666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1082 | Open in IMG/M |
| 3300002914|JGI25617J43924_10157629 | Not Available | 775 | Open in IMG/M |
| 3300004281|Ga0066397_10009698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1208 | Open in IMG/M |
| 3300004281|Ga0066397_10100739 | Not Available | 605 | Open in IMG/M |
| 3300004479|Ga0062595_100297730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1085 | Open in IMG/M |
| 3300004629|Ga0008092_11342316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 876 | Open in IMG/M |
| 3300004633|Ga0066395_10291044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 890 | Open in IMG/M |
| 3300004633|Ga0066395_10759327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
| 3300005148|Ga0066819_1014177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 609 | Open in IMG/M |
| 3300005163|Ga0066823_10090526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 614 | Open in IMG/M |
| 3300005165|Ga0066869_10017325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1052 | Open in IMG/M |
| 3300005167|Ga0066672_10017975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3632 | Open in IMG/M |
| 3300005167|Ga0066672_10213331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1234 | Open in IMG/M |
| 3300005168|Ga0066809_10218844 | Not Available | 521 | Open in IMG/M |
| 3300005169|Ga0066810_10023282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1050 | Open in IMG/M |
| 3300005330|Ga0070690_100164503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1523 | Open in IMG/M |
| 3300005332|Ga0066388_100709584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1611 | Open in IMG/M |
| 3300005332|Ga0066388_102379000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 960 | Open in IMG/M |
| 3300005332|Ga0066388_103107177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 848 | Open in IMG/M |
| 3300005332|Ga0066388_106200692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 603 | Open in IMG/M |
| 3300005332|Ga0066388_106998252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 567 | Open in IMG/M |
| 3300005333|Ga0070677_10589119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 614 | Open in IMG/M |
| 3300005335|Ga0070666_10312304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1120 | Open in IMG/M |
| 3300005340|Ga0070689_100123311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2071 | Open in IMG/M |
| 3300005353|Ga0070669_100024511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4325 | Open in IMG/M |
| 3300005441|Ga0070700_100016832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4169 | Open in IMG/M |
| 3300005447|Ga0066689_10020882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3205 | Open in IMG/M |
| 3300005456|Ga0070678_100759531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 878 | Open in IMG/M |
| 3300005471|Ga0070698_101398306 | Not Available | 650 | Open in IMG/M |
| 3300005540|Ga0066697_10064395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2097 | Open in IMG/M |
| 3300005544|Ga0070686_101349545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 597 | Open in IMG/M |
| 3300005548|Ga0070665_100619144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1096 | Open in IMG/M |
| 3300005713|Ga0066905_102010393 | Not Available | 536 | Open in IMG/M |
| 3300005764|Ga0066903_105387235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| 3300005764|Ga0066903_105642396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 658 | Open in IMG/M |
| 3300005981|Ga0081538_10013903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 6342 | Open in IMG/M |
| 3300006038|Ga0075365_10235490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1286 | Open in IMG/M |
| 3300006042|Ga0075368_10090709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1250 | Open in IMG/M |
| 3300006844|Ga0075428_101573434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 688 | Open in IMG/M |
| 3300006871|Ga0075434_100286318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1667 | Open in IMG/M |
| 3300006881|Ga0068865_101933593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 535 | Open in IMG/M |
| 3300006914|Ga0075436_100217712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1354 | Open in IMG/M |
| 3300009088|Ga0099830_10023082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4084 | Open in IMG/M |
| 3300009137|Ga0066709_100830554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1341 | Open in IMG/M |
| 3300009143|Ga0099792_10024024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 2754 | Open in IMG/M |
| 3300009147|Ga0114129_11180620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 954 | Open in IMG/M |
| 3300009162|Ga0075423_11481960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium | 728 | Open in IMG/M |
| 3300009176|Ga0105242_13162486 | Not Available | 511 | Open in IMG/M |
| 3300010046|Ga0126384_10242118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1453 | Open in IMG/M |
| 3300010046|Ga0126384_10769584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 859 | Open in IMG/M |
| 3300010048|Ga0126373_10128092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2384 | Open in IMG/M |
| 3300010358|Ga0126370_10301669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1271 | Open in IMG/M |
| 3300010359|Ga0126376_13259289 | Not Available | 502 | Open in IMG/M |
| 3300010366|Ga0126379_12305072 | Not Available | 639 | Open in IMG/M |
| 3300010375|Ga0105239_10155458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2554 | Open in IMG/M |
| 3300010376|Ga0126381_102375776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300010396|Ga0134126_11736918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae | 685 | Open in IMG/M |
| 3300010398|Ga0126383_10613353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1160 | Open in IMG/M |
| 3300012189|Ga0137388_10151992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2051 | Open in IMG/M |
| 3300012202|Ga0137363_10290147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1340 | Open in IMG/M |
| 3300012204|Ga0137374_10132427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2266 | Open in IMG/M |
| 3300012205|Ga0137362_10223043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1626 | Open in IMG/M |
| 3300012206|Ga0137380_10052149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3751 | Open in IMG/M |
| 3300012207|Ga0137381_10482171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1082 | Open in IMG/M |
| 3300012354|Ga0137366_10528655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 850 | Open in IMG/M |
| 3300012361|Ga0137360_10600015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 942 | Open in IMG/M |
| 3300012469|Ga0150984_118853320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 734 | Open in IMG/M |
| 3300012948|Ga0126375_10856450 | Not Available | 726 | Open in IMG/M |
| 3300012951|Ga0164300_10029678 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → PX clade → Phaeophyceae → Ectocarpales → Ectocarpaceae → Ectocarpus → unclassified Ectocarpus → Ectocarpus sp. CCAP 1310/34 | 1994 | Open in IMG/M |
| 3300012961|Ga0164302_11783124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 519 | Open in IMG/M |
| 3300012988|Ga0164306_11454406 | Not Available | 585 | Open in IMG/M |
| 3300012989|Ga0164305_10861399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 757 | Open in IMG/M |
| 3300015373|Ga0132257_103175189 | Not Available | 598 | Open in IMG/M |
| 3300016294|Ga0182041_10159416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1752 | Open in IMG/M |
| 3300016319|Ga0182033_10051260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2797 | Open in IMG/M |
| 3300016371|Ga0182034_10381881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1151 | Open in IMG/M |
| 3300016387|Ga0182040_10019023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3766 | Open in IMG/M |
| 3300016445|Ga0182038_11862024 | Not Available | 543 | Open in IMG/M |
| 3300018077|Ga0184633_10145277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1230 | Open in IMG/M |
| 3300018081|Ga0184625_10009481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4461 | Open in IMG/M |
| 3300018431|Ga0066655_10924076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300018482|Ga0066669_10051992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2594 | Open in IMG/M |
| 3300019356|Ga0173481_10226028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 828 | Open in IMG/M |
| 3300019876|Ga0193703_1008511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1524 | Open in IMG/M |
| 3300020016|Ga0193696_1125980 | Not Available | 646 | Open in IMG/M |
| 3300021361|Ga0213872_10005274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6683 | Open in IMG/M |
| 3300021444|Ga0213878_10001371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 8714 | Open in IMG/M |
| 3300021560|Ga0126371_11278764 | Not Available | 868 | Open in IMG/M |
| 3300025321|Ga0207656_10009251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 3655 | Open in IMG/M |
| 3300025923|Ga0207681_10121224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1918 | Open in IMG/M |
| 3300025936|Ga0207670_10945799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 723 | Open in IMG/M |
| 3300025960|Ga0207651_11895343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 536 | Open in IMG/M |
| 3300026023|Ga0207677_10020821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3993 | Open in IMG/M |
| 3300026041|Ga0207639_10023510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4451 | Open in IMG/M |
| 3300026075|Ga0207708_10000532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 29369 | Open in IMG/M |
| 3300026075|Ga0207708_11131185 | Not Available | 683 | Open in IMG/M |
| 3300026088|Ga0207641_10007756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 8920 | Open in IMG/M |
| 3300026319|Ga0209647_1003303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12533 | Open in IMG/M |
| 3300026482|Ga0257172_1011000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1491 | Open in IMG/M |
| 3300027523|Ga0208890_1020798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 943 | Open in IMG/M |
| 3300027548|Ga0209523_1049884 | Not Available | 856 | Open in IMG/M |
| 3300027646|Ga0209466_1030377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1108 | Open in IMG/M |
| 3300027787|Ga0209074_10481187 | Not Available | 535 | Open in IMG/M |
| 3300027866|Ga0209813_10047362 | Not Available | 1331 | Open in IMG/M |
| 3300027874|Ga0209465_10154334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1140 | Open in IMG/M |
| 3300028704|Ga0307321_1074965 | Not Available | 665 | Open in IMG/M |
| 3300028755|Ga0307316_10039085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 1571 | Open in IMG/M |
| 3300028787|Ga0307323_10027363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1970 | Open in IMG/M |
| 3300028790|Ga0307283_10026522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1263 | Open in IMG/M |
| 3300028824|Ga0307310_10257522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 840 | Open in IMG/M |
| 3300028875|Ga0307289_10336442 | Not Available | 621 | Open in IMG/M |
| 3300028881|Ga0307277_10000073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 29909 | Open in IMG/M |
| 3300030336|Ga0247826_11772197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 505 | Open in IMG/M |
| 3300031543|Ga0318516_10017056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3636 | Open in IMG/M |
| 3300031544|Ga0318534_10171749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 1253 | Open in IMG/M |
| 3300031545|Ga0318541_10072047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1814 | Open in IMG/M |
| 3300031546|Ga0318538_10026257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2666 | Open in IMG/M |
| 3300031546|Ga0318538_10053053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1987 | Open in IMG/M |
| 3300031546|Ga0318538_10092825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1548 | Open in IMG/M |
| 3300031549|Ga0318571_10119281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 883 | Open in IMG/M |
| 3300031573|Ga0310915_10454202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 910 | Open in IMG/M |
| 3300031573|Ga0310915_10867081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
| 3300031682|Ga0318560_10242136 | Not Available | 968 | Open in IMG/M |
| 3300031723|Ga0318493_10677299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 577 | Open in IMG/M |
| 3300031748|Ga0318492_10567732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 604 | Open in IMG/M |
| 3300031779|Ga0318566_10273524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 837 | Open in IMG/M |
| 3300031833|Ga0310917_10090336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1955 | Open in IMG/M |
| 3300031835|Ga0318517_10230471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 835 | Open in IMG/M |
| 3300031846|Ga0318512_10041117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2028 | Open in IMG/M |
| 3300031890|Ga0306925_11142223 | Not Available | 784 | Open in IMG/M |
| 3300031896|Ga0318551_10404909 | Not Available | 776 | Open in IMG/M |
| 3300031943|Ga0310885_10359215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 767 | Open in IMG/M |
| 3300031954|Ga0306926_10726440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1202 | Open in IMG/M |
| 3300031981|Ga0318531_10130757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1117 | Open in IMG/M |
| 3300032010|Ga0318569_10085642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1409 | Open in IMG/M |
| 3300032013|Ga0310906_10309143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 1012 | Open in IMG/M |
| 3300032039|Ga0318559_10029216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2188 | Open in IMG/M |
| 3300032039|Ga0318559_10275632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 780 | Open in IMG/M |
| 3300032064|Ga0318510_10053110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1439 | Open in IMG/M |
| 3300032064|Ga0318510_10323253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 646 | Open in IMG/M |
| 3300032066|Ga0318514_10021541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2932 | Open in IMG/M |
| 3300032075|Ga0310890_11798614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 509 | Open in IMG/M |
| 3300032174|Ga0307470_10120101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1550 | Open in IMG/M |
| 3300033290|Ga0318519_10008105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4142 | Open in IMG/M |
| 3300034150|Ga0364933_137012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium | 630 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.65% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.66% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.66% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.66% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03355320 | 2088090014 | Soil | MNYVHLSFRGWELGVMVRAVVEEAATLASLALFLGMVAIWAQVIAAL |
| N55_04829420 | 2189573000 | Grass Soil | MEHIMNYVHPLFRGWGVGVMVRAVVEEAATLASLALFLGTVAIWAQVIATL |
| INPhiseqgaiiFebDRAFT_1015597442 | 3300000364 | Soil | VGTSLPAPVIDLEHNMNYIHASFFDVEWVGMVRAVVEEAATLASLALFLGMVAIWAQVIATL* |
| AF_2010_repII_A001DRAFT_101247322 | 3300000793 | Forest Soil | RDSVALTSEHSMNYVHFLFRSWGVGVMVRAVVEDAATLASLALFLGMVAIWAQVIATL* |
| JGI12627J18819_100690651 | 3300001867 | Forest Soil | MNYVHGLFLWSGEWEIMVRALVEEAATLASLALFLGMIAIW |
| JGI24747J21853_10108631 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | HVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| JGI25390J43892_100426662 | 3300002911 | Grasslands Soil | YVHGLFLSSGEWVMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| JGI25617J43924_101576291 | 3300002914 | Grasslands Soil | MNYVHGLFLSSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066397_100096983 | 3300004281 | Tropical Forest Soil | MNYVLVLFLSVGVVTMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066397_101007391 | 3300004281 | Tropical Forest Soil | MNYVHVLFLSVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0062595_1002977302 | 3300004479 | Soil | MNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0008092_113423162 | 3300004629 | Tropical Rainforest Soil | DSEHTGHGFGRTGPPALDLEHSMNYVHDLFLLVGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066395_102910441 | 3300004633 | Tropical Forest Soil | MNYVHFLFRSWGVGVMVRAVVEDAATLASLALFLGMVAIWAQVIATL* |
| Ga0066395_107593271 | 3300004633 | Tropical Forest Soil | MNYVHGLFLSVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066819_10141772 | 3300005148 | Soil | LTLERIMNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066823_100905261 | 3300005163 | Soil | LTLERNMNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066869_100173252 | 3300005165 | Soil | MNYVHVLFLLLRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066672_100179752 | 3300005167 | Soil | MNYVHGLFLSSGEWVMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066672_102133312 | 3300005167 | Soil | MNYVHVPFRSWELVSMVRAVVEEAATLASLALFLGMVAIWAHVIATL* |
| Ga0066809_102188442 | 3300005168 | Soil | MNYVHVLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066810_100232822 | 3300005169 | Soil | NYVHGLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0070690_1001645031 | 3300005330 | Switchgrass Rhizosphere | LTLERIMNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIA |
| Ga0066388_1007095842 | 3300005332 | Tropical Forest Soil | MHLGAPHQTRPRPLDCEHIMNYVHDLFTSSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066388_1023790002 | 3300005332 | Tropical Forest Soil | LTLEHSMNYVHSLFRGRGVGVMVRAVVEEAATLASLALFLGMVAIWAQVIATL* |
| Ga0066388_1031071772 | 3300005332 | Tropical Forest Soil | MNYVHVLFLSVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL*SA |
| Ga0066388_1062006922 | 3300005332 | Tropical Forest Soil | VHGLFLSVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066388_1069982521 | 3300005332 | Tropical Forest Soil | MNYVHGLFLLVGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0070677_105891191 | 3300005333 | Miscanthus Rhizosphere | MNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWA |
| Ga0070666_103123041 | 3300005335 | Switchgrass Rhizosphere | MNYVHGLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0070689_1001233112 | 3300005340 | Switchgrass Rhizosphere | LTLEQNMNYVHGLFSLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0070669_1000245115 | 3300005353 | Switchgrass Rhizosphere | MNYVHVLFLLLESWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0070700_1000168322 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MNYVHVLFLLLGSCIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066689_100208822 | 3300005447 | Soil | MNYVHVPFRSWELVSMVRAVVEEAATLASLALFLGMVAIWAQVIATL* |
| Ga0070678_1007595311 | 3300005456 | Miscanthus Rhizosphere | LTLERIMNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQV |
| Ga0070698_1013983061 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLGAPNQTRPSALDCEHIMNYVHGLFLWSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066697_100643953 | 3300005540 | Soil | MNYVHVPFRSWELVSMVRAVVEEAVTLASLALFLGMVAIWAHVIATL* |
| Ga0070686_1013495452 | 3300005544 | Switchgrass Rhizosphere | RLTLEHSMNYVHGLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0070665_1006191442 | 3300005548 | Switchgrass Rhizosphere | MNYVHGLFFLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066905_1020103932 | 3300005713 | Tropical Forest Soil | LDPVDPGAIYPLDCEHSMNYVHVLFLSVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066903_1053872352 | 3300005764 | Tropical Forest Soil | MNYVHGLFLSSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIA |
| Ga0066903_1056423962 | 3300005764 | Tropical Forest Soil | MNYVHGLFRGGEWEIMVRALVEEAATLASLALFLGMLAIWAQVIATL* |
| Ga0081538_100139035 | 3300005981 | Tabebuia Heterophylla Rhizosphere | LQQDSALTDEQIMNYVRCLFLGEGWVMVRAVIAEAATLASLALFLGTIAIWAQVIAAL* |
| Ga0075365_102354901 | 3300006038 | Populus Endosphere | MNYIHGLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0075368_100907092 | 3300006042 | Populus Endosphere | MNYIHGLFLVLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVFATL* |
| Ga0075428_1015734342 | 3300006844 | Populus Rhizosphere | MNYVLLLFCIGREDMFRALIEEAAALASLALFLGMIAIWAQIVATLGHVPEAWG* |
| Ga0075434_1002863182 | 3300006871 | Populus Rhizosphere | LTREHIMNYVHLSFRGWELGVMVRAVVEEAATLASLALFLGMVAIWAQVIAAL* |
| Ga0068865_1019335931 | 3300006881 | Miscanthus Rhizosphere | TLEHSMNYVHGLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0075436_1002177121 | 3300006914 | Populus Rhizosphere | YVHGLFLSSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0099830_100230823 | 3300009088 | Vadose Zone Soil | MNYVHVLFLCSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066709_1008305541 | 3300009137 | Grasslands Soil | MNYVHGLFLLVGVVTMVQALVEEAATLASLALFLGMIAIWAQIIATL* |
| Ga0099792_100240241 | 3300009143 | Vadose Zone Soil | PLDCEHIMNYVHVLFLCSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0114129_111806203 | 3300009147 | Populus Rhizosphere | MNYVHGLFLLVGVVTMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0075423_114819602 | 3300009162 | Populus Rhizosphere | MKYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0105242_131624862 | 3300009176 | Miscanthus Rhizosphere | VLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWVQVIATL* |
| Ga0126384_102421182 | 3300010046 | Tropical Forest Soil | MNYVHALFLSWGSTDRRGGVLIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0126384_107695843 | 3300010046 | Tropical Forest Soil | MNYVHVSFSSVGVVTMVRALVEEAATLASLALFLGMIAIWAQ |
| Ga0126373_101280923 | 3300010048 | Tropical Forest Soil | MNYVHDLFLGGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0126370_103016691 | 3300010358 | Tropical Forest Soil | MNYVHGLFLSVGVMIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0126376_132592891 | 3300010359 | Tropical Forest Soil | MNYVHVLFLSVGSSIMVRALVEEAAALASLALFLGMIAIWAQV |
| Ga0126379_123050722 | 3300010366 | Tropical Forest Soil | MNYVHVLFFSVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0105239_101554581 | 3300010375 | Corn Rhizosphere | MNYVHVLFLLLRSWIMVRAVVEEAATLASLALFLG |
| Ga0126381_1023757762 | 3300010376 | Tropical Forest Soil | MNYVHGLFLSVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIAT |
| Ga0134126_117369182 | 3300010396 | Terrestrial Soil | MNYVHLSFRGWELGVMVRAVVEEAATLASLALFLGMVAIWAQVIAAL* |
| Ga0126383_106133532 | 3300010398 | Tropical Forest Soil | MNYVHGLFLSVGVSDMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0137388_101519921 | 3300012189 | Vadose Zone Soil | MNYVHVLFLCSGEWEIMVRALVEEAATLASLALFLG |
| Ga0137363_102901472 | 3300012202 | Vadose Zone Soil | MNYVHDLFSLVGVVTMVRALVEEAATLASLALFLGMIAIWAHVIATL* |
| Ga0137374_101324272 | 3300012204 | Vadose Zone Soil | MNYVHVLFWPVGVVTMVRALVEEAATLASLALFLGMIAIWAHVIATL* |
| Ga0137362_102230434 | 3300012205 | Vadose Zone Soil | MNYVHDLFLSSGEWVMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0137380_100521494 | 3300012206 | Vadose Zone Soil | MNYVHGLFLLVGVVTMVRALVEEAATLASLALFLGMIAIWAHVIATL* |
| Ga0137381_104821711 | 3300012207 | Vadose Zone Soil | MNYVHVPFRPWELVSIVRAVVEEAATLASLALFLGMVAIWAQVIATL* |
| Ga0137366_105286553 | 3300012354 | Vadose Zone Soil | MNYVHGLFLLVGVVTMVRALVEEAATLASLALFLGMIAIWAHVI |
| Ga0137360_106000151 | 3300012361 | Vadose Zone Soil | MNYVHDLFSLVGVVTMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0150984_1188533202 | 3300012469 | Avena Fatua Rhizosphere | IMNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0126375_108564501 | 3300012948 | Tropical Forest Soil | MNYVHVLFLAVGVVIIVRALVEEAATLASLALFLGMI |
| Ga0164300_100296781 | 3300012951 | Soil | MNYVHLSFRGWELGVMARAVVEEAATLASLALFLGMVAIWAQVIAAL* |
| Ga0164302_117831242 | 3300012961 | Soil | LERNMNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0164306_114544061 | 3300012988 | Soil | MNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAI |
| Ga0164305_108613991 | 3300012989 | Soil | MNYIHDLFLSSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0132257_1031751891 | 3300015373 | Arabidopsis Rhizosphere | MNYVHGLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAHVIATI* |
| Ga0182041_101594161 | 3300016294 | Soil | MNYVHDLFLGGEWEIMVRALVEEAATLASLALFLGMIAIWAQ |
| Ga0182033_100512602 | 3300016319 | Soil | MNYVHDLFLGGEWEIVVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0182034_103818813 | 3300016371 | Soil | VCPNQTLALDCEHIMNYVHDLFLEGEWEIMVRALVEEAATLASLALFLGM |
| Ga0182040_100190231 | 3300016387 | Soil | SMNYVHDLFLPVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0182038_118620241 | 3300016445 | Soil | MNYVHDLFLPVGVVIMVRALVEEAAALASLALFLGMIAIWAQVIATL |
| Ga0184633_101452772 | 3300018077 | Groundwater Sediment | MNYVHVLFLLLGSWTMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0184625_100094815 | 3300018081 | Groundwater Sediment | MNYVHVLFCRVELNMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0066655_109240762 | 3300018431 | Grasslands Soil | MNYVHVPFRSWELVSMVRAVIEEAATLASLALFLGMVAIWAHVIATL |
| Ga0066669_100519922 | 3300018482 | Grasslands Soil | MNYVHVPFRSWELVSMVRAVVEEAATLASLALFLGMVAIWAHVIATL |
| Ga0173481_102260281 | 3300019356 | Soil | RIMNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0193703_10085111 | 3300019876 | Soil | MNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0193696_11259801 | 3300020016 | Soil | MNYVHVLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0213872_100052746 | 3300021361 | Rhizosphere | MNYVHDLFLSSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0213878_100013712 | 3300021444 | Bulk Soil | MNYVHGLFQSSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0126371_112787643 | 3300021560 | Tropical Forest Soil | MNYVHDLFLGGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0207656_100092512 | 3300025321 | Corn Rhizosphere | MNYVHVLFLLLRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0207681_101212242 | 3300025923 | Switchgrass Rhizosphere | MNYVHVLFLLLESWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0207670_109457991 | 3300025936 | Switchgrass Rhizosphere | LFLLLRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0207651_118953431 | 3300025960 | Switchgrass Rhizosphere | HGLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0207677_100208213 | 3300026023 | Miscanthus Rhizosphere | DPMSLTLERIMNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0207639_100235101 | 3300026041 | Corn Rhizosphere | MNYVHVLFWLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0207708_100005321 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LTLERIMNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0207708_111311852 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MNYVHVLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIANL |
| Ga0207641_100077561 | 3300026088 | Switchgrass Rhizosphere | SLTLERIMNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0209647_100330312 | 3300026319 | Grasslands Soil | MNYVHGLFLSSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0257172_10110001 | 3300026482 | Soil | EHIMNYVHVLFLCSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0208890_10207982 | 3300027523 | Soil | LFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0209523_10498841 | 3300027548 | Forest Soil | MNYVHGLFLWSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0209466_10303772 | 3300027646 | Tropical Forest Soil | PVDPGAIYPLDCEHSMNYVHVLFLSVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0209074_104811871 | 3300027787 | Agricultural Soil | LTSEHSMNYVHFLFHSSGVGVMVRAGVEDAATLASLALFLGMVAIWARVIATL |
| Ga0209813_100473622 | 3300027866 | Populus Endosphere | MNYIHGLFLVLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVFATL |
| Ga0209465_101543341 | 3300027874 | Tropical Forest Soil | MNYVHGLFLSVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0307321_10749652 | 3300028704 | Soil | SMNYVHVLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0307316_100390852 | 3300028755 | Soil | RIENYVPFLFSSVGKKVMIRAVVEEAATLASLALFLGMIAIWAKVIAALLTTPTL |
| Ga0307323_100273632 | 3300028787 | Soil | PLTLEQTMNYVHVLFLLLGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0307283_100265223 | 3300028790 | Soil | MNYVHVLFLLPGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0307310_102575221 | 3300028824 | Soil | MNYVHFSFRVWELDVMVRAVVEEAATLASLALFLGMVAIWAQVIAAL |
| Ga0307289_103364421 | 3300028875 | Soil | VHVLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0307277_100000734 | 3300028881 | Soil | LTREHIMNYVHLSFRGWELGVMVRAVVEEAATLASLALFLGMVAIWAQVIAAL |
| Ga0247826_117721972 | 3300030336 | Soil | TMNYVHVLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318516_100170562 | 3300031543 | Soil | MNYVHDLFLEGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318534_101717492 | 3300031544 | Soil | VCPNQTLALDCEHIMNYVHDLFLEGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIAT |
| Ga0318541_100720472 | 3300031545 | Soil | MNYVHGLFSSVGAMTMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318538_100262572 | 3300031546 | Soil | MNYVHDLFLGGEWKIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318538_100530532 | 3300031546 | Soil | MNYVHDLFLPVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318538_100928252 | 3300031546 | Soil | MNYVHGLFSSVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318571_101192811 | 3300031549 | Soil | MNYVHDLFLPVGVVIMVRALVEEATALASLALFLGMIAIWAQVIATL |
| Ga0310915_104542022 | 3300031573 | Soil | YVHDLFLPVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0310915_108670811 | 3300031573 | Soil | MNYVHDLFLPVGVVIMVRALVEEAATLASLALFLGMIAIWAQVI |
| Ga0318560_102421362 | 3300031682 | Soil | DPLPRTLDCEHIMNYTHVLFLLSGGVEIMVRALVEEAATLASPALFLGMIAIWAQVIATL |
| Ga0318493_106772991 | 3300031723 | Soil | PNQTLALDCEHIMNYVHDLFLEGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318492_105677322 | 3300031748 | Soil | LPPLDCEHSMNYVHDLFLPVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318566_102735241 | 3300031779 | Soil | IMNYVHDLFLEGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0310917_100903362 | 3300031833 | Soil | MNYVHGLFSSVGVVIMVRALVEEGATLASLALFLGMIAIWAQVIATL |
| Ga0318517_102304712 | 3300031835 | Soil | ALDLEHSMNYVHDLFLGGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318512_100411171 | 3300031846 | Soil | MNYVHDLFLGGEWEIMVRALVEEAATLASLALFLGMIA |
| Ga0306925_111422231 | 3300031890 | Soil | MNYTHVLFLLSGGVEIMVRALVEEAATLASPALFLGMIAIWAQVIATL |
| Ga0318551_104049091 | 3300031896 | Soil | PLPRTLDCEHIMNYTHVLFLLSGGVEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0310885_103592152 | 3300031943 | Soil | HVLFLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0306926_107264402 | 3300031954 | Soil | LFLGGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318531_101307573 | 3300031981 | Soil | MNYVHDLFLGGEWEIMVRALVEEAATLASLALFLGMIAIWAQDIATL |
| Ga0318569_100856422 | 3300032010 | Soil | NYVHDLFLGGEWKIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0310906_103091432 | 3300032013 | Soil | MNYVHVLFLLIGSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318559_100292162 | 3300032039 | Soil | MNYVHDLFLRGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318559_102756322 | 3300032039 | Soil | NQTLALDCEHIMNYVHDLFLEGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318510_100531102 | 3300032064 | Soil | DLEHSMNYVHDLFLGGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318510_103232531 | 3300032064 | Soil | TLPPLDCKHSMNYVHDLFLPVGVVIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318514_100215412 | 3300032066 | Soil | MNYVHDLFLGGEWEIMVRALVEEAATLASLALFLGMIAIWARVIATL |
| Ga0310890_117986141 | 3300032075 | Soil | HVLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0307470_101201011 | 3300032174 | Hardwood Forest Soil | MNYVHVLFLLLGSCIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318519_100081054 | 3300033290 | Soil | MNYVHDLSLGGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0364933_137012_498_629 | 3300034150 | Sediment | MNYVHVLFLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVI |
| ⦗Top⦘ |