| Basic Information | |
|---|---|
| Family ID | F046214 |
| Family Type | Metagenome |
| Number of Sequences | 151 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MGRKLNGCRSGPMCACGALAGEMAGVCEKCRFRVRWLRRKMRRSFGAG |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.33 % |
| % of genes near scaffold ends (potentially truncated) | 15.89 % |
| % of genes from short scaffolds (< 2000 bps) | 60.26 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.887 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (33.775 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.841 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.603 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.68% β-sheet: 5.26% Coil/Unstructured: 71.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF13581 | HATPase_c_2 | 15.33 |
| PF01580 | FtsK_SpoIIIE | 8.67 |
| PF04672 | Methyltransf_19 | 3.33 |
| PF13408 | Zn_ribbon_recom | 2.00 |
| PF03091 | CutA1 | 2.00 |
| PF13359 | DDE_Tnp_4 | 1.33 |
| PF00583 | Acetyltransf_1 | 1.33 |
| PF00440 | TetR_N | 1.33 |
| PF12728 | HTH_17 | 1.33 |
| PF01844 | HNH | 0.67 |
| PF13419 | HAD_2 | 0.67 |
| PF00126 | HTH_1 | 0.67 |
| PF13669 | Glyoxalase_4 | 0.67 |
| PF10592 | AIPR | 0.67 |
| PF09339 | HTH_IclR | 0.67 |
| PF07336 | ABATE | 0.67 |
| PF13242 | Hydrolase_like | 0.67 |
| PF01610 | DDE_Tnp_ISL3 | 0.67 |
| PF14329 | DUF4386 | 0.67 |
| PF13738 | Pyr_redox_3 | 0.67 |
| PF01609 | DDE_Tnp_1 | 0.67 |
| PF01966 | HD | 0.67 |
| PF14022 | DUF4238 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG1674 | DNA segregation ATPase FtsK/SpoIIIE or related protein | Cell cycle control, cell division, chromosome partitioning [D] | 8.67 |
| COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 2.00 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.67 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.67 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.67 |
| COG5516 | Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-binding | General function prediction only [R] | 0.67 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.89 % |
| Unclassified | root | N/A | 33.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101654550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3824 | Open in IMG/M |
| 3300005435|Ga0070714_100501284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1158 | Open in IMG/M |
| 3300005435|Ga0070714_102156952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300005467|Ga0070706_100016584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6804 | Open in IMG/M |
| 3300005534|Ga0070735_10000782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 32344 | Open in IMG/M |
| 3300005591|Ga0070761_10038557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 2677 | Open in IMG/M |
| 3300005995|Ga0066790_10040245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2031 | Open in IMG/M |
| 3300006028|Ga0070717_10752937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 886 | Open in IMG/M |
| 3300006893|Ga0073928_10206129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1536 | Open in IMG/M |
| 3300009012|Ga0066710_101568161 | Not Available | 1011 | Open in IMG/M |
| 3300009137|Ga0066709_102642198 | Not Available | 671 | Open in IMG/M |
| 3300009520|Ga0116214_1021548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2301 | Open in IMG/M |
| 3300009520|Ga0116214_1109746 | Not Available | 1017 | Open in IMG/M |
| 3300009521|Ga0116222_1051261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1798 | Open in IMG/M |
| 3300009521|Ga0116222_1423201 | Not Available | 580 | Open in IMG/M |
| 3300009522|Ga0116218_1074495 | Not Available | 1546 | Open in IMG/M |
| 3300009522|Ga0116218_1102285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1304 | Open in IMG/M |
| 3300009522|Ga0116218_1112390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. PIP175 | 1240 | Open in IMG/M |
| 3300009522|Ga0116218_1164105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1007 | Open in IMG/M |
| 3300009522|Ga0116218_1371700 | Not Available | 638 | Open in IMG/M |
| 3300009524|Ga0116225_1151705 | Not Available | 1058 | Open in IMG/M |
| 3300009525|Ga0116220_10447566 | Not Available | 581 | Open in IMG/M |
| 3300009672|Ga0116215_1041007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2116 | Open in IMG/M |
| 3300009672|Ga0116215_1067693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1611 | Open in IMG/M |
| 3300009698|Ga0116216_10048766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2615 | Open in IMG/M |
| 3300009698|Ga0116216_10405125 | Not Available | 828 | Open in IMG/M |
| 3300009698|Ga0116216_10871889 | Not Available | 539 | Open in IMG/M |
| 3300009700|Ga0116217_10063073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2630 | Open in IMG/M |
| 3300010343|Ga0074044_10038180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 3343 | Open in IMG/M |
| 3300010379|Ga0136449_100209313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3692 | Open in IMG/M |
| 3300010379|Ga0136449_100310721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2865 | Open in IMG/M |
| 3300010379|Ga0136449_100348397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2663 | Open in IMG/M |
| 3300010379|Ga0136449_100384030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2503 | Open in IMG/M |
| 3300010379|Ga0136449_100762563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1607 | Open in IMG/M |
| 3300010379|Ga0136449_100872271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1472 | Open in IMG/M |
| 3300010379|Ga0136449_101469639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1046 | Open in IMG/M |
| 3300010379|Ga0136449_103453764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 603 | Open in IMG/M |
| 3300010379|Ga0136449_104275648 | Not Available | 528 | Open in IMG/M |
| 3300011270|Ga0137391_10295354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1398 | Open in IMG/M |
| 3300012199|Ga0137383_10004446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8902 | Open in IMG/M |
| 3300012199|Ga0137383_10768201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 704 | Open in IMG/M |
| 3300012201|Ga0137365_10053492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3053 | Open in IMG/M |
| 3300012206|Ga0137380_10013249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7513 | Open in IMG/M |
| 3300012206|Ga0137380_10020737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 6038 | Open in IMG/M |
| 3300012206|Ga0137380_11402899 | Not Available | 583 | Open in IMG/M |
| 3300012209|Ga0137379_10076456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3219 | Open in IMG/M |
| 3300012209|Ga0137379_10106034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2704 | Open in IMG/M |
| 3300012209|Ga0137379_10249645 | Not Available | 1688 | Open in IMG/M |
| 3300012210|Ga0137378_10066586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3264 | Open in IMG/M |
| 3300012210|Ga0137378_11618895 | Not Available | 556 | Open in IMG/M |
| 3300012349|Ga0137387_10271133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1225 | Open in IMG/M |
| 3300012350|Ga0137372_10856692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 649 | Open in IMG/M |
| 3300012356|Ga0137371_10133109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1946 | Open in IMG/M |
| 3300012360|Ga0137375_10185472 | Not Available | 1988 | Open in IMG/M |
| 3300012363|Ga0137390_11779029 | Not Available | 548 | Open in IMG/M |
| 3300016341|Ga0182035_11364018 | Not Available | 636 | Open in IMG/M |
| 3300016387|Ga0182040_10847560 | Not Available | 755 | Open in IMG/M |
| 3300016404|Ga0182037_10790171 | Not Available | 818 | Open in IMG/M |
| 3300017821|Ga0187812_1080425 | Not Available | 1075 | Open in IMG/M |
| 3300017821|Ga0187812_1230780 | Not Available | 590 | Open in IMG/M |
| 3300017822|Ga0187802_10076533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1245 | Open in IMG/M |
| 3300017924|Ga0187820_1075271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium | 943 | Open in IMG/M |
| 3300017926|Ga0187807_1002455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5792 | Open in IMG/M |
| 3300017926|Ga0187807_1038293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1485 | Open in IMG/M |
| 3300017926|Ga0187807_1126330 | Not Available | 811 | Open in IMG/M |
| 3300017928|Ga0187806_1037693 | Not Available | 1446 | Open in IMG/M |
| 3300017932|Ga0187814_10067886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1308 | Open in IMG/M |
| 3300017932|Ga0187814_10217911 | Not Available | 719 | Open in IMG/M |
| 3300017932|Ga0187814_10251525 | Not Available | 670 | Open in IMG/M |
| 3300017932|Ga0187814_10355831 | Not Available | 566 | Open in IMG/M |
| 3300017943|Ga0187819_10680241 | Not Available | 581 | Open in IMG/M |
| 3300017955|Ga0187817_10344207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 951 | Open in IMG/M |
| 3300017955|Ga0187817_11058503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300017959|Ga0187779_11204604 | Not Available | 533 | Open in IMG/M |
| 3300017959|Ga0187779_11270916 | Not Available | 520 | Open in IMG/M |
| 3300017970|Ga0187783_10005654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9205 | Open in IMG/M |
| 3300017973|Ga0187780_10125034 | Not Available | 1778 | Open in IMG/M |
| 3300017975|Ga0187782_10125049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1903 | Open in IMG/M |
| 3300017975|Ga0187782_10613793 | Not Available | 836 | Open in IMG/M |
| 3300017975|Ga0187782_10613793 | Not Available | 836 | Open in IMG/M |
| 3300018007|Ga0187805_10371038 | Not Available | 663 | Open in IMG/M |
| 3300018085|Ga0187772_11396732 | Not Available | 520 | Open in IMG/M |
| 3300020582|Ga0210395_10862786 | Not Available | 674 | Open in IMG/M |
| 3300021088|Ga0210404_10435322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
| 3300021178|Ga0210408_10080557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 2552 | Open in IMG/M |
| 3300021388|Ga0213875_10113573 | Not Available | 1265 | Open in IMG/M |
| 3300021405|Ga0210387_10694940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis gilva | 902 | Open in IMG/M |
| 3300021406|Ga0210386_10806522 | Not Available | 807 | Open in IMG/M |
| 3300021407|Ga0210383_10991901 | Not Available | 713 | Open in IMG/M |
| 3300021474|Ga0210390_10722443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300021474|Ga0210390_10943151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300021476|Ga0187846_10021760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2962 | Open in IMG/M |
| 3300021560|Ga0126371_11034231 | Not Available | 962 | Open in IMG/M |
| 3300025910|Ga0207684_10010608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8098 | Open in IMG/M |
| 3300025910|Ga0207684_10026514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4941 | Open in IMG/M |
| 3300025922|Ga0207646_10027909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5146 | Open in IMG/M |
| 3300026294|Ga0209839_10009382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4172 | Open in IMG/M |
| 3300026551|Ga0209648_10021431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5649 | Open in IMG/M |
| 3300027568|Ga0208042_1001518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7461 | Open in IMG/M |
| 3300027662|Ga0208565_1158221 | Not Available | 658 | Open in IMG/M |
| 3300027824|Ga0209040_10004220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10907 | Open in IMG/M |
| 3300027854|Ga0209517_10581903 | Not Available | 596 | Open in IMG/M |
| 3300027911|Ga0209698_10363185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1136 | Open in IMG/M |
| 3300027986|Ga0209168_10000923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 25395 | Open in IMG/M |
| 3300028789|Ga0302232_10062001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1959 | Open in IMG/M |
| 3300028877|Ga0302235_10361997 | Not Available | 623 | Open in IMG/M |
| 3300029882|Ga0311368_10107775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2362 | Open in IMG/M |
| 3300029943|Ga0311340_10071374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3970 | Open in IMG/M |
| 3300029999|Ga0311339_10015946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11456 | Open in IMG/M |
| 3300029999|Ga0311339_10181772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2412 | Open in IMG/M |
| 3300029999|Ga0311339_10241604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1996 | Open in IMG/M |
| 3300030494|Ga0310037_10008036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5145 | Open in IMG/M |
| 3300030494|Ga0310037_10008129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5115 | Open in IMG/M |
| 3300030494|Ga0310037_10026077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2819 | Open in IMG/M |
| 3300030494|Ga0310037_10184409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 933 | Open in IMG/M |
| 3300030494|Ga0310037_10187943 | Not Available | 921 | Open in IMG/M |
| 3300030617|Ga0311356_10793889 | Not Available | 899 | Open in IMG/M |
| 3300031234|Ga0302325_10492798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1856 | Open in IMG/M |
| 3300031573|Ga0310915_11200076 | Not Available | 525 | Open in IMG/M |
| 3300031708|Ga0310686_106429275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1677 | Open in IMG/M |
| 3300031708|Ga0310686_107438319 | Not Available | 986 | Open in IMG/M |
| 3300031708|Ga0310686_113617849 | Not Available | 505 | Open in IMG/M |
| 3300031708|Ga0310686_116968653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300031859|Ga0318527_10154894 | Not Available | 962 | Open in IMG/M |
| 3300031947|Ga0310909_11523697 | Not Available | 532 | Open in IMG/M |
| 3300032160|Ga0311301_10032137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13445 | Open in IMG/M |
| 3300032160|Ga0311301_10056614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8733 | Open in IMG/M |
| 3300032160|Ga0311301_10059642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8382 | Open in IMG/M |
| 3300032160|Ga0311301_10074724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7072 | Open in IMG/M |
| 3300032160|Ga0311301_10111197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 5251 | Open in IMG/M |
| 3300032160|Ga0311301_10115869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5094 | Open in IMG/M |
| 3300032160|Ga0311301_10135399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4546 | Open in IMG/M |
| 3300032160|Ga0311301_10137409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4497 | Open in IMG/M |
| 3300032160|Ga0311301_10140938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4416 | Open in IMG/M |
| 3300032160|Ga0311301_10143846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4352 | Open in IMG/M |
| 3300032160|Ga0311301_10202861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3393 | Open in IMG/M |
| 3300032160|Ga0311301_10206489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3350 | Open in IMG/M |
| 3300032160|Ga0311301_10257083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2868 | Open in IMG/M |
| 3300032160|Ga0311301_10736267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1374 | Open in IMG/M |
| 3300032160|Ga0311301_11148038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1003 | Open in IMG/M |
| 3300032160|Ga0311301_12051112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300032770|Ga0335085_10191944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2511 | Open in IMG/M |
| 3300032770|Ga0335085_10278972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1993 | Open in IMG/M |
| 3300032805|Ga0335078_10133026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3543 | Open in IMG/M |
| 3300032892|Ga0335081_10069293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5403 | Open in IMG/M |
| 3300032892|Ga0335081_10177031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2996 | Open in IMG/M |
| 3300032895|Ga0335074_10059731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5206 | Open in IMG/M |
| 3300032895|Ga0335074_10133254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3187 | Open in IMG/M |
| 3300032895|Ga0335074_10347972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1651 | Open in IMG/M |
| 3300033158|Ga0335077_10548610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1215 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 33.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.26% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 10.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.28% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.96% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.99% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.32% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.66% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.66% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.66% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.66% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.66% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1016545503 | 3300000364 | Soil | MGRKLNGCRNGRQCACGALATDGRSTCEKCRFRARWLRRRMPRNSGTA* |
| Ga0070714_1005012842 | 3300005435 | Agricultural Soil | MSMGLMLNGCRNGRNCACGALSADGSGACDKCRFQARWLRRKTRRSFGSG* |
| Ga0070714_1021569521 | 3300005435 | Agricultural Soil | MGRKLNGCRSGICVCGALSADGSGACEKCRFRARWLRRKLRRSSADE* |
| Ga0070706_10001658411 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRKLNGCRSGLKCACGALATDGPGVCEKCRFRARWMRRKTRRGFDAG* |
| Ga0070735_1000078224 | 3300005534 | Surface Soil | MGRKLTGCRSGLMCACGAVAGEMAGVCEKCRFRVRWLRRKVRRSFDAG* |
| Ga0070761_100385571 | 3300005591 | Soil | MRVGHKLTGCRSGRPVCECGAMAGEMAGVCDKCRFRVRWLRRKTGRSFGAR* |
| Ga0066790_100402453 | 3300005995 | Soil | VGRKLTGCRSGRPVCACGALAGEMAGVCDKCRFRVRWLRRKVRRSFGRE* |
| Ga0070717_107529372 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSMGRKLNGCRSGPMCACGALAARQVGTCEKCRFRARWLRRKMRRHHGIA* |
| Ga0073928_102061293 | 3300006893 | Iron-Sulfur Acid Spring | MGRKLTGCRSGPMCACGALAGEMAGVCEKCRFRVRWLRRKMRRSSDAG* |
| Ga0066710_1015681611 | 3300009012 | Grasslands Soil | MGRKLNGCRSGFKCTCGALATDGDGVCEKCRFRARWLRRKMRRGFDAG |
| Ga0066709_1026421982 | 3300009137 | Grasslands Soil | MSMGRKLNGCRSGFKCTCGALATDGDGVCEKCRFRARWLRRKMRRGFEAG* |
| Ga0116214_10215486 | 3300009520 | Peatlands Soil | MGRKLTGCRISEICKCGAVAMDAAGVCEKCRFRARWLRRKMRRSMDAG* |
| Ga0116214_11097464 | 3300009520 | Peatlands Soil | MGRKLNGCRSGFKCTCGALAADGAGVCEKCRFRARWLRRKMRRDFDAG* |
| Ga0116222_10512615 | 3300009521 | Peatlands Soil | MSMGRKLTGCRISEICKCGAVAMDAAGVCEKCRFRARWLRRKTRRTFNVG* |
| Ga0116222_14232011 | 3300009521 | Peatlands Soil | MGRKLTGCRNGSVCACGGLAMDAAGVCEKCRLRARWLRRKTRRTFNVG* |
| Ga0116218_10744953 | 3300009522 | Peatlands Soil | MGRKLTGCRISEICKCGAVAMDAAGVCEKCRFRARWLRRKTRRTFNVG* |
| Ga0116218_11022853 | 3300009522 | Peatlands Soil | MGRKLNGCRSGFKCTCGALAADGAGVCEKCRFRARWLRRKMRRDF |
| Ga0116218_11123902 | 3300009522 | Peatlands Soil | MGRKLNGCRNGRQCACGALTADGADRCEKCRFRARWLRRKQPRAFGIG* |
| Ga0116218_11641051 | 3300009522 | Peatlands Soil | MGHKLNGCRNGRQCTCGALAADGTDRCEKCRFRARWLRRK |
| Ga0116218_13717002 | 3300009522 | Peatlands Soil | MGHKLNGCRNGRQCACGGLAADGTDRCEKCRFRARWLRR |
| Ga0116221_11690412 | 3300009523 | Peatlands Soil | LTGCRISEICKCGAVAMDAAGVCEKCRFRARWLRRKTRRTFNVG* |
| Ga0116225_11517054 | 3300009524 | Peatlands Soil | MGRKLTGCRNGSVCACGGLAMDAAGVCEKCRLRARWLRRKTR |
| Ga0116220_104475661 | 3300009525 | Peatlands Soil | MSMGRKLTGCRISQICDCGAVAMDAAGVCEKCRFRARWIRRKTRRTFNVG* |
| Ga0116215_10410073 | 3300009672 | Peatlands Soil | MGRKLTGCRNGSVCACGGLAMDAAGVCEKCRLRARWLRRKTRRTFNAG* |
| Ga0116215_10676934 | 3300009672 | Peatlands Soil | MGRKLNGCRNGRMCACGALSSDIAGICEKCRFRARWLRRKTHRRFGTG* |
| Ga0116216_100487664 | 3300009698 | Peatlands Soil | MGHKLNGCRNGRQCTCGALAADGTDRCEKCRFRARWLRRKMPRHPGIR* |
| Ga0116216_104051252 | 3300009698 | Peatlands Soil | MGRKLTGCRISEICKCGAVATDAAGVCEKCRYRARWLRRKTRRTFNVG* |
| Ga0116216_108718892 | 3300009698 | Peatlands Soil | MKMGRKLTGCRSGPMCACGAVAGEMAGVCEKCRFRVRWLRRKMRRSFGAG* |
| Ga0116217_100630731 | 3300009700 | Peatlands Soil | MGRKLHGCRSGPRCACGAMAAGQAGACEKCRFRARWLRRKMRRDPGIA* |
| Ga0074044_100381804 | 3300010343 | Bog Forest Soil | MGHELNGCRSGSKCACGALATDGSGACEKCRFRARWLRRKLRRSFSAG* |
| Ga0136449_1002093135 | 3300010379 | Peatlands Soil | MGRKLNGCRSGLKCTCGALATDGPGVCEKCRFRSRWLRRKTRRGFDAG* |
| Ga0136449_1003107214 | 3300010379 | Peatlands Soil | MGRKLNGCRSVPDCACGALAGEMAGVCEKCRFRFRWLRRKTRRGFNAG* |
| Ga0136449_1003483973 | 3300010379 | Peatlands Soil | MGRKLNGCRSGAKCACGALATDGSGACEKCRFRSRWLRRKTRRSFDAG* |
| Ga0136449_1003840301 | 3300010379 | Peatlands Soil | MGRMLTGCRNGRQCACGALTADGTDSCEKCRFRARWLRRKQPRASGIG* |
| Ga0136449_1007625631 | 3300010379 | Peatlands Soil | MGRKLNGCRSGPECACGALATDGSGACEKCRFRSRWLRRKTRRSFDAG* |
| Ga0136449_1008722712 | 3300010379 | Peatlands Soil | MSMGRKLNGCRSGFKCTCGALADGVGVCEKCRFRARWLRRKMRHDFDAG* |
| Ga0136449_1014696391 | 3300010379 | Peatlands Soil | MKMGRKLTGCRSGPMCACGALAGEMAGVCEKCRFRVRWLRRKVRRSFGAG* |
| Ga0136449_1034537642 | 3300010379 | Peatlands Soil | MGLKLNGCRSGTICACGALAPDGSGACEKCRFRARWLRRKT |
| Ga0136449_1042756481 | 3300010379 | Peatlands Soil | MKMGRKLTGCRSGPMCACGAVATGVAGVCEKCRFRVRWLRRKVRRSFDAG* |
| Ga0137391_102953543 | 3300011270 | Vadose Zone Soil | MGRKLNGCRSGAQCACGALATDGSGACEKCRFRARWLRRKTRRSFDAG* |
| Ga0137383_100044467 | 3300012199 | Vadose Zone Soil | MGRKLNGCRSGLKCTCGALATDGDGVCEKCRFRSRWLRRKTRRGFDAG* |
| Ga0137383_107682012 | 3300012199 | Vadose Zone Soil | MSMGRKLNGCRSGFKCTCGALAADGDGVCEKCRFRARWLRRKMRRGFDAG* |
| Ga0137365_100534921 | 3300012201 | Vadose Zone Soil | MSMGRKLNGCRSGFKCTCGALATDGDGVCEKCRFRARWLRRKMRRGFDA |
| Ga0137380_100132493 | 3300012206 | Vadose Zone Soil | MGRKLNGCRSGPMCVCGALASEMAGVCEKCRFRVRWLRRKMRRSFGDG* |
| Ga0137380_100207374 | 3300012206 | Vadose Zone Soil | MGRKLNGCRNGRQCACGALAAEGGSTCEKCRFRARWLRRRMPRNSGIG* |
| Ga0137380_114028992 | 3300012206 | Vadose Zone Soil | MGRKLNGCRSGFKCTCGALAADGDGVCEKCRFRARWLRRKMRRGFDAG* |
| Ga0137379_100764565 | 3300012209 | Vadose Zone Soil | MSMGRELNGCRSGFKCTCGALATDGDGVCEKCRFRARWLRRKMR |
| Ga0137379_101060344 | 3300012209 | Vadose Zone Soil | MGLKLNGCRSGLKCACGALATDGPGVCEKCRFRSRWLRRKTRRGFDAG* |
| Ga0137379_102496452 | 3300012209 | Vadose Zone Soil | MGHKLTGCRNGRQCACGALAADGGSTCEKCRFRARWLRRKMPRNSGIG* |
| Ga0137378_100665861 | 3300012210 | Vadose Zone Soil | MGLKLNGCRSGLKCACGALATDGPGVCEKCRFGTPWLRRKTRRGFDAGYRPVP |
| Ga0137378_116188951 | 3300012210 | Vadose Zone Soil | MGHKLTGCRSGPMCVCGALASEMAGVCEKCRFRVRWLRRKMRRSFGDG* |
| Ga0137387_102711331 | 3300012349 | Vadose Zone Soil | MGRELNGCRSGFKCTCGALATDGDGVCEKCRFRARWLRRKMRRGFDAG* |
| Ga0137372_108566921 | 3300012350 | Vadose Zone Soil | MSMGRKLNGCRSGFECTCGALATDGDRACEKCRFRARWLRRKLRRGFDAG |
| Ga0137371_101331094 | 3300012356 | Vadose Zone Soil | MGRKLNGCRSGLKCACGALATDGPGVCEKCRFRSRWMRRKTRRGFDAG* |
| Ga0137375_101854722 | 3300012360 | Vadose Zone Soil | MGRKLNGCRSGFKCTCGALAADGDGVCEKCRFRSRWLRRKTRRGFDAVARKPGA* |
| Ga0137390_117790291 | 3300012363 | Vadose Zone Soil | MGRKLNGCRNGLMCACGALATDGPGACEKCRFRARWLRRKTRRSFDAR* |
| Ga0182035_113640183 | 3300016341 | Soil | MGRKLNGCRSGPTCACGALAGEMAGVCEKCRFRVRWLRRKTRHSFGSG |
| Ga0182040_108475601 | 3300016387 | Soil | MGRKLTGCRNGAMCLCGAQATDGSGACEKCRFRARWLRRKMRRRFG |
| Ga0182037_107901712 | 3300016404 | Soil | MGRKLNGCRNGLTCACGALATDGSGACEKCQFRARWLRRKMPRIP |
| Ga0187812_10804252 | 3300017821 | Freshwater Sediment | MGRKLTGCRISEICKCGAVAMDAAGVCEKCRFRARWLRRKTRRTFNVG |
| Ga0187812_12307801 | 3300017821 | Freshwater Sediment | MGRKLNGCRSVANCGCGALAGEMAGVCEKCRFRVRWLRRKMRRSFGAG |
| Ga0187802_100765333 | 3300017822 | Freshwater Sediment | VGRKLTGCRSGQPMCACGALAGEIAGVCDKCRFRVRWLRRK |
| Ga0187820_10752711 | 3300017924 | Freshwater Sediment | MGRKLSGCRNGSVCACGGLAMDAAGVCEKCRFRARWLRRKTRRTFNVG |
| Ga0187807_10024554 | 3300017926 | Freshwater Sediment | MGRELNGCRSGRQCACGALAADGADRCEKCRFRARWLRRKQSRSFDT |
| Ga0187807_10382932 | 3300017926 | Freshwater Sediment | MGRKLNGCRSVANCGCGALAGEMAGVCEKCRFRVRWLRRKTRRNFGAG |
| Ga0187807_11263301 | 3300017926 | Freshwater Sediment | MGRKLNGCRSGFKCTCGALAADRVGVCEKCRFRARWLRRKMRHDFDAG |
| Ga0187806_10376934 | 3300017928 | Freshwater Sediment | MGRKLTGCRSGFVCACGGLAMDAAGVCEKCRFRARWLRRKTRRTFNVG |
| Ga0187814_100678862 | 3300017932 | Freshwater Sediment | LTGCRISEICKCGAVAMDAAGVCEKCRFRARWLRRKTRRTFNVG |
| Ga0187814_102179112 | 3300017932 | Freshwater Sediment | MGRKLNGCRSGPMCACGALAGEMAGVCEKCRFRVRWLRRKTRRSFGTG |
| Ga0187814_102515251 | 3300017932 | Freshwater Sediment | LTGCRSGPMCACGALAGEMAGVCEKCRFRVRWLRRKVRRSFDAG |
| Ga0187814_103558311 | 3300017932 | Freshwater Sediment | MKVGRKLIGCRSGPMCACGALAGEVAGVCEKCRFRVRWLRRKVRRSFGAV |
| Ga0187819_106802411 | 3300017943 | Freshwater Sediment | MRVGRKLTGCRSGQPVCECGALAGEMAGVCDKCRFRVRWLRRKMRRSFGAG |
| Ga0187817_103442071 | 3300017955 | Freshwater Sediment | MGRKLTGCRSGPMCACGALAGEVAGVCEKCRFRVRWLRRKVRRSFGAG |
| Ga0187817_110585032 | 3300017955 | Freshwater Sediment | MGRELNGCRNGSKCACGALATDGSGACEKCRFRARWLRRKLRRSF |
| Ga0187779_112046041 | 3300017959 | Tropical Peatland | MGRKLNGCRSGPMCACGALAGEMAGVCEKCRFRVRWLRRKMRRSFGAG |
| Ga0187779_112709161 | 3300017959 | Tropical Peatland | MGRKLNGCRNGRQCACGALSADGGSTCEKCRFRARWLRRKMPRNYGTS |
| Ga0187783_1000565410 | 3300017970 | Tropical Peatland | MMTGELAGCRRGRQCQCGALTADGAGVCEKCRYRARWLRRKMQRRFDIG |
| Ga0187780_101250342 | 3300017973 | Tropical Peatland | MGRKLQGCRSGPMCVCGALAAGQAGVCEKCRFRARWLRRKMRRDHGIA |
| Ga0187782_101250492 | 3300017975 | Tropical Peatland | MRVGRKLTGCVSGQPMCACGALAGEMAGVCEKCRFRVRWLRRKTRRSFGTG |
| Ga0187782_106137932 | 3300017975 | Tropical Peatland | MGRKLQGCRSGPMCACGALTAGQAGTCEKCRFRARWLRRKMRRDPGIG |
| Ga0187782_106137933 | 3300017975 | Tropical Peatland | MAGELSGCRSGPRCACGALAAHQSGACEKCRFRARWLRRK |
| Ga0187805_103710382 | 3300018007 | Freshwater Sediment | MGRKLTGCRSGPMCACGAVANEVAGVCEKCRFRVRWLRRKVRRSFDAG |
| Ga0187772_113967322 | 3300018085 | Tropical Peatland | MGHEVNGCRNGRQCACGALSAGGADRCEKCRFRARWLRRKQPRN |
| Ga0210395_108627862 | 3300020582 | Soil | MGRKLTGCRSGPMCACGALAGEMAGVCEKCRFRVRWLRRKVRRSFDAR |
| Ga0210404_104353221 | 3300021088 | Soil | MGRMLNGCRNGRNCDCGAQATDGSGACDKCRFRARWLRRKTRRS |
| Ga0210408_100805573 | 3300021178 | Soil | MGRMLNGCRNGRNCDCGAQATDGSGACDKCRFRARWLRRKTRRSFGSG |
| Ga0213875_101135732 | 3300021388 | Plant Roots | MGRKFTGCRNGSQCVCGALATDGAGVCDKCRFRARWLRRKMPRHINAG |
| Ga0210387_106949402 | 3300021405 | Soil | MGRKLTGCRSGPMCACGAVAGEMAGVCEKCRFRVRWLRRKMRRTFGAG |
| Ga0210386_108065222 | 3300021406 | Soil | LTGCRSGPMCACGALAGEMAGVCEKCRFRVRWLRRKVRRSFGAG |
| Ga0210383_109919011 | 3300021407 | Soil | MKMGRKLTGCRSGPMCACGAVAGEMAGVCEKCRFRVRWLRRKVRRSFDAG |
| Ga0210390_107224433 | 3300021474 | Soil | MGRKLNGCRSGFKCMCGALADGAGVCEKCRFRARWLRRKTHRSFDAG |
| Ga0210390_109431512 | 3300021474 | Soil | LNGCRSGPICACGAVAGEMAGVCEKCRFRVRWLRRKMRRTFGAG |
| Ga0187846_100217604 | 3300021476 | Biofilm | MAGELSGCRSGPRCACGALAAHRSGACEKCRFRARWLRRKMRRDPGIG |
| Ga0126371_110342311 | 3300021560 | Tropical Forest Soil | MGRKLTGCRSGPVCACGALAGEMPGVCDKCRFRARWLRRKMRRSPEAG |
| Ga0207684_100106082 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRKLNGCRSGLKCACGALATDGPGVCEKCRFRARWMRRKTRRGFDAG |
| Ga0207684_100265144 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VGHKLTGCRSGRPVCACGALADEMAGMCEKCRFRVRWLRRKTHRRFGAG |
| Ga0207646_100279097 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIGRMLNGCRNGRKCECGALSADGSGACDKCRFRARWLRRKTRRSFGSG |
| Ga0209839_100093823 | 3300026294 | Soil | MRVGRKLTGCRSGRPVCACGALAGEMAGVCDKCRFRVRWLRRKVRRSFGRE |
| Ga0209648_100214318 | 3300026551 | Grasslands Soil | MGRKLNGCRSGLKCTCGGLATDGPGVGEKCRFRSRWLRRKTRRGFDAG |
| Ga0208042_10015183 | 3300027568 | Peatlands Soil | MGRELNGCRSGSKCACGALATDGSGACEKCRFRARWLRRKLRRSFSAG |
| Ga0208565_11582212 | 3300027662 | Peatlands Soil | MGRKLNGCRSGFKCTCGALAADGAGVCEKCRFRARWLRRKMRRDFDAG |
| Ga0209040_100042201 | 3300027824 | Bog Forest Soil | MGRKLNGCRNGRQCACGAQATDGGSTCEKCRFRARWLRRKMPRNSGTA |
| Ga0209517_105819031 | 3300027854 | Peatlands Soil | MSMGRKLTGCRISEICKCGAVAMDAAGVCEKCRFRARWLRRKTRRTFNVG |
| Ga0209698_103631852 | 3300027911 | Watersheds | MGHKLNGCRNGRMCACGALSDNMAGMCEKCRFRARWLRRKTHRRFGTG |
| Ga0209168_100009239 | 3300027986 | Surface Soil | MGRKLTGCRSGLMCACGAVAGEMAGVCEKCRFRVRWLRRKVRRSFDAG |
| Ga0302232_100620012 | 3300028789 | Palsa | MGHELNGCRNGRQCACGALTADGAGRCEKCRYRARWLRRKMPRHSGIG |
| Ga0302235_103619972 | 3300028877 | Palsa | MGHKLNGCRNGRLCACGALSANVGGVCEKCYLRARWLR |
| Ga0311368_101077751 | 3300029882 | Palsa | MGHELNGCRNGRQCACGALTADGAGRCEKCRFRARWLRRKMPRHSGIG |
| Ga0311340_100713745 | 3300029943 | Palsa | MGHKLNGCRNGRLCACGALSANVGGVCEKCYLRARWLRRKMPRSHGHR |
| Ga0311339_100159467 | 3300029999 | Palsa | MGHKLNGCRNGRLCACGALSANVGGVCEKCYLRARWLRRKMPRNYGHR |
| Ga0311339_101817723 | 3300029999 | Palsa | MGHKLNGCRNGRQCACGALTADGAGRCEKCRFRARWLRRKMPRHSGIG |
| Ga0311339_102416044 | 3300029999 | Palsa | MGQKLNGCRNGRQCACGALTADGTDRCEKCIFRIRWLRRKMPRNSGIG |
| Ga0310037_100080366 | 3300030494 | Peatlands Soil | MRVGRKLTGCRSGQPVCECGALAGDMVGVCDKCRFRVRWLRRKTRRSFGTG |
| Ga0310037_100081297 | 3300030494 | Peatlands Soil | MGRKLNGCRNGSMCACGALATDVAGVCEKCRFRARWLRRKMRHDPGIG |
| Ga0310037_100260771 | 3300030494 | Peatlands Soil | MGHKLNGCRNGRQCTCGALAADGTDRCEKCRFRARWLRRKMPRHPGIR |
| Ga0310037_101844091 | 3300030494 | Peatlands Soil | MGRKLTGCRSGPMCACGALAGEMAGVCEKCRFRVRWLRRKVRRSFDAG |
| Ga0310037_101879431 | 3300030494 | Peatlands Soil | MGRKLNGCRSGFKCTCGALADGVGVCEKCRFRARWLRRKMRRDFDAG |
| Ga0311356_107938894 | 3300030617 | Palsa | NGCRNGRQCACGALTADGAGRCEKCRFRARWLRRKMPRHSGIG |
| Ga0302325_104927983 | 3300031234 | Palsa | MGRKLNGCRNGQMCACGALSSEMAGMCEKCRFRVRWLRRKMRRSSRAG |
| Ga0310915_112000762 | 3300031573 | Soil | MGRKLNGCRNGAMCPCGAQATDGSGACEKCRFRARWLRRKMRRSFGTG |
| Ga0310686_1064292753 | 3300031708 | Soil | MGRELNGCRSGPMCACGALAGEMAGVCEKCRFRVRWLRRKVRRSFDAG |
| Ga0310686_1074383191 | 3300031708 | Soil | MGQKLTGCRSGPMCACGAVAGEMAGVCEKCRFRVRWLRRKMRRSFDAG |
| Ga0310686_1136178491 | 3300031708 | Soil | MRVGHKLTGCRSGQPVCECGALAGEMAGVCDKCRFRVRWLRRKTRRSSGDR |
| Ga0310686_1169686532 | 3300031708 | Soil | MGRKLNGCRSGPTCACGALAGEMAGVCEKCRFRVLWLRRKTRRSFGSG |
| Ga0318527_101548942 | 3300031859 | Soil | MGRKLNGCRNGLTCACGALATDGSGACEKCQFRARWLRRKMPRIPGVG |
| Ga0310909_115236971 | 3300031947 | Soil | MLNGCRNGRQCACGALAADGITCEKCRFRARWLRRRMPRRPGTA |
| Ga0311301_100321379 | 3300032160 | Peatlands Soil | MGRKLHGCRSGPRCACGAMAAGQAGACEKCRFRARWLRRKMRRDPGIA |
| Ga0311301_100566147 | 3300032160 | Peatlands Soil | MGRKLTGCRNGSVCACGGLAMDAAGVCEKCRLRARWLRRKTRRTFNAG |
| Ga0311301_100596427 | 3300032160 | Peatlands Soil | MGRMLTGCRNGRQCACGALTADGTDSCEKCRFRARWLRRKQPRASGIG |
| Ga0311301_100747246 | 3300032160 | Peatlands Soil | VGRKLTGCRSGQPVCECGALAGDMVGVCDKCRFRVRWLRRKTRRSFGTG |
| Ga0311301_101111974 | 3300032160 | Peatlands Soil | MGRKLNGCRSGTECACGALATDGSGACEKCRFRSRWLRRKTRRSFDAG |
| Ga0311301_101158693 | 3300032160 | Peatlands Soil | MGRKLNGCRSGAKCACGALATDGSGACEKCRFRSRWLRRKTRRSFDAG |
| Ga0311301_101353996 | 3300032160 | Peatlands Soil | RNGRQCTCGALAADGTDRCEKCRFRARWLRRKMPRHPGIR |
| Ga0311301_101374095 | 3300032160 | Peatlands Soil | MGRKLNGCRNGRMCACGALSSDIAGICEKCRFRARWLRRKTHRRFGTG |
| Ga0311301_101409381 | 3300032160 | Peatlands Soil | MGHKLTGCRNGRQCACGALAADGTDRCEKCRFRARWLRRKMPRNSGIG |
| Ga0311301_101438465 | 3300032160 | Peatlands Soil | MGRKLNGCRSGLKCTCGALATDGPGVCEKCRFRSRWLRRKTRRGFDAG |
| Ga0311301_102028611 | 3300032160 | Peatlands Soil | MGHKLNGCRNGRQCACGALTADGTDRCEKCRFRARWLRRKMPRSSGIG |
| Ga0311301_102064893 | 3300032160 | Peatlands Soil | MGHKLTGCRNGRQCACGALSADGTDRCEKCRFRARWLRRKMPRHPGIR |
| Ga0311301_102570831 | 3300032160 | Peatlands Soil | MGHKLTGCRNGRQCACGAQASDGTDPCEKCRFRARWLRRK |
| Ga0311301_107362674 | 3300032160 | Peatlands Soil | MGRKLNGCRSGFKCTCGALADGVGVCEKCRFRARWLRRKMRHDFDAG |
| Ga0311301_111480382 | 3300032160 | Peatlands Soil | MGRKLNGCRNGRMCACGALSGDMAGICEKCRFRARWLRRKTHRRFGTG |
| Ga0311301_120511121 | 3300032160 | Peatlands Soil | MGHKLNGCRNGRQCACGALAADGTDRCEKCRFRARWLRRK |
| Ga0335085_101919444 | 3300032770 | Soil | MGRKLNGCRNGRECACGALAEDGGSTCEKCRFRARWLRRKMPRDHGIG |
| Ga0335085_102789722 | 3300032770 | Soil | MGRMLTGCRNGRQCACGALAAEGGSSCEKCRFRARWLRRKMPRHHGIA |
| Ga0335078_101330263 | 3300032805 | Soil | MGRKLNGCRNGRMCACGAFSGDMAGMCEKCRFRARWLRRKMRRSSGAG |
| Ga0335081_100692938 | 3300032892 | Soil | MGRKLNGCRSGLKCACGALATDGPGVCEKCRFRSRWMRRKTRRGFDGG |
| Ga0335081_101770312 | 3300032892 | Soil | MGRKLNGCRSGRQCACGALAADGTGRCEKCRFRARWLRRKQPRSFDT |
| Ga0335074_100597315 | 3300032895 | Soil | MGRKLTGCRSGPMCACGAAAGEMAGVCDKCRFRVRWLRRKVRRSSDAG |
| Ga0335074_101332542 | 3300032895 | Soil | MMMAGELNGCRSGRQCPYGAVAGEVAGVCEKCRFRARWLRRKMRRSSAG |
| Ga0335074_103479721 | 3300032895 | Soil | MGRELNGCRSGPMCPCGALASDGADRCEKCRFRARWMRRKMRRSFDNG |
| Ga0335077_105486103 | 3300033158 | Soil | MGRKLTGCRSGPMCTCGALAGEMAGVCEKCRFRVRWLRRKVRRSFGAG |
| ⦗Top⦘ |