| Basic Information | |
|---|---|
| Family ID | F046040 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MRLLGSILLLIGMGSAAFATVPEISPASAGSAIALISGAVLVMRGRRKK |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 79.47 % |
| % of genes near scaffold ends (potentially truncated) | 23.68 % |
| % of genes from short scaffolds (< 2000 bps) | 79.61 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.579 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (15.790 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.447 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.895 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 51.95% β-sheet: 0.00% Coil/Unstructured: 48.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF09721 | Exosortase_EpsH | 10.85 |
| PF13483 | Lactamase_B_3 | 4.65 |
| PF00753 | Lactamase_B | 2.33 |
| PF04116 | FA_hydroxylase | 1.55 |
| PF12844 | HTH_19 | 1.55 |
| PF12727 | PBP_like | 1.55 |
| PF00069 | Pkinase | 1.55 |
| PF02705 | K_trans | 0.78 |
| PF12796 | Ank_2 | 0.78 |
| PF12697 | Abhydrolase_6 | 0.78 |
| PF00135 | COesterase | 0.78 |
| PF11746 | DUF3303 | 0.78 |
| PF01145 | Band_7 | 0.78 |
| PF07690 | MFS_1 | 0.78 |
| PF02517 | Rce1-like | 0.78 |
| PF00685 | Sulfotransfer_1 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.20 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 1.55 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.78 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.78 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.58 % |
| All Organisms | root | All Organisms | 43.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10026896 | All Organisms → cellular organisms → Bacteria | 3441 | Open in IMG/M |
| 3300000567|JGI12270J11330_10059680 | Not Available | 1976 | Open in IMG/M |
| 3300000567|JGI12270J11330_10059680 | Not Available | 1976 | Open in IMG/M |
| 3300000567|JGI12270J11330_10059680 | Not Available | 1976 | Open in IMG/M |
| 3300004119|Ga0058887_1234539 | Not Available | 520 | Open in IMG/M |
| 3300004463|Ga0063356_100293529 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300004961|Ga0072333_1142453 | Not Available | 603 | Open in IMG/M |
| 3300004961|Ga0072333_1142453 | Not Available | 603 | Open in IMG/M |
| 3300004964|Ga0072331_1173529 | Not Available | 689 | Open in IMG/M |
| 3300005329|Ga0070683_100021550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 5752 | Open in IMG/M |
| 3300005329|Ga0070683_100075546 | All Organisms → cellular organisms → Bacteria | 3148 | Open in IMG/M |
| 3300005329|Ga0070683_100831344 | Not Available | 886 | Open in IMG/M |
| 3300005332|Ga0066388_100340349 | Not Available | 2146 | Open in IMG/M |
| 3300005334|Ga0068869_100031534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3729 | Open in IMG/M |
| 3300005334|Ga0068869_101213250 | Not Available | 663 | Open in IMG/M |
| 3300005334|Ga0068869_101213250 | Not Available | 663 | Open in IMG/M |
| 3300005338|Ga0068868_100265105 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300005338|Ga0068868_101346068 | Not Available | 664 | Open in IMG/M |
| 3300005340|Ga0070689_101938476 | Not Available | 538 | Open in IMG/M |
| 3300005345|Ga0070692_10458968 | Not Available | 817 | Open in IMG/M |
| 3300005364|Ga0070673_100150754 | All Organisms → cellular organisms → Bacteria | 1969 | Open in IMG/M |
| 3300005364|Ga0070673_100150754 | All Organisms → cellular organisms → Bacteria | 1969 | Open in IMG/M |
| 3300005434|Ga0070709_10785219 | Not Available | 746 | Open in IMG/M |
| 3300005434|Ga0070709_11528417 | Not Available | 542 | Open in IMG/M |
| 3300005434|Ga0070709_11528417 | Not Available | 542 | Open in IMG/M |
| 3300005436|Ga0070713_100304074 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300005439|Ga0070711_100616140 | Not Available | 907 | Open in IMG/M |
| 3300005439|Ga0070711_100616140 | Not Available | 907 | Open in IMG/M |
| 3300005439|Ga0070711_100737517 | Not Available | 832 | Open in IMG/M |
| 3300005439|Ga0070711_101311637 | Not Available | 628 | Open in IMG/M |
| 3300005459|Ga0068867_100507944 | Not Available | 1037 | Open in IMG/M |
| 3300005535|Ga0070684_100793988 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300005538|Ga0070731_10487910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 820 | Open in IMG/M |
| 3300005539|Ga0068853_100056452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 3386 | Open in IMG/M |
| 3300005539|Ga0068853_100541447 | Not Available | 1102 | Open in IMG/M |
| 3300005542|Ga0070732_10975058 | Not Available | 518 | Open in IMG/M |
| 3300005543|Ga0070672_101534846 | Not Available | 597 | Open in IMG/M |
| 3300005547|Ga0070693_101376138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300005564|Ga0070664_100051511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3486 | Open in IMG/M |
| 3300005564|Ga0070664_101411240 | Not Available | 658 | Open in IMG/M |
| 3300005615|Ga0070702_101473357 | Not Available | 559 | Open in IMG/M |
| 3300005719|Ga0068861_101431477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300005829|Ga0074479_10573231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1946 | Open in IMG/M |
| 3300005829|Ga0074479_10573231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1946 | Open in IMG/M |
| 3300005841|Ga0068863_102730332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300006163|Ga0070715_10572899 | Not Available | 658 | Open in IMG/M |
| 3300006237|Ga0097621_100141868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 2053 | Open in IMG/M |
| 3300006237|Ga0097621_101501419 | Not Available | 639 | Open in IMG/M |
| 3300006358|Ga0068871_101418150 | Not Available | 655 | Open in IMG/M |
| 3300006638|Ga0075522_10113462 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300006755|Ga0079222_12065304 | Not Available | 562 | Open in IMG/M |
| 3300006880|Ga0075429_101864474 | Not Available | 521 | Open in IMG/M |
| 3300006881|Ga0068865_100285898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1314 | Open in IMG/M |
| 3300006893|Ga0073928_10613265 | Not Available | 767 | Open in IMG/M |
| 3300006893|Ga0073928_10679450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RIFCSPLOWO2_02_FULL_56_15 | 720 | Open in IMG/M |
| 3300006954|Ga0079219_11831428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 569 | Open in IMG/M |
| 3300009098|Ga0105245_10205994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1891 | Open in IMG/M |
| 3300009098|Ga0105245_10530338 | Not Available | 1197 | Open in IMG/M |
| 3300009098|Ga0105245_11307244 | Not Available | 774 | Open in IMG/M |
| 3300009098|Ga0105245_12070813 | Not Available | 623 | Open in IMG/M |
| 3300009148|Ga0105243_10757073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300009148|Ga0105243_12466657 | Not Available | 559 | Open in IMG/M |
| 3300009174|Ga0105241_10125450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 2072 | Open in IMG/M |
| 3300009176|Ga0105242_11714071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300009176|Ga0105242_13115860 | Not Available | 514 | Open in IMG/M |
| 3300009177|Ga0105248_13387709 | Not Available | 506 | Open in IMG/M |
| 3300009523|Ga0116221_1533908 | Not Available | 515 | Open in IMG/M |
| 3300009551|Ga0105238_10246385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1765 | Open in IMG/M |
| 3300009551|Ga0105238_11478975 | Not Available | 708 | Open in IMG/M |
| 3300009551|Ga0105238_13041405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300009839|Ga0116223_10038120 | All Organisms → cellular organisms → Bacteria | 3215 | Open in IMG/M |
| 3300010375|Ga0105239_11490778 | Not Available | 782 | Open in IMG/M |
| 3300010375|Ga0105239_13529101 | Not Available | 508 | Open in IMG/M |
| 3300010379|Ga0136449_100000591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 103277 | Open in IMG/M |
| 3300010379|Ga0136449_100000591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 103277 | Open in IMG/M |
| 3300010379|Ga0136449_100196766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 3843 | Open in IMG/M |
| 3300010379|Ga0136449_100196766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 3843 | Open in IMG/M |
| 3300010379|Ga0136449_100893979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1449 | Open in IMG/M |
| 3300010400|Ga0134122_10211922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1613 | Open in IMG/M |
| 3300011119|Ga0105246_11595608 | Not Available | 616 | Open in IMG/M |
| 3300011120|Ga0150983_14049606 | Not Available | 794 | Open in IMG/M |
| 3300011120|Ga0150983_14465150 | Not Available | 1237 | Open in IMG/M |
| 3300011120|Ga0150983_14465150 | Not Available | 1237 | Open in IMG/M |
| 3300011120|Ga0150983_15878294 | Not Available | 559 | Open in IMG/M |
| 3300011120|Ga0150983_15878294 | Not Available | 559 | Open in IMG/M |
| 3300012931|Ga0153915_11203349 | Not Available | 885 | Open in IMG/M |
| 3300012931|Ga0153915_11203349 | Not Available | 885 | Open in IMG/M |
| 3300012982|Ga0168317_1003605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6582 | Open in IMG/M |
| 3300012982|Ga0168317_1003605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6582 | Open in IMG/M |
| 3300013100|Ga0157373_11082435 | Not Available | 601 | Open in IMG/M |
| 3300013296|Ga0157374_10155839 | All Organisms → cellular organisms → Bacteria | 2223 | Open in IMG/M |
| 3300013296|Ga0157374_11171627 | Not Available | 790 | Open in IMG/M |
| 3300013306|Ga0163162_11069472 | Not Available | 914 | Open in IMG/M |
| 3300013308|Ga0157375_11822192 | Not Available | 722 | Open in IMG/M |
| 3300014325|Ga0163163_10724122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1058 | Open in IMG/M |
| 3300014325|Ga0163163_10866281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300014501|Ga0182024_10659386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1299 | Open in IMG/M |
| 3300014969|Ga0157376_10276648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1579 | Open in IMG/M |
| 3300014969|Ga0157376_10276648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1579 | Open in IMG/M |
| 3300017959|Ga0187779_10438948 | Not Available | 857 | Open in IMG/M |
| 3300017959|Ga0187779_10734613 | Not Available | 670 | Open in IMG/M |
| 3300020580|Ga0210403_11322968 | Not Available | 549 | Open in IMG/M |
| 3300025899|Ga0207642_10350703 | Not Available | 870 | Open in IMG/M |
| 3300025906|Ga0207699_10733993 | Not Available | 724 | Open in IMG/M |
| 3300025906|Ga0207699_10733993 | Not Available | 724 | Open in IMG/M |
| 3300025906|Ga0207699_11108466 | Not Available | 586 | Open in IMG/M |
| 3300025907|Ga0207645_10366222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300025911|Ga0207654_10846879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300025913|Ga0207695_11249365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 623 | Open in IMG/M |
| 3300025922|Ga0207646_10366415 | Not Available | 1302 | Open in IMG/M |
| 3300025927|Ga0207687_10684760 | Not Available | 869 | Open in IMG/M |
| 3300025927|Ga0207687_10684760 | Not Available | 869 | Open in IMG/M |
| 3300025927|Ga0207687_11650392 | Not Available | 550 | Open in IMG/M |
| 3300025933|Ga0207706_10070331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 3078 | Open in IMG/M |
| 3300025935|Ga0207709_10037908 | All Organisms → cellular organisms → Bacteria | 2867 | Open in IMG/M |
| 3300025935|Ga0207709_10268106 | Not Available | 1255 | Open in IMG/M |
| 3300025935|Ga0207709_10706983 | Not Available | 807 | Open in IMG/M |
| 3300025935|Ga0207709_11065204 | Not Available | 663 | Open in IMG/M |
| 3300025936|Ga0207670_10834748 | Not Available | 769 | Open in IMG/M |
| 3300025938|Ga0207704_10299697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
| 3300025944|Ga0207661_10043094 | All Organisms → cellular organisms → Bacteria | 3560 | Open in IMG/M |
| 3300025961|Ga0207712_10918716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300026023|Ga0207677_10852713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300026023|Ga0207677_11176830 | Not Available | 701 | Open in IMG/M |
| 3300026078|Ga0207702_12025242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300027842|Ga0209580_10638610 | Not Available | 527 | Open in IMG/M |
| 3300027854|Ga0209517_10005407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16276 | Open in IMG/M |
| 3300027854|Ga0209517_10014647 | All Organisms → cellular organisms → Bacteria | 7992 | Open in IMG/M |
| 3300027854|Ga0209517_10014647 | All Organisms → cellular organisms → Bacteria | 7992 | Open in IMG/M |
| 3300027854|Ga0209517_10014647 | All Organisms → cellular organisms → Bacteria | 7992 | Open in IMG/M |
| 3300027854|Ga0209517_10014647 | All Organisms → cellular organisms → Bacteria | 7992 | Open in IMG/M |
| 3300027854|Ga0209517_10014647 | All Organisms → cellular organisms → Bacteria | 7992 | Open in IMG/M |
| 3300027905|Ga0209415_10023813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9254 | Open in IMG/M |
| 3300028792|Ga0307504_10096459 | Not Available | 934 | Open in IMG/M |
| 3300028800|Ga0265338_10569860 | Not Available | 791 | Open in IMG/M |
| 3300028800|Ga0265338_10569860 | Not Available | 791 | Open in IMG/M |
| 3300030002|Ga0311350_10442132 | Not Available | 1167 | Open in IMG/M |
| 3300031057|Ga0170834_100419709 | Not Available | 605 | Open in IMG/M |
| 3300031057|Ga0170834_102346640 | Not Available | 649 | Open in IMG/M |
| 3300031231|Ga0170824_116860232 | Not Available | 520 | Open in IMG/M |
| 3300031231|Ga0170824_126263382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 980 | Open in IMG/M |
| 3300031232|Ga0302323_101717074 | Not Available | 710 | Open in IMG/M |
| 3300031474|Ga0170818_102848420 | Not Available | 532 | Open in IMG/M |
| 3300031595|Ga0265313_10003166 | All Organisms → cellular organisms → Bacteria | 13586 | Open in IMG/M |
| 3300031595|Ga0265313_10003166 | All Organisms → cellular organisms → Bacteria | 13586 | Open in IMG/M |
| 3300031726|Ga0302321_102498649 | Not Available | 603 | Open in IMG/M |
| 3300032160|Ga0311301_10842320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1249 | Open in IMG/M |
| 3300032160|Ga0311301_10862028 | Not Available | 1229 | Open in IMG/M |
| 3300032160|Ga0311301_11137972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1010 | Open in IMG/M |
| 3300032515|Ga0348332_10772979 | Not Available | 545 | Open in IMG/M |
| 3300033475|Ga0310811_11070240 | Not Available | 691 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 15.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 10.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 7.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.29% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.29% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.97% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.97% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.32% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.32% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.32% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.32% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.32% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.66% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.66% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.66% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.66% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.66% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300004119 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF210 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004961 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 83 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004964 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100268963 | 3300000567 | Peatlands Soil | MKLSGSVLLLIGMGSFVFGINVPEISPASAGSAIALISGAVLVMRGRRKE* |
| JGI12270J11330_100596802 | 3300000567 | Peatlands Soil | MKIIGAMLLLVGMGGAAFATGVPEISPASAGSAIALISGAVLVMRGRRKK* |
| JGI12270J11330_100596804 | 3300000567 | Peatlands Soil | VRLVGSILLLIGVVSAAFATPSVPEISPASAGSAIALISGAVLVMRGRRSK* |
| JGI12270J11330_100596805 | 3300000567 | Peatlands Soil | MKIIGAMLLLVGMGSAAFASVPEISPASAGSAIALISGAVLVMRGRRSK* |
| Ga0058887_12345392 | 3300004119 | Forest Soil | SRSISKEIQVKLLGSVLLLIGMGSIAFATPTPEISPASAGSAIALISGAVLVMRGRRKN* |
| Ga0063356_1002935293 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VKLLGNMLLLIGLGSLAFAQTAPVPEISPASAGSALALVSGVLLVMRGRRK* |
| Ga0072333_11424531 | 3300004961 | Peatlands Soil | RLVGSILLLIGVVSAAFATPSVPEISPASAGSAIALISGAVLVMRGRRSK* |
| Ga0072333_11424533 | 3300004961 | Peatlands Soil | VKLIGAMVLLMGMGTFASALNVSAPEISPASAGSAIALIAGAVLVMRGRRKKQNLSKVKETL* |
| Ga0072331_11735291 | 3300004964 | Peatlands Soil | GDAVRLVGSILLLIGVVSAAFATPSVPEISPASAGSAIALISGAVLVMRGRRSK* |
| Ga0070683_1000215503 | 3300005329 | Corn Rhizosphere | VLLLIGMGSAAFASPVPEINPASAGSALALISGAVLVMRGRRKK* |
| Ga0070683_1000755463 | 3300005329 | Corn Rhizosphere | LKLLGYMLLLMGMGSAAFATAVPEINPASASSALALVSGALLVMRGRRKK* |
| Ga0070683_1008313441 | 3300005329 | Corn Rhizosphere | VKLLGSVLLFIGVGGAAFATAVPEINPASAGSAIALVSGALLVMRGRRKK* |
| Ga0066388_1003403493 | 3300005332 | Tropical Forest Soil | LKNILGMLLLVLGYSAFASAAIVGAPEVDPASAGSALALLSGAVMVIRGRRRK* |
| Ga0068869_1000315341 | 3300005334 | Miscanthus Rhizosphere | MLLLMGMGSAAFATAVPEINPASAGSALALVSGALLVMRGRRKK* |
| Ga0068869_1012132501 | 3300005334 | Miscanthus Rhizosphere | VKLLGSVLLFIGVGSMAFGVTAVPEINPASVGSALALISGALLVMGGRRKK* |
| Ga0068869_1012132502 | 3300005334 | Miscanthus Rhizosphere | MKLLGSILLLIGVGSVAFAQPAPTPEISPASTGSALALISGALLVMGGRRKK* |
| Ga0068868_1002651052 | 3300005338 | Miscanthus Rhizosphere | MKLLGSILLLIGVGSVAFAQPAPTPEISPASAGSALALLSGALLVMGGRRRK* |
| Ga0068868_1013460682 | 3300005338 | Miscanthus Rhizosphere | VKLLGSVLLFIGVGGAAFATAVPEINPASAGSAIALVSGALLVMRGRRK |
| Ga0070689_1019384762 | 3300005340 | Switchgrass Rhizosphere | MKLLGSILLLIGVGSVAFAQPAPTPEISPASAGSALALLSGLLLVMRGRRRK* |
| Ga0070692_104589682 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MGMGSAAFGTAVAAPEISPASASSALALVSGVMLVMRGRRK* |
| Ga0070673_1001507541 | 3300005364 | Switchgrass Rhizosphere | LLFVGVGSMAFGLTAVPEISPASTGSALALISGALLVMGGRRKK* |
| Ga0070673_1001507542 | 3300005364 | Switchgrass Rhizosphere | MKLLGSILLLIGVGSVAFAQPAPTPEISPASAGSALALISGALLVMGGRRKK* |
| Ga0070709_107852192 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGFILLSIGAGSVAFGISVVPEINPAAAGSAIALISGTVLVMRGRRKN* |
| Ga0070709_115284171 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVLGSMLLLIGMASSAMAQVQTPEVSPASAVGALALISGGLLVMRGRRSK* |
| Ga0070709_115284172 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGSILLLIGTGSMAFASVPEISPASAGSAIALISGAVLVMRGRRTK* |
| Ga0070713_1003040741 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLLGMMLLLIGVGSVASAIPAAPEISPASAGSALALISGAVLVMRGRRKK* |
| Ga0070711_1006161401 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLLGMMLLLIGVGSVASAIPAAPEISPASAGSALALISGAVLVIRGRREK* |
| Ga0070711_1006161402 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MIMKFAGITLVLTGLSGAAMALQVSAPEVSPVSAGSAIALIAGAVLIMRGRRKQ* |
| Ga0070711_1007375172 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLIGSILLLVGMGSMAFATVPEVSPASAGSAIALISGAVLVMRGRRKK* |
| Ga0070711_1013116372 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLTGSILLLIGMGCVAFGQPAPTPEVSPASAGSALALIAGAVLVIRGRRKK* |
| Ga0068867_1005079441 | 3300005459 | Miscanthus Rhizosphere | LKLLGYMLLLMGMGSAAFATAVPEISPASASSALALVSGALLVMRGRKK* |
| Ga0070684_1007939881 | 3300005535 | Corn Rhizosphere | LLIGMGSAAFASPVPEINPASAGSALALISGAVLVMRGRRKK* |
| Ga0070731_104879103 | 3300005538 | Surface Soil | MRMKLVGITLLLVGLSSVAMALETTAPEISPVSAGSAVALIAGAVLVMRGRRKN* |
| Ga0068853_1000564523 | 3300005539 | Corn Rhizosphere | MLLLMGMGSAAFGTAVAAPEISPASASSALALVSGVMLVMRGRRK* |
| Ga0068853_1005414471 | 3300005539 | Corn Rhizosphere | MLLLMGMGSAAFATAVPEINPASASSALALVSGALLVMRGRRK |
| Ga0070732_109750581 | 3300005542 | Surface Soil | VKLIGSMLLLVGMGSFAFAITAVPEVSAASAGSAVALISGALLVMRGRRKK* |
| Ga0070672_1015348462 | 3300005543 | Miscanthus Rhizosphere | PSGRRFTMKLLGSILLLIGVGSVAFAQPAPTPEISPASAGSALALLSGVLLVMGGRRRK* |
| Ga0070693_1013761382 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LKLLGYMLLLMGMGSAAFATAVPEINPASASSALALVSGALLVM |
| Ga0070664_1000515114 | 3300005564 | Corn Rhizosphere | MGMGSAAFGTAVAAPEISPASASSALALVSGVLLVMRGRRK* |
| Ga0070664_1014112401 | 3300005564 | Corn Rhizosphere | VKLLGSVLLFVGVGSMAFGLTAVPEISPASTGSALALISGALLVMGGRRKK* |
| Ga0070702_1014733571 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | PSGRRFTMKLLGSILLLIGVGSVAFAQPAPTPEISPASAGSALALISGALLVMGGRRKK* |
| Ga0068861_1014314771 | 3300005719 | Switchgrass Rhizosphere | LKLVGYMLLLMGMGSAAFATAVPEINPASAGSALALVSGALLVMRGRRKK* |
| Ga0074479_105732311 | 3300005829 | Sediment (Intertidal) | MKLLATMLLLIGVGSVAFAQPAPTPEISPASAGSALALISGALLVMRGRRKK* |
| Ga0074479_105732312 | 3300005829 | Sediment (Intertidal) | VKVLGSVLLFIGVASAAFGLVYVATPEISPASAGSALALISGALLVMGGRRKK* |
| Ga0068863_1027303321 | 3300005841 | Switchgrass Rhizosphere | VKLLGSVLLFIGVGSMAFGVTAVPEINPASVGSALALISGAL |
| Ga0070715_105728992 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VKFAGFVLLMMGMGSAAFATAVPEISPASAGSALALVSGALLVMRGGRKK* |
| Ga0097621_1001418682 | 3300006237 | Miscanthus Rhizosphere | VKLLGTVLLFIGVGGAAFATAVPEISPASAGSAIALISGAVLVMRGRKK* |
| Ga0097621_1015014192 | 3300006237 | Miscanthus Rhizosphere | VRLLGSVLLFIGVGGAAFATAVPEINPASAGSAIALISGAVLVMRGRRKK* |
| Ga0068871_1014181502 | 3300006358 | Miscanthus Rhizosphere | LKLLGYMLLLMGMGSAAFATAVPEINPASASSAVALVSGALLVMRGRRKK* |
| Ga0075522_101134622 | 3300006638 | Arctic Peat Soil | VRILGTTLLLIGMASFVSASVPEISSASAGSALALVSGALLVIRGRRKK* |
| Ga0079222_120653041 | 3300006755 | Agricultural Soil | VKLLGTALLLIGMGSAAFATVVPEISPVSAGSAIALISGAVLVMRGRRRK* |
| Ga0075429_1018644742 | 3300006880 | Populus Rhizosphere | MKLLGSVLLFIGVGSIAFGFTPAPVPEISPASASSALALISGALLVMGGRRKK* |
| Ga0068865_1002858981 | 3300006881 | Miscanthus Rhizosphere | LKLVGYMLLLMGMGSAAFATAVPEIDPASAGSALALVSGALLVMRGRRKK* |
| Ga0073928_106132652 | 3300006893 | Iron-Sulfur Acid Spring | MVRTLGRVFLLLGMGSFVFATAAVSEVSPAPAGSAVALICGAVLVLRGKR |
| Ga0073928_106794502 | 3300006893 | Iron-Sulfur Acid Spring | LLGSMLLLSGMGCVAFAQVQTPEISPASTVTALALVSGFLLVMRGRRKK* |
| Ga0079219_118314281 | 3300006954 | Agricultural Soil | LKTLGMMLLLIGVSGAAFAVTAVPEISPASAGSALALISGAVLVIRGRRKQ* |
| Ga0105245_102059942 | 3300009098 | Miscanthus Rhizosphere | MLLLMGMGSAAFGTAVAAPEISPASASSALALVSGVLLVMRGRRK* |
| Ga0105245_105303383 | 3300009098 | Miscanthus Rhizosphere | MKVLGSVLLLIGMASMTFATVAPEVNPASAGSAIALISGAVLVMRGRRKN* |
| Ga0105245_113072442 | 3300009098 | Miscanthus Rhizosphere | RVKLLGSVLLFIGVGGAAFATAVPEINPASAGSAIALVSGALLVMRGRRKK* |
| Ga0105245_120708132 | 3300009098 | Miscanthus Rhizosphere | MGMGSAVFGAAVAAPEISPASAGSALAFVSGALMVMRGRRKK* |
| Ga0105243_107570732 | 3300009148 | Miscanthus Rhizosphere | MSKIVMRRSIVKLLGSVLLFIGVGSMAFGVTAVPEINPASVGSALALISGALLVMGGRRKK* |
| Ga0105243_124666572 | 3300009148 | Miscanthus Rhizosphere | MLLLMGMGSAAFATAVPEISPASASSALALVSGALLVMRGRKK* |
| Ga0105241_101254502 | 3300009174 | Corn Rhizosphere | MLLLMGMGSAAFATAVPEINPASASSAVALVSGALLVMRGRRKK* |
| Ga0105242_117140712 | 3300009176 | Miscanthus Rhizosphere | MAFGLTAVPEISPASTGSALALISGALLVMGGRRKK* |
| Ga0105242_131158601 | 3300009176 | Miscanthus Rhizosphere | MLLLVGMGSAAFASGPASVPEIGPVSASGAIALIASAVLVMRGRRKK* |
| Ga0105248_133877092 | 3300009177 | Switchgrass Rhizosphere | MMLLLVGMGSAAFASGPASVPEIGPLSASGAIALIASAVLVMRGRRKK* |
| Ga0116221_15339081 | 3300009523 | Peatlands Soil | MKIIGAMLLLVGMGSAAFAWVPEISPASAGSAIALISGAVLVMRGRRSK* |
| Ga0105238_102463852 | 3300009551 | Corn Rhizosphere | MLLLMGMGSAAFATAVPEINPASASSALALVSGALLVMRGRRKK* |
| Ga0105238_114789752 | 3300009551 | Corn Rhizosphere | KLLGSVLLFIGVGGAAFATAVPEINPASAGSAIALVSGALLVMRGRRKK* |
| Ga0105238_130414051 | 3300009551 | Corn Rhizosphere | MLLLMGMGSAAFATAVPEISPASASSALALVSGALLVMRG |
| Ga0116223_100381202 | 3300009839 | Peatlands Soil | MSQWLLIGMGSAAFATPAPEINPASAGSAIALISGVVLVMRGRRSRRY* |
| Ga0105239_114907782 | 3300010375 | Corn Rhizosphere | KRQLLKSKEKLVVKLLGTVLLFIGVGGAAFATAVPEISPASAGSAIALISGAVLVMRGRKK* |
| Ga0105239_135291012 | 3300010375 | Corn Rhizosphere | VKLLGMMLLLVGMGSAAFASGPASVPEIGPVSASGAIALIASAVLVMRGRRKK* |
| Ga0136449_10000059181 | 3300010379 | Peatlands Soil | LIGVVSAAFATPSVPEISPASAGSAIALISGAVLVMRGRRSK* |
| Ga0136449_10000059182 | 3300010379 | Peatlands Soil | MVLLMGMGTFASALNVSAPEISPASAGSAIALIAGAVLVMRGRRKKQNLSKVKETL* |
| Ga0136449_1001967665 | 3300010379 | Peatlands Soil | VKLIGSILLLIGVGTAVFATPSVPEINPASAGSAIALISGAVLLMRGRRKK* |
| Ga0136449_1001967666 | 3300010379 | Peatlands Soil | MKVLGQVLLFIGVGSVAFGGAPPAPEISSASAGSAIALISGAVLVMRGRRKK* |
| Ga0136449_1008939793 | 3300010379 | Peatlands Soil | MKFVGITLLLMGLSSAAMALQATVPEVSPVSAGSALALIAGAVLVMRGRRKK* |
| Ga0134122_102119222 | 3300010400 | Terrestrial Soil | MLLLMGMGSAAFAVATVPEINPASAGSALALVSGALLVMRGRRKK* |
| Ga0105246_115956081 | 3300011119 | Miscanthus Rhizosphere | MKLLGSVLLFIGVGSMAFGFTAVAPEISPASAGSALALISGALLVMGGRRKK* |
| Ga0150983_140496062 | 3300011120 | Forest Soil | MRLLGSILLLIGMGSAAFATVPEISPASAGSAIALISGAVLVMRGRRKK* |
| Ga0150983_144651502 | 3300011120 | Forest Soil | MGSAAFASVPEISPASAGSAIALISGAVLVMRGRRKK* |
| Ga0150983_144651503 | 3300011120 | Forest Soil | LKEIYMELLGSVLLLIGVGGAAFAATPEVSPASAGSAIALISGAVLVMRGRRKK* |
| Ga0150983_158782941 | 3300011120 | Forest Soil | RSRGNQKSKRSFSMKLLGMVLLFIGLGSAAFGGSPAPEISLGSAGSALTLISGVLLVMGGRRRK* |
| Ga0150983_158782942 | 3300011120 | Forest Soil | VKLLGGILLLMGMGSIAFATPTPEISPASAGSAIALISGAVLVMRGRRKK* |
| Ga0153915_112033492 | 3300012931 | Freshwater Wetlands | MKLLGSALLLIGMGCLVFAQPAPVPEISPASAGSALALISGMLLVMRGRRGK* |
| Ga0153915_112033494 | 3300012931 | Freshwater Wetlands | MLLMIGLGGAAFGISVAVPEISPASAGSALALVSGLVLVMRGRRKK* |
| Ga0168317_10036056 | 3300012982 | Weathered Mine Tailings | MKLLGSTLLLIGMSSLAFGTSVPEVSSASAGSAIALISGALLVMRGRRKK* |
| Ga0168317_10036057 | 3300012982 | Weathered Mine Tailings | MKLLGSVLLLIGMSSAAFAQIAPVPEISALTGVNAVCLIAGAVVVMRGRRKR* |
| Ga0157373_110824351 | 3300013100 | Corn Rhizosphere | NSKGDLRVKLLGSVLLFIGVGGAAFATAVPEINPASAGSAIALVSGALLVMRGRRKK* |
| Ga0157374_101558392 | 3300013296 | Miscanthus Rhizosphere | VKILGGVLLLIGMGGAAFANAVPEINPASAGSALALISGAVLVMRGRRKK* |
| Ga0157374_111716271 | 3300013296 | Miscanthus Rhizosphere | HKTKSSKGDPRMKLVGSVLLLIGMGSAAFAAPVPEISPASAGSAIALISGAVLVMRGRRKK* |
| Ga0163162_110694722 | 3300013306 | Switchgrass Rhizosphere | VGYMLLLMGMGSAAFATAVPEIDPASAGSALALVSGALLVMRGRRKK* |
| Ga0157375_118221922 | 3300013308 | Miscanthus Rhizosphere | MKLLGSILLLIGVGSVAFAQPAPTPEISPASAGSALALLSGVLLVMGGRRRK* |
| Ga0163163_107241221 | 3300014325 | Switchgrass Rhizosphere | SVLLFIGVGSAAFATAVPEINPASAGSAIALISGAVLVMRGRRKK* |
| Ga0163163_108662811 | 3300014325 | Switchgrass Rhizosphere | MLLLMGMGSAAFGTAVAAPEISLASASSALALVSGVLLVMRGR |
| Ga0182024_106593862 | 3300014501 | Permafrost | MKLLGCVLLFIGVGSVAFASVPEISPASAGSAIALISGAVLVMRGRRKK* |
| Ga0157376_102766482 | 3300014969 | Miscanthus Rhizosphere | MGSLLLLIGLGSVAFAQVAPAPEISPASAGSALALLSGAVLVMRGRRKK* |
| Ga0157376_102766483 | 3300014969 | Miscanthus Rhizosphere | VKFAGFVLLMIGAGSAAFAVATVPEISPASAGSALALVSGALLVMRGRRQK* |
| Ga0187779_104389482 | 3300017959 | Tropical Peatland | VKIVGCVLLLIGMGSAAFAVSAAPEISPASAGSAIALISGAVLVMRGSRNK |
| Ga0187779_107346132 | 3300017959 | Tropical Peatland | MMKLLGSILLLMGVTSAAFATSVPEISPASAGSAIALIAGAVLVIRGRRNSRY |
| Ga0210403_113229682 | 3300020580 | Soil | VKLIGSVLLLIGMGGAAFAQVAPVPEISPVPAGSAVALIAGAVLVMRGRRKK |
| Ga0207642_103507031 | 3300025899 | Miscanthus Rhizosphere | MLLLMGMGSAAFATAVPEISPASASSALALVSGALLVMRGRKK |
| Ga0207699_107339931 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLASMLLLIGMASFAMAQVQTPEVNPASAVGALALISGGLLV |
| Ga0207699_107339932 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGFILLSIGAGSVAFGISVVPEINPAAAGSAIALISGTVLVMRGRRKN |
| Ga0207699_111084662 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | YYILTKDAFRRRLNMKLLGSILLLIGTGSMAFASVPEISPASAGSAIALISGAVLVMRGRRTK |
| Ga0207645_103662222 | 3300025907 | Miscanthus Rhizosphere | MLLLMGMGSAAFATAVPEINPASAGSALALVSGALLVMRGRRKK |
| Ga0207654_108468792 | 3300025911 | Corn Rhizosphere | MLLLMGMGSAAFATAVPEINPASASSAVALVSGALLVMRGRRKK |
| Ga0207695_112493651 | 3300025913 | Corn Rhizosphere | LKLLGYMLLLMGMGSAAFATAVPEINPASASSALALVSGALL |
| Ga0207646_103664152 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLLGMMLLLIGVGSVASAIPAAPEISPASAGSALALISGAVLVIRGRREK |
| Ga0207687_106847602 | 3300025927 | Miscanthus Rhizosphere | MKVLGSVLLLIGMASMTFATVAPEVNPASAGSAIALISGAVLVMRGRRKN |
| Ga0207687_106847603 | 3300025927 | Miscanthus Rhizosphere | LIGLGSAVYGGPATAPEVNPASAGSALALISGVVLVLRGRRRKG |
| Ga0207687_116503922 | 3300025927 | Miscanthus Rhizosphere | VKLVGSLLLLMGMGSAVFGAAVAAPEISPASAGSALAFVSGALMVMRGRRKK |
| Ga0207706_100703313 | 3300025933 | Corn Rhizosphere | MGMGSAAFGTAVAAPEISPASASSALALVSGVLLVMRGRRK |
| Ga0207709_100379082 | 3300025935 | Miscanthus Rhizosphere | LKLVGYMLLLMGMGSAAFATAVPEINPASAGSALALVSGALLVMRGRRKK |
| Ga0207709_102681061 | 3300025935 | Miscanthus Rhizosphere | LRLLGYMLLLMGMGSAAFGTAVAAPEISPASASSALALVSGVLL |
| Ga0207709_107069832 | 3300025935 | Miscanthus Rhizosphere | MKLLGSILLLIGVGSVAFAQPAPTPEISPASAGSALALLSGALLVMGGRRRK |
| Ga0207709_110652041 | 3300025935 | Miscanthus Rhizosphere | SLAVAGALIAAPEISPASGAAALAMVSGALLVVRGRRK |
| Ga0207670_108347481 | 3300025936 | Switchgrass Rhizosphere | VKLLGSVLLFIGVGSMAFGVTAVPEINPASVGSALALISGALLVMGGRRKK |
| Ga0207704_102996972 | 3300025938 | Miscanthus Rhizosphere | LRLLGYMLLLMGMGSAAFATAVPEIDPASAGSALALVSGALLVMRGRRKK |
| Ga0207661_100430943 | 3300025944 | Corn Rhizosphere | VKLLGGVLLLIGMGSAAFASPVPEINPASAGSALALISGAVLVMRGRRKK |
| Ga0207712_109187161 | 3300025961 | Switchgrass Rhizosphere | MAFGLTAVPEISPASTGSALALISGALLVMGGRRKK |
| Ga0207677_108527133 | 3300026023 | Miscanthus Rhizosphere | AVAGALIAAPEISPASGAAALAMVSGALLVVRGRRK |
| Ga0207677_111768301 | 3300026023 | Miscanthus Rhizosphere | VTLKLVGYMLLLMGMGSAAFATAVPEINPASAGSALALVSGALLVMRGRRKK |
| Ga0207702_120252421 | 3300026078 | Corn Rhizosphere | LKLLGYMLLLMGMGSAAFATAVPEINPASASSAVALVSG |
| Ga0209580_106386101 | 3300027842 | Surface Soil | VKLIGSMLLLVGMGSFAFAITAVPEVSAASAGSAVALISGALLVMRGRRKK |
| Ga0209517_100054073 | 3300027854 | Peatlands Soil | MKLSGSVLLLIGMGSFVFGINVPEISPASAGSAIALISGAVLVMRGRRKE |
| Ga0209517_1001464710 | 3300027854 | Peatlands Soil | VKLIGAMVLLMGMGTFASALNVSAPEISPASAGSAIALIAGAVLVMRGRRKKQNLSKVKETL |
| Ga0209517_1001464711 | 3300027854 | Peatlands Soil | MKIIGAMLLLVGMGGAAFATGVPEISPASAGSAIALISGAVLVMRGRRKK |
| Ga0209517_1001464712 | 3300027854 | Peatlands Soil | MSQWLLIGMGSAAFATPAPEINPASAGSAIALISGVVLVMRGRRSRRY |
| Ga0209517_100146478 | 3300027854 | Peatlands Soil | MKIIGAMLLLVGMGSAAFASVPEISPASAGSAIALISGAVLVMRGRRSK |
| Ga0209517_100146479 | 3300027854 | Peatlands Soil | LIGVVSAAFATPSVPEISPASAGSAIALISGAVLVMRGRRSK |
| Ga0209415_1002381310 | 3300027905 | Peatlands Soil | VKLIGAMVLLMGMGTFASALNVSAPEISPASAGSAIALIAGAVLGMRG |
| Ga0307504_100964592 | 3300028792 | Soil | VRLSGIILLLIGMSCVAFAQVQTPEISPASAGTAVALIAGAVLVMRGRRKK |
| Ga0265338_105698602 | 3300028800 | Rhizosphere | VKLLGSVLLLIGVGSAAFASGVPEVSPASAGSAIALISGAVLVMRGRRKK |
| Ga0265338_105698603 | 3300028800 | Rhizosphere | VRLIGAMVLLMGMGTFASALNVSAPEISPASAGSAIALISGAVLVMRGRRKK |
| Ga0311331_106904121 | 3300029954 | Bog | VGASVFAMADFTTPEINPASAGSAIALVSGALLVYRGRRK |
| Ga0311350_104421322 | 3300030002 | Fen | VKKLIGMFLLLIGASTLALADVVAAPEISPASAGSALALVSGALLIYRGRR |
| Ga0170834_1004197092 | 3300031057 | Forest Soil | VKLLGSILLLIAMGSVAWAQVAPAPEVNPSSAGTALALISGAVLVMRGRRKK |
| Ga0170834_1023466402 | 3300031057 | Forest Soil | LLFIGVGSAAFAVPAVPEISPVSAGSAIALISGAVLVMRGRRKK |
| Ga0170824_1168602321 | 3300031231 | Forest Soil | SSTTFSRVFKSKGDLRVRLLGTVLLFIGVGSAAFAVPAVPEISPVSAGSAIALISGAVLVMRGRRKK |
| Ga0170824_1262633822 | 3300031231 | Forest Soil | VKLLGSILLLIAMGSVAFAQVAPAPEISPSSAGTALALISGAVLVMRGRRKK |
| Ga0302323_1017170741 | 3300031232 | Fen | VKKLNGMFLLLIGASTLALADVVAAPEISPASAGSALALVSGALLIYRGRR |
| Ga0170818_1028484201 | 3300031474 | Forest Soil | MLLIAMGSVAFAQVAPAPEISPSSAGTALALISGAVLVMRGRRKK |
| Ga0265313_100031663 | 3300031595 | Rhizosphere | MRLIGSILLLIGMATFAVAQSVAPEISPASAGSAIALISGAVLVMRGRRKK |
| Ga0265313_100031664 | 3300031595 | Rhizosphere | MKLLGTILLLIGMGSMVFATPSVPEISPASAGSAIALISGAVLVMRGRRKK |
| Ga0302321_1024986492 | 3300031726 | Fen | MRILGVVLLLVGLGSAAFAGPATAPEINPASAGSALALVSGLVLVIRGRRKK |
| Ga0311301_108423203 | 3300032160 | Peatlands Soil | MSMKFVGITLLLMGLSSAAMALQATVPEVSPVSAGSALALIAGAVLVMRGRRKK |
| Ga0311301_108620281 | 3300032160 | Peatlands Soil | VKLIGSILLLIGVGTAVFATPSVPEINPASAGSAIALISGAVLLMRGRRKK |
| Ga0311301_111379722 | 3300032160 | Peatlands Soil | MKVLGQVLLFIGVGSVAFGGAPPAPEISSASAGSAIALISGAVLVMRGRRKK |
| Ga0348332_107729792 | 3300032515 | Plant Litter | PVVRKSEGDFKMKLLGCVLLFIGVGSVAFAGVPEISPASAGSAIALISGAVLVMRGRRKK |
| Ga0310811_110702402 | 3300033475 | Soil | MKLFGSMLLVMGMGCVAFAQAVPAPEVSPASAGSALALIAGAVLVMRGRRKK |
| ⦗Top⦘ |