| Basic Information | |
|---|---|
| Family ID | F046038 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 41 residues |
| Representative Sequence | YHTQGTYQGKPYDHVGRFTDTWVLDLGKWQCVASHTSLLKK |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.37 % |
| % of genes from short scaffolds (< 2000 bps) | 86.84 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.737 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.816 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.368 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.684 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.78% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF00892 | EamA | 34.87 |
| PF10415 | FumaraseC_C | 13.82 |
| PF14534 | DUF4440 | 1.97 |
| PF03724 | META | 1.32 |
| PF08281 | Sigma70_r4_2 | 1.32 |
| PF03129 | HGTP_anticodon | 1.32 |
| PF12804 | NTP_transf_3 | 0.66 |
| PF15902 | Sortilin-Vps10 | 0.66 |
| PF13563 | 2_5_RNA_ligase2 | 0.66 |
| PF02452 | PemK_toxin | 0.66 |
| PF07676 | PD40 | 0.66 |
| PF13520 | AA_permease_2 | 0.66 |
| PF12838 | Fer4_7 | 0.66 |
| PF01432 | Peptidase_M3 | 0.66 |
| PF14088 | DUF4268 | 0.66 |
| PF00326 | Peptidase_S9 | 0.66 |
| PF03466 | LysR_substrate | 0.66 |
| PF12891 | Glyco_hydro_44 | 0.66 |
| PF06271 | RDD | 0.66 |
| PF00117 | GATase | 0.66 |
| PF01491 | Frataxin_Cyay | 0.66 |
| PF08545 | ACP_syn_III | 0.66 |
| PF04542 | Sigma70_r2 | 0.66 |
| PF00440 | TetR_N | 0.66 |
| PF00282 | Pyridoxal_deC | 0.66 |
| PF05016 | ParE_toxin | 0.66 |
| PF04120 | Iron_permease | 0.66 |
| PF08238 | Sel1 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.32 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 1.32 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.32 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.32 |
| COG3187 | Heat shock protein HslJ | Posttranslational modification, protein turnover, chaperones [O] | 1.32 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.66 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.66 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.66 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.66 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.66 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.66 |
| COG1965 | Fe-S cluster assembly protein CyaY, frataxin homolog | Inorganic ion transport and metabolism [P] | 0.66 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.66 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.39 % |
| Unclassified | root | N/A | 4.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16497862 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300000567|JGI12270J11330_10204078 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101073082 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300005167|Ga0066672_10011880 | All Organisms → cellular organisms → Bacteria | 4242 | Open in IMG/M |
| 3300005436|Ga0070713_101687305 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005439|Ga0070711_101522292 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005538|Ga0070731_10825616 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005541|Ga0070733_10041727 | All Organisms → cellular organisms → Bacteria | 2864 | Open in IMG/M |
| 3300005541|Ga0070733_10483694 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300005542|Ga0070732_10695632 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005556|Ga0066707_10229836 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300005557|Ga0066704_10494928 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300005602|Ga0070762_10808436 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005764|Ga0066903_100235868 | All Organisms → cellular organisms → Bacteria | 2798 | Open in IMG/M |
| 3300005921|Ga0070766_10668158 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300006052|Ga0075029_100078649 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| 3300006162|Ga0075030_100990179 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300006163|Ga0070715_10614500 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300006173|Ga0070716_100033924 | All Organisms → cellular organisms → Bacteria | 2795 | Open in IMG/M |
| 3300006175|Ga0070712_100143551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1825 | Open in IMG/M |
| 3300006176|Ga0070765_100654847 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300006893|Ga0073928_10271295 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300009089|Ga0099828_11856978 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300009644|Ga0116121_1147283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300009665|Ga0116135_1310056 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300009700|Ga0116217_10421720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300010343|Ga0074044_10687079 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300010358|Ga0126370_11795795 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300010362|Ga0126377_10182176 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
| 3300010366|Ga0126379_10956037 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300010376|Ga0126381_102585318 | Not Available | 727 | Open in IMG/M |
| 3300010376|Ga0126381_103112045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300010376|Ga0126381_104209432 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300012202|Ga0137363_11191990 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012203|Ga0137399_11787343 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012205|Ga0137362_10834582 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300012205|Ga0137362_11739661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300012363|Ga0137390_10154942 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
| 3300012582|Ga0137358_10370837 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300012923|Ga0137359_10583804 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300013100|Ga0157373_10389563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300013105|Ga0157369_10610725 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300014155|Ga0181524_10295579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300014157|Ga0134078_10347442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300014164|Ga0181532_10109789 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300014201|Ga0181537_10060588 | All Organisms → cellular organisms → Bacteria | 2565 | Open in IMG/M |
| 3300014654|Ga0181525_10148331 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300014657|Ga0181522_10369386 | Not Available | 856 | Open in IMG/M |
| 3300015241|Ga0137418_10804001 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300015242|Ga0137412_10047015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3519 | Open in IMG/M |
| 3300016371|Ga0182034_11999220 | Not Available | 512 | Open in IMG/M |
| 3300016387|Ga0182040_10559724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
| 3300016404|Ga0182037_11765397 | Not Available | 552 | Open in IMG/M |
| 3300016750|Ga0181505_10448604 | All Organisms → cellular organisms → Eukaryota | 771 | Open in IMG/M |
| 3300017924|Ga0187820_1007164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2632 | Open in IMG/M |
| 3300017927|Ga0187824_10117240 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300017934|Ga0187803_10071252 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300017943|Ga0187819_10210980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1144 | Open in IMG/M |
| 3300017955|Ga0187817_10000122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 26756 | Open in IMG/M |
| 3300017955|Ga0187817_10448038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300017972|Ga0187781_10137591 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300017972|Ga0187781_10663713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300017974|Ga0187777_10206394 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300017995|Ga0187816_10091987 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300018007|Ga0187805_10282280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300018025|Ga0187885_10466123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300018034|Ga0187863_10266528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 952 | Open in IMG/M |
| 3300018035|Ga0187875_10263308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300018042|Ga0187871_10279666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300018062|Ga0187784_10180594 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
| 3300018085|Ga0187772_10827816 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300018085|Ga0187772_10858750 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300018085|Ga0187772_10897830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300018088|Ga0187771_10187809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1712 | Open in IMG/M |
| 3300019786|Ga0182025_1069760 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300020582|Ga0210395_10798756 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300020583|Ga0210401_10452201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
| 3300021170|Ga0210400_10002801 | All Organisms → cellular organisms → Bacteria | 15762 | Open in IMG/M |
| 3300021178|Ga0210408_11218375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300021180|Ga0210396_10131528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2255 | Open in IMG/M |
| 3300021181|Ga0210388_10055364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3312 | Open in IMG/M |
| 3300021181|Ga0210388_10711324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 874 | Open in IMG/M |
| 3300021401|Ga0210393_11303030 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300021403|Ga0210397_11568667 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300021405|Ga0210387_10979341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 741 | Open in IMG/M |
| 3300021405|Ga0210387_11362969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300021407|Ga0210383_10585141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300021432|Ga0210384_10980226 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300021433|Ga0210391_10565535 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300021439|Ga0213879_10252066 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300021474|Ga0210390_11630463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300021477|Ga0210398_11063921 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300021478|Ga0210402_10549846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1071 | Open in IMG/M |
| 3300021479|Ga0210410_10872727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300025419|Ga0208036_1000396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 27245 | Open in IMG/M |
| 3300025496|Ga0208191_1003930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5481 | Open in IMG/M |
| 3300025906|Ga0207699_11461171 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300025916|Ga0207663_10390405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300025916|Ga0207663_10924151 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300025929|Ga0207664_10795824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300026078|Ga0207702_10823546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300026879|Ga0207763_1018333 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300027604|Ga0208324_1187952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300027674|Ga0209118_1124844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300027767|Ga0209655_10073238 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300027795|Ga0209139_10025498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2111 | Open in IMG/M |
| 3300027854|Ga0209517_10422991 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300027867|Ga0209167_10797407 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027884|Ga0209275_10562573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300027889|Ga0209380_10499271 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300027898|Ga0209067_10178872 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300027911|Ga0209698_11024617 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300028020|Ga0265351_1027514 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300028037|Ga0265349_1027382 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300028748|Ga0302156_10187867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300028788|Ga0302189_10404870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300029883|Ga0311327_10238262 | Not Available | 1218 | Open in IMG/M |
| 3300029908|Ga0311341_10435094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300029943|Ga0311340_10684472 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300029999|Ga0311339_10285530 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300030047|Ga0302286_10574399 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300030054|Ga0302182_10216240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300031231|Ga0170824_117599454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031249|Ga0265339_10142006 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300031708|Ga0310686_114480431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300031708|Ga0310686_116800865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300031708|Ga0310686_116991802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1768 | Open in IMG/M |
| 3300031715|Ga0307476_11276110 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031753|Ga0307477_10304881 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300031754|Ga0307475_10379305 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300031879|Ga0306919_10555695 | Not Available | 886 | Open in IMG/M |
| 3300031879|Ga0306919_10914625 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300031941|Ga0310912_10620727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300031962|Ga0307479_10787087 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300031962|Ga0307479_11683373 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031962|Ga0307479_11746057 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031996|Ga0308176_11202118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
| 3300032119|Ga0316051_1007405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300032205|Ga0307472_102346850 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300032782|Ga0335082_11264978 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300032783|Ga0335079_10010758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10420 | Open in IMG/M |
| 3300032783|Ga0335079_11458432 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300032828|Ga0335080_10175192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2368 | Open in IMG/M |
| 3300032828|Ga0335080_10222164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2072 | Open in IMG/M |
| 3300032828|Ga0335080_11211257 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300032892|Ga0335081_10388926 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300033289|Ga0310914_10311057 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300033290|Ga0318519_10644844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300033807|Ga0314866_033301 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300033983|Ga0371488_0318126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300034124|Ga0370483_0000301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14183 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.58% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.26% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.26% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.95% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.29% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.29% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.63% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.63% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.63% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.97% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.32% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.66% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.66% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.66% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.66% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.66% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.66% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.66% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_04001960 | 2088090014 | Soil | QGTYQGKPYDHVGRFTDTWVLDQGKWQCVASHTSLLKK |
| JGI12270J11330_102040782 | 3300000567 | Peatlands Soil | YGGKPYEHFGRFTDTWVFQDGAWLCVASHSSLLKK* |
| JGIcombinedJ26739_1010730821 | 3300002245 | Forest Soil | TKGTYGAKPYEHFGRFTDTWVFQDGKWLCVASHTSLLKK* |
| Ga0066672_100118805 | 3300005167 | Soil | AKGTYQGRPYDHVGRFTDTWILEDGKWQCVASHSSLLKK* |
| Ga0070713_1016873051 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GIYHTQGTYQGKPYNHVGRFTDTWVLDTGKWQCVASHTSLLKK* |
| Ga0070711_1015222922 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | YHTQGTYQGKSYDHVGRFTDTWVFDQGKWQCVASHTSLLKK* |
| Ga0070731_108256162 | 3300005538 | Surface Soil | GSYHAKPYEHTGRFTDTWVLNDSRWQCVASHTSLLQK* |
| Ga0070733_100417271 | 3300005541 | Surface Soil | GIYHTKGTYEGKPYEHFGRYTDTWVYTDGRWQCAASHTSLLKK* |
| Ga0070733_104836943 | 3300005541 | Surface Soil | SYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK* |
| Ga0070732_106956322 | 3300005542 | Surface Soil | VTGVYHTKGSYEGKPYDHIGRFTDTWINDGGKWQCVASHTSLLKK* |
| Ga0066707_102298361 | 3300005556 | Soil | YRTRGTYQGKSYDHLGRFTDTWIQEGGKWQCVASHTSLLKK* |
| Ga0066704_104949281 | 3300005557 | Soil | LVPWFGRLTKGIYKGKPFEHFGRFTDSWIHQNGKWQCIASH |
| Ga0066702_100984341 | 3300005575 | Soil | NGKPYLHRGRFTDTWVRQGSSWMCVASHSTLMQR* |
| Ga0070762_108084361 | 3300005602 | Soil | KGTYQAKPYEHWGRFTDTWIYAQGRWQCVASHTSLLKK* |
| Ga0066903_1002358681 | 3300005764 | Tropical Forest Soil | GIYHTQGTYQGKSYDHVGRFTDTWVMDQGKWQCVASHTSLLKK* |
| Ga0070766_106681581 | 3300005921 | Soil | YHNTGVVTGSYHTKGSYNSKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK* |
| Ga0075029_1000786491 | 3300006052 | Watersheds | YQGKSYDHVGRFTDTWVYDQGKWQCVASHTSLLKNK* |
| Ga0075030_1009901791 | 3300006162 | Watersheds | GTYQGKPYDHVGRFTDTWVLDMGKWQCVASHTSLLKK* |
| Ga0070715_106145002 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GTYKSKPYDHTGRFTDTWVFDMGKWQCVSSHTSLLKK* |
| Ga0070716_1000339241 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QGKPYDHVGRFTDTWVLDQGKWQCVASHTSLLKK* |
| Ga0070712_1001435513 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QTKGTYSGKAYEHVGRFTDTWIFENGKWLCVASHTSLLKK* |
| Ga0070765_1006548471 | 3300006176 | Soil | YQGKPYEHFGRFTDTWVYSDGRWQCVASHTSLLKK* |
| Ga0073928_102712951 | 3300006893 | Iron-Sulfur Acid Spring | VVTGIYHTQGSYQGKPYDHLGRFTDTWVQDLGKWQCVASHTSLLKK* |
| Ga0099828_118569781 | 3300009089 | Vadose Zone Soil | QNKPYEHWGRFTDTWVFTEGRWQCVASHTSLVKK* |
| Ga0116121_11472832 | 3300009644 | Peatland | VVTGIYHASGTYQGKPYDHMGRFTDTWVMDLGKWQCVASHTSLLKK* |
| Ga0116135_13100562 | 3300009665 | Peatland | IYHSQGTYQGKPYDHVGRFTDTWVMDAGKWQCVASYTSLIKK* |
| Ga0116217_104217201 | 3300009700 | Peatlands Soil | GTYGAKPYEHFGRFTDTWIFQDGKWQCVASHTSLVKK* |
| Ga0074044_106870791 | 3300010343 | Bog Forest Soil | AVVTGTYHTQGTYQGKPYDHVGRFTDTWIFGSGRWQCVASHTSLIKK* |
| Ga0126370_117957951 | 3300010358 | Tropical Forest Soil | ASKPYEHTGRFTDTWIFEDGKWLCVASHTSLLKK* |
| Ga0126377_101821763 | 3300010362 | Tropical Forest Soil | VYYTKGTFSGKPYEHTGRFTDTWIFENGKWLCVASHTSLLGK* |
| Ga0126379_109560371 | 3300010366 | Tropical Forest Soil | TQGTYQGKPYDHVGRFTDTWVLDLGKWQCVASHTSLLKK* |
| Ga0126381_1025853182 | 3300010376 | Tropical Forest Soil | IYRTQGTFQGKAYDHVGRFTDTWVYELGRWQCVASHTSLIKK* |
| Ga0126381_1031120452 | 3300010376 | Tropical Forest Soil | YHTKGTYDSKPYEHLGRFTDTWVFEGGRWMCVASHTSLLKK* |
| Ga0126381_1042094321 | 3300010376 | Tropical Forest Soil | YQGKSYEHVGRFTDTWVFADARWQCVASHSSLLQK* |
| Ga0137363_111919901 | 3300012202 | Vadose Zone Soil | QGKSYDHVGRFTDTWVMDQGKWQCVASHTSLLKNK* |
| Ga0137399_117873431 | 3300012203 | Vadose Zone Soil | KGTYQGRPYEHFGRFTDAWMLQDGRWQCVASHTSLVKK* |
| Ga0137362_108345822 | 3300012205 | Vadose Zone Soil | YHTKGTYGAKPYEHFGRFTDTWVFQDGKWLCVASHTSLLKK* |
| Ga0137362_117396611 | 3300012205 | Vadose Zone Soil | HTKGTYGAKPYEHFGRFTDTWVFQDGKWLCVASHTSLLKK* |
| Ga0137390_101549421 | 3300012363 | Vadose Zone Soil | YQGRPYEHFGRFTDTWVLDDGRWQCVASHTSLVKK* |
| Ga0137358_103708371 | 3300012582 | Vadose Zone Soil | SGVYHTKGTYGAKPYEHFGRFTDTWVFQDGKWLCVASHTSLLKK* |
| Ga0137359_105838044 | 3300012923 | Vadose Zone Soil | YQNKPYEHWGRFTDTWVFTEGRWQCVASHTSLVKK* |
| Ga0157373_103895632 | 3300013100 | Corn Rhizosphere | YKGKAYDHVGRFTDTWVLDGAKWLCVASHTSLIKN* |
| Ga0157369_106107253 | 3300013105 | Corn Rhizosphere | KGTISGKPFDHHGRFTDTWVNQGGKWQCVASHTSSLKKPPQ* |
| Ga0181524_102955792 | 3300014155 | Bog | VTGTYHTKGTYGGKPYDHIGRFTDTWILQNGKWLCVASHSSLLKK* |
| Ga0134078_103474421 | 3300014157 | Grasslands Soil | TGNYHTKGLYASKPYEHFGRFTDTWVFQESKWLCVASHSSLVKK* |
| Ga0181532_101097891 | 3300014164 | Bog | TYGAKPYEHFGRFTDTWIFQDGKWQCVASHTSLIKK* |
| Ga0181537_100605883 | 3300014201 | Bog | YHIRGSYNNQPYEHTGRFTDTWIYDGGKWLCVASHSSLLKK* |
| Ga0181525_101483312 | 3300014654 | Bog | EYHTKGSYQGKAYDHVGRFTDTWVFQGGKWVCVASHASLLKK* |
| Ga0181522_103693862 | 3300014657 | Bog | YNTQAYEHTGRFTDTWIFEGGKWLCVASHSSLIKKN* |
| Ga0137418_108040012 | 3300015241 | Vadose Zone Soil | YQTKGTYHGKAYDHFGRFTDTWILENGKWQCVASHTSLLKK* |
| Ga0137412_100470151 | 3300015242 | Vadose Zone Soil | TKGVYGSKPYEHFGRFTDTWVFQDGKWLCVASHSSLKK* |
| Ga0182034_119992201 | 3300016371 | Soil | VVIGSYHSKGSYQGKSYDHFGRFTDTWVFADARWQCVASHSSLVQK |
| Ga0182040_105597241 | 3300016387 | Soil | YQAKGTYSGKAYEHIGRFTDTWIFENGRWLCVASHTSLLKK |
| Ga0182037_117653971 | 3300016404 | Soil | NVAVVIGSYHSKGSYQGKSYDHFGRFTDTWVFADARWQCVASHSSLVQK |
| Ga0181505_104486042 | 3300016750 | Peatland | VVIGEYHTKGSYQGKAYDHVGRFTDTWVMDSGKWQCVASHTSLIKK |
| Ga0187820_10071643 | 3300017924 | Freshwater Sediment | VITGTYHTQGTYQGKAYDHVGRFTDTWVLDGGKWQCVASHTSLIKK |
| Ga0187824_101172403 | 3300017927 | Freshwater Sediment | TKGTYSGKPYEHTGRFTDTWIFGNGRWLCVASHTSLLKKEKSEG |
| Ga0187803_100712522 | 3300017934 | Freshwater Sediment | VTGIYHTKGTYQGKPYEHVGRFTDTWIFENGRWLCVASHTSLVKK |
| Ga0187819_102109801 | 3300017943 | Freshwater Sediment | TYSGKPYEHFGRFTDTWVYQDGKWLCVASHSSLKNK |
| Ga0187817_1000012225 | 3300017955 | Freshwater Sediment | VVTGIYRAKGTYQGKPYDHIGRFTDTWVLQDAKWECVASHTSLLQK |
| Ga0187817_104480382 | 3300017955 | Freshwater Sediment | SYNGKPYDHLGRFTDTWIFQDGKWECVASHTSLMKK |
| Ga0187781_101375913 | 3300017972 | Tropical Peatland | KGTYQGKPYEHLGRFTDTWVFQDARWQCVASHTSLLQK |
| Ga0187781_106637132 | 3300017972 | Tropical Peatland | YQGKPYDHFGRFTDTWVLDSGKWQCVASHTSLVKK |
| Ga0187777_102063941 | 3300017974 | Tropical Peatland | HTKGTYQAKPYDHFGRFTDTWIQQLGKWQCVASHTSLVKK |
| Ga0187816_100919872 | 3300017995 | Freshwater Sediment | GVYHTQGTYHGKPYDHVGRFTDTWVFDLGKWQCVASHTSLLKK |
| Ga0187805_102822802 | 3300018007 | Freshwater Sediment | RHTKGTYQGEAFEHYSRFTDTWVYQHSRWLCVASQTSLIKK |
| Ga0187885_104661232 | 3300018025 | Peatland | HTKGSYNGKPYDHLGRFTDTWILEDGKWECVASHTSLLKR |
| Ga0187863_102665282 | 3300018034 | Peatland | FYGRAAVVTGGYHAKGTYQGKPYDHNGRFTDTWVSSDTVTWQCVASHTSLLQK |
| Ga0187875_102633081 | 3300018035 | Peatland | KGSYNGKPYDHLGRFTDTWILEDGKWECVASHTSLLKR |
| Ga0187871_102796662 | 3300018042 | Peatland | HTKGSYNGKPYDHLGRFTDTGMLEDGKWECVASHTSLLKK |
| Ga0187784_101805941 | 3300018062 | Tropical Peatland | HTKGTYQGKPYEHLGRFTDTWVFQDARWQCVASHTSLLQK |
| Ga0187772_108278161 | 3300018085 | Tropical Peatland | GEYHAQGTYQGKPYDHVGRFTDTWVEQNGKWVCVCSHSSLLKK |
| Ga0187772_108587501 | 3300018085 | Tropical Peatland | TYQGKPYDHLGRFTDTWIFDMGKWQCVASHTSLLKK |
| Ga0187772_108978301 | 3300018085 | Tropical Peatland | DYHTKGMYGGKPFEHFGRFTDTWVHQDSKWLCVASHASLKK |
| Ga0187771_101878091 | 3300018088 | Tropical Peatland | TQGTYQGKPYEHWGRFTDTWVFDGVKWQCVASHTSLLKK |
| Ga0182025_10697601 | 3300019786 | Permafrost | GKIPKGTYQGKSYEHIGRFTDTWVFTEGRWQCAASHTSLLKK |
| Ga0210395_107987561 | 3300020582 | Soil | YQGKPYDHVGRFTDTWVLDLGKWQCVASHTSLVKK |
| Ga0210401_104522012 | 3300020583 | Soil | TGSYHTKGSYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK |
| Ga0210400_1000280110 | 3300021170 | Soil | TAVITGIYHTAGTYQGKPYDHVGRFTDTWVMDMGKWQCVASHTSLLKK |
| Ga0210408_112183751 | 3300021178 | Soil | TGVVTGSYHTKGSYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK |
| Ga0210396_101315283 | 3300021180 | Soil | VTGIYHAQGTYQGKTYDHVGRFTDTWVQELGKWQCVASHTSLVKK |
| Ga0210388_100553641 | 3300021181 | Soil | HTKGSYNGKPYDHLGRFTDTWILEDGRWECVASHTSLLKK |
| Ga0210388_107113241 | 3300021181 | Soil | VTGSYHTKGSYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK |
| Ga0210393_113030302 | 3300021401 | Soil | IYHTKGTYQAKPYEHWGRFTDTWIYAQGRWQCVASHTSLLKK |
| Ga0210397_115686671 | 3300021403 | Soil | VTGIYHTKGSYHGKPYDHVGRFTDTWIYDDGKWQCVASHTSLLKR |
| Ga0210387_109793411 | 3300021405 | Soil | SYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK |
| Ga0210387_113629692 | 3300021405 | Soil | TYGSKPYEHFGRFTDTWVFQDGRWLCVASHSSLVKK |
| Ga0210383_105851411 | 3300021407 | Soil | YHNTGVVTGSYHTKGSYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK |
| Ga0210384_109802261 | 3300021432 | Soil | YHTQGTYQGKPYDHVGRFTDTWVLDLGKWQCVASHTSLLKK |
| Ga0210391_105655352 | 3300021433 | Soil | RTKGSYQGKTYDHVGRFTDTWVFQSDKWVCVASHSSLLKK |
| Ga0213879_102520661 | 3300021439 | Bulk Soil | KGTYMGKAYEHTGRFTDTWVLQDARWQCVASHTSLLQK |
| Ga0210390_116304631 | 3300021474 | Soil | RTKGTYGGKPYDHLGRFTDTWVFQDGKWLCVASHTSLLKK |
| Ga0210398_110639211 | 3300021477 | Soil | IYHAQGSYQGKSYDHVGRFTDTWVMDAGKWQCVASHTSLIKK |
| Ga0210402_105498461 | 3300021478 | Soil | GNYHVKGVYGSKPYEHFGRFTDTWILEDGKWLCVASHSSLVKK |
| Ga0210410_108727271 | 3300021479 | Soil | YHAKGTYAGKGYEHTGRFTDTWIFESGKWLCVASHTSLLKK |
| Ga0208036_10003961 | 3300025419 | Peatland | SAAVVGIYHTKGTYQGKPYEHFGRFTDTWVFTEGRWQCAASHTSLLKK |
| Ga0208191_10039307 | 3300025496 | Peatland | VVGIYHTKGTYQGKPYEHFGRFTDTWVFTEGRWQCAASHTSLLKK |
| Ga0207699_114611712 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TYHAAGTYQGKPYDHVGRFTDTWISDNGHWQCVASHTSLLKK |
| Ga0207663_103904052 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LTKGTYSGRIYEHTGRFTDTWIFENGRWLCVASHTSLVKK |
| Ga0207663_109241512 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | HTQGTYKSKPYDHTGRFTDTWVFDMGKWQCVSSHTSLLKK |
| Ga0207664_107958242 | 3300025929 | Agricultural Soil | GTYSGKAYEHLGRFTDTWIFENGKWLCVASHTSLLKK |
| Ga0207702_108235461 | 3300026078 | Corn Rhizosphere | HSKGTIAGKPFDHHGRFTDTWVNQGGKWQCVASHTSSLKKPPQ |
| Ga0207763_10183331 | 3300026879 | Tropical Forest Soil | TGTYHAQGSYQGKPYDHIGRFTDTWVLDAGKWQCVASHTSLVKK |
| Ga0208324_11879521 | 3300027604 | Peatlands Soil | KGSYNGKPYDHLGRFTDTWIFQDGKWECVASHTSLVKR |
| Ga0209118_11248441 | 3300027674 | Forest Soil | GAYHTKGTYGAKPYEHFGRFTDTWVFQDGKWLCVASHTSLLKK |
| Ga0209655_100732381 | 3300027767 | Bog Forest Soil | VVGIYHTKGMYQNKPYEHFGRFTDTWIYSEGRWQCVASHTSLLKK |
| Ga0209139_100254983 | 3300027795 | Bog Forest Soil | VVGIDHAKGIYQNKPYEHLGRFTDTWIYAEGRWQCVASHTSLLKK |
| Ga0209517_104229911 | 3300027854 | Peatlands Soil | YGGKPYEHFGRFTDTWVFQDGAWLCVASHSSLLKK |
| Ga0209167_107974072 | 3300027867 | Surface Soil | GYHAKGTYQGKPYDHNGRFTDTWVSTDSETWQCVASHTSLLQK |
| Ga0209275_105625732 | 3300027884 | Soil | AVVVGIYHTKGIYQGKPYDHFGRFTDTWVFTEGRWQCVASHTSLLKK |
| Ga0209380_104992712 | 3300027889 | Soil | GTYQGKSYDHVGRFTDTWVFDQGKWQCVASHTSLLKNK |
| Ga0209067_101788721 | 3300027898 | Watersheds | TYQGKPYDHVGRFTDTWVLDQGKWQCVASHTSLLKK |
| Ga0209698_110246171 | 3300027911 | Watersheds | GTYHTQGTFQGKPYDHVGRFTDTWIFDTGKWQCVASHTSLLKK |
| Ga0265351_10275141 | 3300028020 | Soil | AYHTQGSFQGKPYDHVGRFTDTWVLELGKWQCVASHTSLLKK |
| Ga0265349_10273821 | 3300028037 | Soil | YHTKGTYQGKPYEHFGRFTDTWVFTEGRWQCVASHTSLLKK |
| Ga0302156_101878672 | 3300028748 | Bog | VVGVYHTKGTYQSKPYEHWGRFTDTWVFTEGRWQCAASHTSLLKK |
| Ga0302189_104048702 | 3300028788 | Bog | YHTKGTYGPKAYEHFGRFTDTWVYSDGKWLCVASHSSLMKK |
| Ga0311327_102382622 | 3300029883 | Bog | YHAKGTYNAQAYEHTGRFTDTWIFEGGKWLCVASHSSLIKKN |
| Ga0311341_104350942 | 3300029908 | Bog | TYHTKGTYGPKAYEHFGRFTDTWVYSDGKWLCVASHSSLMKK |
| Ga0311340_106844721 | 3300029943 | Palsa | TAVVTGIYHTQGTYQGKPYDHVGRFTDTWVMDLGKWQCVASHTSLLKK |
| Ga0311339_102855301 | 3300029999 | Palsa | GTYQGKPYDHVGRFTDTWVFDTGKWECVASHTSLLKK |
| Ga0302286_105743991 | 3300030047 | Fen | IVTGIYRTKGTYQGKPYGHVGRFTDTWVFENDKWQCVASHTSLLKK |
| Ga0302182_102162402 | 3300030054 | Palsa | YQTKPYDHVGRFTDTWVLDNGKWQCVASHTSLIKK |
| Ga0170824_1175994542 | 3300031231 | Forest Soil | IYHTQGTYQGKPYNHVGRFTDTWVLDTGKWQCVASHTSLLKK |
| Ga0265339_101420062 | 3300031249 | Rhizosphere | YQGKAYDHVGRFTDTWIFDGGKWQCVASHTSLLKK |
| Ga0310686_1144804311 | 3300031708 | Soil | KGTYQAKPYEHWGRFTDTWIYAQGRWQCVASHTSLLKK |
| Ga0310686_1168008651 | 3300031708 | Soil | YHTKGSYNGKPYDHLGRFTDTWILEDGKWECVASHTSLLKK |
| Ga0310686_1169918021 | 3300031708 | Soil | YHNTGVVTGSYHTKGSYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKR |
| Ga0307476_112761101 | 3300031715 | Hardwood Forest Soil | VVVGIYHAKGTYQAKPYEHWGRFTDTWIYAQGRWQCVASHTSLLKK |
| Ga0307477_103048811 | 3300031753 | Hardwood Forest Soil | IYHAQGTFQGKPYDHLGRFTDTWVLELGKWQCVASHTSLLKK |
| Ga0307475_103793051 | 3300031754 | Hardwood Forest Soil | RTKGTYQGRPYEHFGRFTDTWMLENGRWQCVASHTSLVKK |
| Ga0306919_105556952 | 3300031879 | Soil | TLLSNVAVVIGSYHSKGSYQGKSYDHFGRFTDTWVFADARWQCVASHSSLVQK |
| Ga0306919_109146251 | 3300031879 | Soil | GTYQGKPYDHMGRFTDTWVLDGGKWQCVASHTSLLKSK |
| Ga0310912_106207271 | 3300031941 | Soil | TYRSKGSHMNKSYDHLGRFTDTWVFADGKWQCVASHTSLLQK |
| Ga0307479_107870872 | 3300031962 | Hardwood Forest Soil | YHAQGTFQGKAYDHLGRFTDTWVFEMGKWQCVASHTSLLKK |
| Ga0307479_116833731 | 3300031962 | Hardwood Forest Soil | SAVVVGIYHNKGTYQAKPYEHWGRFTDTWIYAQGRWQCVASHTSLLRK |
| Ga0307479_117460572 | 3300031962 | Hardwood Forest Soil | KGTYQGKAYEHWGRFTDTWAFTEGRWQCVASHTSLLKK |
| Ga0308176_112021182 | 3300031996 | Soil | VYHTQGTYKSKPYDHTGRFTDTWVFDMGKWQCVSSHTSLLKK |
| Ga0316051_10074051 | 3300032119 | Soil | AGVVTGVYHTKGSYNGKPYDHVGRFTDTWIFQEGKWECVASHTSLVKK |
| Ga0307472_1023468501 | 3300032205 | Hardwood Forest Soil | RNTGVVTGIYHTKGSYYGKPYDHLGRFTDTWIFEDGKWECVASHTSLLKK |
| Ga0335082_112649781 | 3300032782 | Soil | GLYAGKPYEHFGRFTDTWVFQDGKWLCVASHSSLKK |
| Ga0335079_100107588 | 3300032783 | Soil | QGSYQGKPYDHVGRFTDTWVFDTGKWSCVASHTSLLKK |
| Ga0335079_114584322 | 3300032783 | Soil | GIYHTKGTVQGKPYEHAGRFTDTWIFQDARWECVASHTSLLQK |
| Ga0335080_101751921 | 3300032828 | Soil | IVTGDYHTKGVYAGKPYEHFGRFTDTWVYQDSKWLCVASHSSLKK |
| Ga0335080_102221641 | 3300032828 | Soil | GVYHTAGTYQGKPYDHVGRFTDTWIFDMGKWQCVASHTSLLKK |
| Ga0335080_112112571 | 3300032828 | Soil | TYQGKPYDHVGRFTDTWVLDMGKWQCVASHTSLLKKQ |
| Ga0335081_103889261 | 3300032892 | Soil | GIYHTQGTYQGKPYDHMGRFTDTWVLDMGKWQCVASHTSLLKK |
| Ga0310914_103110573 | 3300033289 | Soil | VVTGTYRSKGSYMNKSYDHLGRFTDTWVFADGKWQCVASHTSLLQK |
| Ga0318519_106448442 | 3300033290 | Soil | AVVTGTYRSKGSYMNKSYDHLGRFTDTWVFADGKWQCVASHTSLLQK |
| Ga0314866_033301_2_133 | 3300033807 | Peatland | GTYHTAGTYQGKPYDHVGRFTDTWVLDLGKWQCVASHTSLLKK |
| Ga0371488_0318126_1_108 | 3300033983 | Peat Soil | YGTKPYEHFGRFTDTWVFQEGKWVCVASHTSLLKK |
| Ga0370483_0000301_18_155 | 3300034124 | Untreated Peat Soil | VVGVYHTKGTYQSKAYEHWGRFTDTWVFTEGRWQCAASHTSLLRK |
| ⦗Top⦘ |