Basic Information | |
---|---|
Family ID | F045991 |
Family Type | Metagenome |
Number of Sequences | 152 |
Average Sequence Length | 46 residues |
Representative Sequence | MEMLCHGEPMVELLLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Number of Associated Samples | 124 |
Number of Associated Scaffolds | 152 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 7.24 % |
% of genes near scaffold ends (potentially truncated) | 30.92 % |
% of genes from short scaffolds (< 2000 bps) | 80.26 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (61.184 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.658 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.842 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.053 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 30.26% β-sheet: 2.63% Coil/Unstructured: 67.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 152 Family Scaffolds |
---|---|---|
PF03466 | LysR_substrate | 28.95 |
PF00126 | HTH_1 | 23.68 |
PF00107 | ADH_zinc_N | 23.03 |
PF08240 | ADH_N | 8.55 |
PF07995 | GSDH | 2.63 |
PF02790 | COX2_TM | 2.63 |
PF01476 | LysM | 1.32 |
PF13561 | adh_short_C2 | 0.66 |
PF06559 | DCD | 0.66 |
COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
---|---|---|---|
COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 2.63 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 2.63 |
COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.66 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 61.18 % |
Unclassified | root | N/A | 38.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2067725004|GPKC_F5V46DG03F5Q1F | Not Available | 502 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105308856 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300000956|JGI10216J12902_100553078 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
3300002568|C688J35102_118933478 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300002568|C688J35102_119763115 | Not Available | 768 | Open in IMG/M |
3300003267|soilL1_10031481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2426 | Open in IMG/M |
3300003319|soilL2_10076178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3181 | Open in IMG/M |
3300003324|soilH2_10004661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7278 | Open in IMG/M |
3300003993|Ga0055468_10281759 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300004114|Ga0062593_100007308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4829 | Open in IMG/M |
3300004114|Ga0062593_100345110 | Not Available | 1298 | Open in IMG/M |
3300004114|Ga0062593_100466516 | Not Available | 1157 | Open in IMG/M |
3300004156|Ga0062589_100272193 | Not Available | 1287 | Open in IMG/M |
3300004156|Ga0062589_100536861 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300004156|Ga0062589_101937657 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300004157|Ga0062590_100865702 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300004157|Ga0062590_100889526 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300004463|Ga0063356_100121306 | All Organisms → cellular organisms → Bacteria | 2901 | Open in IMG/M |
3300004463|Ga0063356_100177557 | All Organisms → cellular organisms → Bacteria | 2475 | Open in IMG/M |
3300004463|Ga0063356_105898519 | Not Available | 525 | Open in IMG/M |
3300004479|Ga0062595_101133845 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300005093|Ga0062594_100157443 | Not Available | 1502 | Open in IMG/M |
3300005093|Ga0062594_101835517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 640 | Open in IMG/M |
3300005093|Ga0062594_103397528 | Not Available | 501 | Open in IMG/M |
3300005294|Ga0065705_10117341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3295 | Open in IMG/M |
3300005294|Ga0065705_10511690 | Not Available | 768 | Open in IMG/M |
3300005328|Ga0070676_10467509 | Not Available | 890 | Open in IMG/M |
3300005328|Ga0070676_11244784 | Not Available | 567 | Open in IMG/M |
3300005332|Ga0066388_101138377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1326 | Open in IMG/M |
3300005332|Ga0066388_101687911 | Not Available | 1120 | Open in IMG/M |
3300005334|Ga0068869_100383197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1153 | Open in IMG/M |
3300005339|Ga0070660_100223455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1531 | Open in IMG/M |
3300005345|Ga0070692_10138350 | Not Available | 1375 | Open in IMG/M |
3300005345|Ga0070692_10286291 | Not Available | 1001 | Open in IMG/M |
3300005347|Ga0070668_100175223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1748 | Open in IMG/M |
3300005347|Ga0070668_100903400 | Not Available | 789 | Open in IMG/M |
3300005366|Ga0070659_101350430 | Not Available | 633 | Open in IMG/M |
3300005438|Ga0070701_10035110 | All Organisms → cellular organisms → Bacteria | 2517 | Open in IMG/M |
3300005441|Ga0070700_100885938 | Not Available | 725 | Open in IMG/M |
3300005450|Ga0066682_10204079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1267 | Open in IMG/M |
3300005539|Ga0068853_101876326 | Not Available | 581 | Open in IMG/M |
3300005549|Ga0070704_101046379 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300005713|Ga0066905_102047522 | Not Available | 532 | Open in IMG/M |
3300005719|Ga0068861_100636333 | Not Available | 984 | Open in IMG/M |
3300005840|Ga0068870_10048788 | All Organisms → cellular organisms → Bacteria | 2231 | Open in IMG/M |
3300005842|Ga0068858_100473167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1209 | Open in IMG/M |
3300005888|Ga0075289_1028173 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300005937|Ga0081455_10064780 | All Organisms → cellular organisms → Bacteria | 3059 | Open in IMG/M |
3300005937|Ga0081455_10122729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2044 | Open in IMG/M |
3300006058|Ga0075432_10415234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
3300006169|Ga0082029_1264397 | Not Available | 1004 | Open in IMG/M |
3300006881|Ga0068865_102033499 | Not Available | 522 | Open in IMG/M |
3300009100|Ga0075418_10036347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5336 | Open in IMG/M |
3300009147|Ga0114129_11015176 | Not Available | 1044 | Open in IMG/M |
3300009148|Ga0105243_10163148 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
3300009156|Ga0111538_10002938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 23910 | Open in IMG/M |
3300009553|Ga0105249_10065328 | All Organisms → cellular organisms → Bacteria | 3347 | Open in IMG/M |
3300009789|Ga0126307_10000134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 44128 | Open in IMG/M |
3300010038|Ga0126315_10211190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1173 | Open in IMG/M |
3300010041|Ga0126312_10680611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
3300010045|Ga0126311_11249180 | Not Available | 616 | Open in IMG/M |
3300010371|Ga0134125_10281543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1847 | Open in IMG/M |
3300010399|Ga0134127_11329133 | Not Available | 788 | Open in IMG/M |
3300010400|Ga0134122_11164571 | Not Available | 769 | Open in IMG/M |
3300012897|Ga0157285_10041478 | Not Available | 1085 | Open in IMG/M |
3300012901|Ga0157288_10088575 | Not Available | 816 | Open in IMG/M |
3300012902|Ga0157291_10025328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1227 | Open in IMG/M |
3300012903|Ga0157289_10213519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
3300012908|Ga0157286_10096503 | Not Available | 860 | Open in IMG/M |
3300012909|Ga0157290_10074826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
3300012911|Ga0157301_10218274 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300012915|Ga0157302_10155932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
3300012938|Ga0162651_100020071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
3300013297|Ga0157378_12421643 | Not Available | 577 | Open in IMG/M |
3300014969|Ga0157376_12498384 | Not Available | 556 | Open in IMG/M |
3300015077|Ga0173483_10006787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3848 | Open in IMG/M |
3300015077|Ga0173483_10148016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1033 | Open in IMG/M |
3300015077|Ga0173483_10312529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
3300015373|Ga0132257_102483597 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300015374|Ga0132255_100040541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5986 | Open in IMG/M |
3300017965|Ga0190266_10000540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6318 | Open in IMG/M |
3300017965|Ga0190266_10657123 | Not Available | 646 | Open in IMG/M |
3300018028|Ga0184608_10138052 | Not Available | 1044 | Open in IMG/M |
3300018031|Ga0184634_10252611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
3300018073|Ga0184624_10148829 | Not Available | 1028 | Open in IMG/M |
3300018465|Ga0190269_11449453 | Not Available | 561 | Open in IMG/M |
3300019356|Ga0173481_10011264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2533 | Open in IMG/M |
3300019356|Ga0173481_10044349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1500 | Open in IMG/M |
3300019356|Ga0173481_10060698 | Not Available | 1335 | Open in IMG/M |
3300019361|Ga0173482_10247526 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300019361|Ga0173482_10788267 | Not Available | 502 | Open in IMG/M |
3300019867|Ga0193704_1039820 | Not Available | 938 | Open in IMG/M |
3300020016|Ga0193696_1038924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1266 | Open in IMG/M |
3300021078|Ga0210381_10150453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
3300021078|Ga0210381_10306194 | Not Available | 574 | Open in IMG/M |
3300022915|Ga0247790_10226652 | Not Available | 503 | Open in IMG/M |
3300023071|Ga0247752_1070943 | Not Available | 570 | Open in IMG/M |
3300024055|Ga0247794_10078914 | Not Available | 949 | Open in IMG/M |
3300024055|Ga0247794_10244336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
3300025321|Ga0207656_10472306 | Not Available | 635 | Open in IMG/M |
3300025567|Ga0210076_1044637 | Not Available | 956 | Open in IMG/M |
3300025899|Ga0207642_10080281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1582 | Open in IMG/M |
3300025901|Ga0207688_10034864 | All Organisms → cellular organisms → Bacteria | 2787 | Open in IMG/M |
3300025901|Ga0207688_10294298 | Not Available | 991 | Open in IMG/M |
3300025903|Ga0207680_10820177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
3300025904|Ga0207647_10322316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
3300025912|Ga0207707_10777634 | Not Available | 799 | Open in IMG/M |
3300025918|Ga0207662_10235120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1198 | Open in IMG/M |
3300025918|Ga0207662_10981494 | Not Available | 599 | Open in IMG/M |
3300025923|Ga0207681_10684497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
3300025935|Ga0207709_11252233 | Not Available | 612 | Open in IMG/M |
3300025937|Ga0207669_10511250 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300025961|Ga0207712_10125041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1951 | Open in IMG/M |
3300025972|Ga0207668_10061486 | All Organisms → cellular organisms → Bacteria | 2642 | Open in IMG/M |
3300025981|Ga0207640_11384812 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300026025|Ga0208778_1025707 | Not Available | 586 | Open in IMG/M |
3300026035|Ga0207703_11789620 | Not Available | 590 | Open in IMG/M |
3300027695|Ga0209966_1041049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
3300027907|Ga0207428_10058580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3056 | Open in IMG/M |
3300028587|Ga0247828_10414836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
3300028705|Ga0307276_10023149 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300028712|Ga0307285_10098457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
3300028717|Ga0307298_10153813 | Not Available | 669 | Open in IMG/M |
3300028719|Ga0307301_10107878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
3300028720|Ga0307317_10026698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1787 | Open in IMG/M |
3300028721|Ga0307315_10146602 | Not Available | 715 | Open in IMG/M |
3300028722|Ga0307319_10009621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2943 | Open in IMG/M |
3300028754|Ga0307297_10051280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1272 | Open in IMG/M |
3300028755|Ga0307316_10017185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2285 | Open in IMG/M |
3300028755|Ga0307316_10107911 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300028771|Ga0307320_10116975 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300028778|Ga0307288_10093471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1087 | Open in IMG/M |
3300028791|Ga0307290_10013646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2771 | Open in IMG/M |
3300028791|Ga0307290_10082149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1172 | Open in IMG/M |
3300028796|Ga0307287_10022841 | Not Available | 2190 | Open in IMG/M |
3300028814|Ga0307302_10015105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3465 | Open in IMG/M |
3300028878|Ga0307278_10466127 | Not Available | 553 | Open in IMG/M |
3300031198|Ga0307500_10110861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 747 | Open in IMG/M |
3300031548|Ga0307408_100282159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1384 | Open in IMG/M |
3300031740|Ga0307468_100160586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1460 | Open in IMG/M |
3300031824|Ga0307413_10275329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1262 | Open in IMG/M |
3300031852|Ga0307410_10818069 | Not Available | 793 | Open in IMG/M |
3300031854|Ga0310904_11097000 | Not Available | 570 | Open in IMG/M |
3300031858|Ga0310892_10301473 | Not Available | 1010 | Open in IMG/M |
3300031901|Ga0307406_11388994 | Not Available | 615 | Open in IMG/M |
3300031938|Ga0308175_100073058 | All Organisms → cellular organisms → Bacteria | 3063 | Open in IMG/M |
3300031996|Ga0308176_10790069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 991 | Open in IMG/M |
3300032003|Ga0310897_10009079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2892 | Open in IMG/M |
3300032004|Ga0307414_11729370 | Not Available | 583 | Open in IMG/M |
3300032005|Ga0307411_10114257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1939 | Open in IMG/M |
3300032126|Ga0307415_100008477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5701 | Open in IMG/M |
3300033550|Ga0247829_10556847 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 7.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.61% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.29% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.29% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.63% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.63% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.97% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.97% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.97% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.32% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.32% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.32% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.32% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.32% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.32% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.32% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.32% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.32% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.66% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.66% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.66% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.66% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026025 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPKC_05779340 | 2067725004 | Soil | MKSLCHGELMEAAFLLAFLLLLGPLAYVFGTDSRTGDVRGGWPGEPRR |
INPhiseqgaiiFebDRAFT_1053088562 | 3300000364 | Soil | MEMLCHGESMVELLIIGFLCLLGPLAYFYGTDSRTSDTRAGWPGEPRR* |
JGI10216J12902_1005530784 | 3300000956 | Soil | MEMLCHGESMVELLLIGFLCLLGPLAYFYGTDSRTSDTRAGWPGEPRR* |
C688J35102_1189334782 | 3300002568 | Soil | MEGLCHVETVIVFLILMILLLSGPLAYVYGVDSRTGDARGGWPGEPRR* |
C688J35102_1197631152 | 3300002568 | Soil | MERLCHVESVIAFIVLTILVLSGPLAYVFGVDSRTGDVRGGWPGEPRR* |
soilL1_100314814 | 3300003267 | Sugarcane Root And Bulk Soil | MEMLCHGECMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGNPRR* |
soilL2_100761782 | 3300003319 | Sugarcane Root And Bulk Soil | MEMLCHGECMVELLLIAFLCLLGPLAYLYGTDTRTGDARGGWPGNPRR* |
soilH2_100046612 | 3300003324 | Sugarcane Root And Bulk Soil | MVELFLIAFLCLMGPLAYVYGADSRTGDRRGGWPGEPRR* |
Ga0055468_102817591 | 3300003993 | Natural And Restored Wetlands | MDMLCHGELMVELLLIAFLCLLGPLAYRFGVDSRTGDSRGGWPGEPRR* |
Ga0062593_1000073085 | 3300004114 | Soil | MKIRCHGEGMFSVFLLGFLLLLGPLAYLYGKDTRTGDPRGGWPGDPRH* |
Ga0062593_1003451102 | 3300004114 | Soil | MEILCHRECMVELLLIAFICLLGPLAYVYGVDSRTGDSRGGWPGEPRR* |
Ga0062593_1004665162 | 3300004114 | Soil | VMVELLLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR* |
Ga0062589_1002721932 | 3300004156 | Soil | MEMLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR* |
Ga0062589_1005368612 | 3300004156 | Soil | MVELFLIAFLCLMGPLAYVYGADSRTGDSRDGWPGERRR* |
Ga0062589_1019376572 | 3300004156 | Soil | IITRLALMELLCHGQSMVELLLIGFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR* |
Ga0062590_1008657021 | 3300004157 | Soil | MKSLCHGELMEAAFLLAFLLLLGPLAYVFGTDSRTGDVRGGWPGEPRR* |
Ga0062590_1008895261 | 3300004157 | Soil | MELLCHGQSMVELLLIGFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR* |
Ga0063356_1001213065 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKSLCHGELMEAVFLLAFLLLLGPLAYVFGTDSRTGDVRGGWPGEPRR* |
Ga0063356_1001775572 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MEMLCHGECMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR* |
Ga0063356_1058985191 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RCHGEGMFSVFLLGFLLLLGPLAYLYGKDTRTGDPRGGWPGDPRH* |
Ga0062595_1011338452 | 3300004479 | Soil | MKRLCHGEIMFDIFLLAFLLLLGPLAYLFGADSRTGDTRGGWPGEPRR* |
Ga0062594_1001574432 | 3300005093 | Soil | MERLCHRELMVELFLIGFLCLLGPLAYFFGTDTRTGDTRAGWPGEPRR* |
Ga0062594_1018355172 | 3300005093 | Soil | WKSSATVSSMVELLLIAFLVLMGPLAYVYGADSRSGDSRGGWPGEPRR* |
Ga0062594_1033975281 | 3300005093 | Soil | CHGESMVELLLIGFLCLLGPLAYFYGTDSRTSGTRAGWPGEPRR* |
Ga0065705_101173412 | 3300005294 | Switchgrass Rhizosphere | MELLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR* |
Ga0065705_105116902 | 3300005294 | Switchgrass Rhizosphere | MEMLCHGESMVELLLIGFLCLLGPLAYFYGTDSRTSGTRA |
Ga0070676_104675091 | 3300005328 | Miscanthus Rhizosphere | MEMVCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR* |
Ga0070676_112447842 | 3300005328 | Miscanthus Rhizosphere | MELLCHGQSMVELLLIAFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR* |
Ga0066388_1011383772 | 3300005332 | Tropical Forest Soil | MEKLCHGESVVELLLIGFLCVLGPLAYVYGADSRTGDTRAGWPGERRR* |
Ga0066388_1016879112 | 3300005332 | Tropical Forest Soil | MEILSHSESMVELLLITVLCLLGPLAYFYGTDSRTGDTRGGWPGNSRR* |
Ga0068869_1003831972 | 3300005334 | Miscanthus Rhizosphere | MEMLCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR* |
Ga0070660_1002234552 | 3300005339 | Corn Rhizosphere | MLCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR* |
Ga0070692_101383503 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MELLCHRELMVELLLIAFLCLLGPLAYVYGVDSRTGDSRGGW |
Ga0070692_102862912 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MEILCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR* |
Ga0070668_1001752233 | 3300005347 | Switchgrass Rhizosphere | LMEMLCHREVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR* |
Ga0070668_1009034001 | 3300005347 | Switchgrass Rhizosphere | MEMLCHGVVMVELLVIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR* |
Ga0070659_1013504302 | 3300005366 | Corn Rhizosphere | MEMLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEP |
Ga0070701_100351104 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MELLCHGQSMVELLLIAFLCLLGPLAYVYGFDSRTGDSRGGWPGEPRR* |
Ga0070700_1008859381 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MEMLCHGEVMVELLLIAFICLLGPLAYFYGADTRTGDARGGWPGEPRR* |
Ga0066682_102040792 | 3300005450 | Soil | MAVFFLLAFLVLLGPLAYLYGADSRTGDTRGGWPGDPRR* |
Ga0068853_1018763261 | 3300005539 | Corn Rhizosphere | RIITRFALMEILCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR* |
Ga0070704_1010463791 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MEMLCHGESMVELLLIGFLCLLGPLAYFYGTDSRTSGTRAGWPGEPRR* |
Ga0066905_1020475221 | 3300005713 | Tropical Forest Soil | MEKLCHGEPMVELLLIGFLCLLGPLAYVYGADSRTGDTRAGWPGERRR* |
Ga0068861_1006363331 | 3300005719 | Switchgrass Rhizosphere | LMEMLCHGEVMVELLLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR* |
Ga0068870_100487881 | 3300005840 | Miscanthus Rhizosphere | MELLCHGQSMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR* |
Ga0068858_1004731672 | 3300005842 | Switchgrass Rhizosphere | MKILCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR* |
Ga0075289_10281731 | 3300005888 | Rice Paddy Soil | VETMITVVILALLLLSGPLAYVFGVDSRTGDARGGWPGERPR* |
Ga0081455_100647802 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MENLCHGESMVELLLIGFLCLLGPLAYFYGTDSRAGDTRAGWPGEPRR* |
Ga0081455_101227292 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MEMLCHGECMVELLLIGFLCLLGPLAYLYGTDTRTGDARGGWPGNPRR* |
Ga0075432_104152342 | 3300006058 | Populus Rhizosphere | MEMLCHGELMVEVFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR* |
Ga0082029_12643972 | 3300006169 | Termite Nest | RIITRFALMETLCHGECMVELLLIAFLCLLGPLAYLYGADTRTGDPRGGWPGDPRR* |
Ga0068865_1020334991 | 3300006881 | Miscanthus Rhizosphere | MEMLCHGEVMVELLLIAFICLLGPLAYFYGADTRTGDA |
Ga0075418_100363472 | 3300009100 | Populus Rhizosphere | MEMLCHGELMVEVFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGAPRR* |
Ga0114129_110151762 | 3300009147 | Populus Rhizosphere | MEMLCHGELMVEVFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGE |
Ga0105243_101631483 | 3300009148 | Miscanthus Rhizosphere | MELLCHGQFMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR* |
Ga0111538_1000293828 | 3300009156 | Populus Rhizosphere | MEMLCHGEVMVEVFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGAPRR* |
Ga0105249_100653284 | 3300009553 | Switchgrass Rhizosphere | MEMLCHGEVMVELLLIGFICLLGPLAYVYGTDTRTGDARGGWPGEPRR* |
Ga0126307_1000013444 | 3300009789 | Serpentine Soil | MEMLCHREFMVELLFIAFICLLGPLAYVYGADSRTGDSRGGWPGEPRR* |
Ga0126315_102111902 | 3300010038 | Serpentine Soil | MIDANHARFALMDMLCHGEVMVELFLIAFLCLLGPLAYVYGVDSRTGDTRGGWPGEPRR* |
Ga0126312_106806112 | 3300010041 | Serpentine Soil | MEMLCHREFMVELLFIAFICLLGPLTYVYGADSRTGDSRGGWPGEPRR* |
Ga0126311_112491802 | 3300010045 | Serpentine Soil | MDMLCHGEVMVELFLIAFLCLLGPLAYVYGVDSRTGDTRGGWPGEPRR* |
Ga0134125_102815432 | 3300010371 | Terrestrial Soil | MEMLCHGEVMVELLLIAFLCLLGPLAYLYGTDTRTGDPRGGWPGEPRR* |
Ga0134127_113291332 | 3300010399 | Terrestrial Soil | MVELLLIAFLVLMGPLAYVYGADSRSGDSRGGWPGEPRR* |
Ga0134122_111645711 | 3300010400 | Terrestrial Soil | ELLLIAFICLLGPLAYFYGADTRTGDARGGWPGEPRR* |
Ga0157285_100414781 | 3300012897 | Soil | HGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR* |
Ga0157288_100885751 | 3300012901 | Soil | MEMLCHGVVMVELLLIAFICLLGPLAYLYGTDTRTGDARGGWPGEPRR* |
Ga0157291_100253282 | 3300012902 | Soil | MEMLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDTRGGWPGEPRR* |
Ga0157289_102135192 | 3300012903 | Soil | MEILCHRECMVELLLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR* |
Ga0157286_100965031 | 3300012908 | Soil | MEMLCHGEFMVELFLIAFICLLGPLAYVYGTDTRTGDPRGGWPGERRR* |
Ga0157290_100748262 | 3300012909 | Soil | MEMLCHGERMVEVLLIAFLCLLGPLVYVYGVDSRTGDSRGGWPGEPRR* |
Ga0157301_102182742 | 3300012911 | Soil | KSLCHGELMEAAFLLAFLLLLGPLAYVFGTDSRTGDVRGGWPGEPRR* |
Ga0157302_101559322 | 3300012915 | Soil | MEMLCHGEFMVELFLIAFICLLGPLAYLYGTDTRTGDARGGWPGEPRR* |
Ga0162651_1000200712 | 3300012938 | Soil | MEMVCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR* |
Ga0157378_124216432 | 3300013297 | Miscanthus Rhizosphere | MEILCHGEVMVELLLIAFICLLGPLAYFYGADTRTGDARGGWPGEPRR* |
Ga0157376_124983842 | 3300014969 | Miscanthus Rhizosphere | MEMLCHGELMVELFLIAFLCLLGPLANVYGVDSRTGD |
Ga0173483_100067876 | 3300015077 | Soil | MLCHGEVMVELLLIAFICLLGPLAYFYGADTRTGDARGGWPGEPRR* |
Ga0173483_101480162 | 3300015077 | Soil | MELLCHGQSMVELLLIAFLCLLGPLAYVYGADSRTGDSRDGWPGERRR* |
Ga0173483_103125292 | 3300015077 | Soil | MEMLCHGEVMVELLLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR* |
Ga0132257_1024835972 | 3300015373 | Arabidopsis Rhizosphere | ELLLIAFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR* |
Ga0132255_1000405417 | 3300015374 | Arabidopsis Rhizosphere | GESMVELFLIAFLCLMGPLAYVYGADSRTGDSRDGWPGERRR* |
Ga0190266_100005406 | 3300017965 | Soil | MELLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGQPRR |
Ga0190266_106571232 | 3300017965 | Soil | MDMLCHRELMVELFLIAFLCLLGPLAYVYGADSRTGDIRGGWPGDPRR |
Ga0184608_101380522 | 3300018028 | Groundwater Sediment | MEILCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Ga0184634_102526112 | 3300018031 | Groundwater Sediment | MEMLCHGEVMVELLLIAFICLLGPLAYLVGTDSRTGDTRGGWPGEPRR |
Ga0184624_101488292 | 3300018073 | Groundwater Sediment | FALMEMLCHGECMVELLLIAFLCLLGPLAYVYGADSLTGDSRGGWPGDPRR |
Ga0190269_114494532 | 3300018465 | Soil | MELLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Ga0173481_100112645 | 3300019356 | Soil | MEMLCHGVVMVELLVIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR |
Ga0173481_100443492 | 3300019356 | Soil | MEMLCHGEFMVELFLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR |
Ga0173481_100606981 | 3300019356 | Soil | MEMLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Ga0173482_102475262 | 3300019361 | Soil | MEMLCHGEFMVELFLIAFICLLGPLAYLYGTDTRTGDARGGWPGEPRR |
Ga0173482_107882672 | 3300019361 | Soil | MFSVFLLGFLLLLGPLAYLYGKDTRTGDPRGGWPGDPRH |
Ga0193704_10398202 | 3300019867 | Soil | MKRLCHGEIMFGVFLLAFLLLLGPLAYLFGADSRTGDARGGWPGEPRR |
Ga0193696_10389241 | 3300020016 | Soil | LFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Ga0210381_101504532 | 3300021078 | Groundwater Sediment | MEILCHGESMVELLLIGFLCLLGPLAYLVGTDSRTGDTRGGWPGEPRR |
Ga0210381_103061942 | 3300021078 | Groundwater Sediment | MKRPCHGEIMFGAFLLAFLLLLGPLAYLFGADSRTGDARGGWPGEPRR |
Ga0247790_102266521 | 3300022915 | Soil | MVELFLIAFLCLMGPLAYVYGADSRTGDSRDGWPGERRR |
Ga0247752_10709432 | 3300023071 | Soil | MEMLCHGVVMVELLLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR |
Ga0247794_100789142 | 3300024055 | Soil | ALMEMLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Ga0247794_102443362 | 3300024055 | Soil | MELLCHGQSMVELLLIGFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR |
Ga0207656_104723062 | 3300025321 | Corn Rhizosphere | MELLCHGQSMVELLLIAFLCLLGPLAYVYGFDSRTGDSRGGWPGEPRR |
Ga0210076_10446372 | 3300025567 | Natural And Restored Wetlands | MDMLCHGELMVELLLIAFLCLLGPLAYRFGVDSRTGDSRGGWPGEPRR |
Ga0207642_100802811 | 3300025899 | Miscanthus Rhizosphere | MEILCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDAR |
Ga0207688_100348643 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MEMLCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR |
Ga0207688_102942981 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MELLCHGQSMVELLLIAFLCLLGPLAYVYGADSRTGDSRG |
Ga0207680_108201772 | 3300025903 | Switchgrass Rhizosphere | MELLCHGQSMVELLLIAFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR |
Ga0207647_103223162 | 3300025904 | Corn Rhizosphere | MEMLCHGESMVELLLIGFLCLLGPLAYFYGTDSRTSGTRAGWPGEPRR |
Ga0207707_107776341 | 3300025912 | Corn Rhizosphere | MEILCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR |
Ga0207662_102351202 | 3300025918 | Switchgrass Rhizosphere | MELLCHGQSMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR |
Ga0207662_109814941 | 3300025918 | Switchgrass Rhizosphere | MERLCHRELMVELFLIGFLCLLGPLAYFFGTDTRTGDTRAGWPGEPRR |
Ga0207681_106844972 | 3300025923 | Switchgrass Rhizosphere | MEMLCHGEVMVELLLIGFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR |
Ga0207709_112522332 | 3300025935 | Miscanthus Rhizosphere | RIITRLALMELLCHGQFMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR |
Ga0207669_105112502 | 3300025937 | Miscanthus Rhizosphere | LALMELLCHGQSMVELLLIAFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR |
Ga0207712_101250412 | 3300025961 | Switchgrass Rhizosphere | MEMLCHGEVMVELLLIGFICLLGPLAYVYGTDTRTGDARGGWPGEPRR |
Ga0207668_100614864 | 3300025972 | Switchgrass Rhizosphere | MEMLCHREVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR |
Ga0207640_113848121 | 3300025981 | Corn Rhizosphere | ELFLICFLCLLGPLAYFFGTDTRTGDTRAGWPGEPRR |
Ga0208778_10257072 | 3300026025 | Rice Paddy Soil | MENVCHVEIMITVLILALLLLSGPLAYVYGVDSRTGDARGGWPGERPR |
Ga0207703_117896202 | 3300026035 | Switchgrass Rhizosphere | MKILCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR |
Ga0209966_10410492 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MEMLCHGEVMVELLLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR |
Ga0207428_100585801 | 3300027907 | Populus Rhizosphere | MEMLCHGELMVEVFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Ga0247828_104148362 | 3300028587 | Soil | MEMLCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGERRR |
Ga0307276_100231491 | 3300028705 | Soil | MDMLCHRELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGDPRR |
Ga0307285_100984572 | 3300028712 | Soil | MEMLCHGECMVELLLIAFLCLLGPLAYVYGADSLTGDSRGGWPGDPRR |
Ga0307298_101538132 | 3300028717 | Soil | MDMLCHRELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGG |
Ga0307301_101078782 | 3300028719 | Soil | MKRLCHGEIMFDVFLLAFLLLLGPLAYLFGADSRTGDARGGWPGEPRR |
Ga0307317_100266982 | 3300028720 | Soil | MKRLCHGEIMFDVFPLAFLLLLGPLAYLFGADSRTGDARGGWPGEPRR |
Ga0307315_101466022 | 3300028721 | Soil | MEMLCHGECMVELLLIAFLCLLGPLAYVYGADSLTGD |
Ga0307319_100096212 | 3300028722 | Soil | MEMLCHGECMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR |
Ga0307297_100512801 | 3300028754 | Soil | ALMDMLCHRELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Ga0307316_100171854 | 3300028755 | Soil | MEMLCHGECMVELLLIAFLCLLGPLAYVYGADSLTGDSRGGWP |
Ga0307316_101079112 | 3300028755 | Soil | RIITRFALMEMLCHGECMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR |
Ga0307320_101169751 | 3300028771 | Soil | VELFLIAFICLLGPLAYVYGADSRTGDTRGGWPREPRR |
Ga0307288_100934711 | 3300028778 | Soil | LMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Ga0307290_100136464 | 3300028791 | Soil | MVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Ga0307290_100821492 | 3300028791 | Soil | HGEIMFGAFLLAFLLLLGPLAYLFGADSRTGDARGGWPGEPRR |
Ga0307287_100228413 | 3300028796 | Soil | MFGAFLLAFLLLLGPLAYLFGADSRTGDARGGWPGEPRR |
Ga0307302_100151052 | 3300028814 | Soil | MKRLCHGEIMFDVLLLLGPLAYLFGADSRTGDARGGWPGEPRR |
Ga0307278_104661272 | 3300028878 | Soil | LLLIGFLCLLGPLAYLVGTDTRTGDTRGGWPGEPRR |
Ga0307500_101108612 | 3300031198 | Soil | LCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Ga0307408_1002821592 | 3300031548 | Rhizosphere | MEMLCHGEFMVELLFIAFICLLGPLAYVYGADSRTGDSRGGWPGERR |
Ga0307468_1001605862 | 3300031740 | Hardwood Forest Soil | MEMLCHREGMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR |
Ga0307413_102753292 | 3300031824 | Rhizosphere | MEMLCHGEFMVELLFIAFICLLGPLAYIYGADSRTGDSRGGWPGERR |
Ga0307410_108180691 | 3300031852 | Rhizosphere | MEMLCHGEFMVELLFIAFICLLGPLAYIYGADSRTGD |
Ga0310904_110970001 | 3300031854 | Soil | MEMLCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEP |
Ga0310892_103014732 | 3300031858 | Soil | HRELMVELLLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Ga0307406_113889942 | 3300031901 | Rhizosphere | MEMLCHGEPMVELLLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Ga0308175_1000730585 | 3300031938 | Soil | MDMLCHRELMVELFLIAFLCLLGPLAYIYGADSRTGDSSGGWPGDPRR |
Ga0308176_107900692 | 3300031996 | Soil | MDMLCHRELMVELFLIAFLCLLGPLAYIYGADSRTGDRRGGWPGDPRR |
Ga0310897_100090795 | 3300032003 | Soil | ELMVELLLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR |
Ga0307414_117293701 | 3300032004 | Rhizosphere | MEMLCHGEFLVELLFIAFICLLGPLAYIYGADSRTGDSRGGWPGERR |
Ga0307411_101142575 | 3300032005 | Rhizosphere | MEMLCHGEFMVELLFIAFICLLGPLAYVYGADSRTG |
Ga0307415_1000084778 | 3300032126 | Rhizosphere | MEMLCHGEFMVELLFIAFICLLGPLAYVYGADSRT |
Ga0247829_105568472 | 3300033550 | Soil | MERLCHGELMVELFLIGFLCLLGPLAYFFGTDTRTGDSRAGWPGQPRR |
⦗Top⦘ |