NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F045991

Metagenome Family F045991

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045991
Family Type Metagenome
Number of Sequences 152
Average Sequence Length 46 residues
Representative Sequence MEMLCHGEPMVELLLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Number of Associated Samples 124
Number of Associated Scaffolds 152

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.24 %
% of genes near scaffold ends (potentially truncated) 30.92 %
% of genes from short scaffolds (< 2000 bps) 80.26 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (61.184 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.658 % of family members)
Environment Ontology (ENVO) Unclassified
(36.842 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.053 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 30.26%    β-sheet: 2.63%    Coil/Unstructured: 67.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 152 Family Scaffolds
PF03466LysR_substrate 28.95
PF00126HTH_1 23.68
PF00107ADH_zinc_N 23.03
PF08240ADH_N 8.55
PF07995GSDH 2.63
PF02790COX2_TM 2.63
PF01476LysM 1.32
PF13561adh_short_C2 0.66
PF06559DCD 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 152 Family Scaffolds
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 2.63
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 2.63
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms61.18 %
UnclassifiedrootN/A38.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725004|GPKC_F5V46DG03F5Q1FNot Available502Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105308856All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300000956|JGI10216J12902_100553078All Organisms → cellular organisms → Bacteria1852Open in IMG/M
3300002568|C688J35102_118933478All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300002568|C688J35102_119763115Not Available768Open in IMG/M
3300003267|soilL1_10031481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2426Open in IMG/M
3300003319|soilL2_10076178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3181Open in IMG/M
3300003324|soilH2_10004661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7278Open in IMG/M
3300003993|Ga0055468_10281759All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300004114|Ga0062593_100007308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei4829Open in IMG/M
3300004114|Ga0062593_100345110Not Available1298Open in IMG/M
3300004114|Ga0062593_100466516Not Available1157Open in IMG/M
3300004156|Ga0062589_100272193Not Available1287Open in IMG/M
3300004156|Ga0062589_100536861All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300004156|Ga0062589_101937657All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300004157|Ga0062590_100865702All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300004157|Ga0062590_100889526All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300004463|Ga0063356_100121306All Organisms → cellular organisms → Bacteria2901Open in IMG/M
3300004463|Ga0063356_100177557All Organisms → cellular organisms → Bacteria2475Open in IMG/M
3300004463|Ga0063356_105898519Not Available525Open in IMG/M
3300004479|Ga0062595_101133845All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300005093|Ga0062594_100157443Not Available1502Open in IMG/M
3300005093|Ga0062594_101835517All Organisms → cellular organisms → Bacteria → Terrabacteria group640Open in IMG/M
3300005093|Ga0062594_103397528Not Available501Open in IMG/M
3300005294|Ga0065705_10117341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3295Open in IMG/M
3300005294|Ga0065705_10511690Not Available768Open in IMG/M
3300005328|Ga0070676_10467509Not Available890Open in IMG/M
3300005328|Ga0070676_11244784Not Available567Open in IMG/M
3300005332|Ga0066388_101138377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1326Open in IMG/M
3300005332|Ga0066388_101687911Not Available1120Open in IMG/M
3300005334|Ga0068869_100383197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1153Open in IMG/M
3300005339|Ga0070660_100223455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1531Open in IMG/M
3300005345|Ga0070692_10138350Not Available1375Open in IMG/M
3300005345|Ga0070692_10286291Not Available1001Open in IMG/M
3300005347|Ga0070668_100175223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1748Open in IMG/M
3300005347|Ga0070668_100903400Not Available789Open in IMG/M
3300005366|Ga0070659_101350430Not Available633Open in IMG/M
3300005438|Ga0070701_10035110All Organisms → cellular organisms → Bacteria2517Open in IMG/M
3300005441|Ga0070700_100885938Not Available725Open in IMG/M
3300005450|Ga0066682_10204079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1267Open in IMG/M
3300005539|Ga0068853_101876326Not Available581Open in IMG/M
3300005549|Ga0070704_101046379All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300005713|Ga0066905_102047522Not Available532Open in IMG/M
3300005719|Ga0068861_100636333Not Available984Open in IMG/M
3300005840|Ga0068870_10048788All Organisms → cellular organisms → Bacteria2231Open in IMG/M
3300005842|Ga0068858_100473167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1209Open in IMG/M
3300005888|Ga0075289_1028173All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300005937|Ga0081455_10064780All Organisms → cellular organisms → Bacteria3059Open in IMG/M
3300005937|Ga0081455_10122729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2044Open in IMG/M
3300006058|Ga0075432_10415234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300006169|Ga0082029_1264397Not Available1004Open in IMG/M
3300006881|Ga0068865_102033499Not Available522Open in IMG/M
3300009100|Ga0075418_10036347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5336Open in IMG/M
3300009147|Ga0114129_11015176Not Available1044Open in IMG/M
3300009148|Ga0105243_10163148All Organisms → cellular organisms → Bacteria1923Open in IMG/M
3300009156|Ga0111538_10002938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia23910Open in IMG/M
3300009553|Ga0105249_10065328All Organisms → cellular organisms → Bacteria3347Open in IMG/M
3300009789|Ga0126307_10000134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria44128Open in IMG/M
3300010038|Ga0126315_10211190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1173Open in IMG/M
3300010041|Ga0126312_10680611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria742Open in IMG/M
3300010045|Ga0126311_11249180Not Available616Open in IMG/M
3300010371|Ga0134125_10281543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1847Open in IMG/M
3300010399|Ga0134127_11329133Not Available788Open in IMG/M
3300010400|Ga0134122_11164571Not Available769Open in IMG/M
3300012897|Ga0157285_10041478Not Available1085Open in IMG/M
3300012901|Ga0157288_10088575Not Available816Open in IMG/M
3300012902|Ga0157291_10025328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1227Open in IMG/M
3300012903|Ga0157289_10213519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300012908|Ga0157286_10096503Not Available860Open in IMG/M
3300012909|Ga0157290_10074826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria941Open in IMG/M
3300012911|Ga0157301_10218274All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300012915|Ga0157302_10155932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria781Open in IMG/M
3300012938|Ga0162651_100020071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300013297|Ga0157378_12421643Not Available577Open in IMG/M
3300014969|Ga0157376_12498384Not Available556Open in IMG/M
3300015077|Ga0173483_10006787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3848Open in IMG/M
3300015077|Ga0173483_10148016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1033Open in IMG/M
3300015077|Ga0173483_10312529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300015373|Ga0132257_102483597All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300015374|Ga0132255_100040541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5986Open in IMG/M
3300017965|Ga0190266_10000540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6318Open in IMG/M
3300017965|Ga0190266_10657123Not Available646Open in IMG/M
3300018028|Ga0184608_10138052Not Available1044Open in IMG/M
3300018031|Ga0184634_10252611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria808Open in IMG/M
3300018073|Ga0184624_10148829Not Available1028Open in IMG/M
3300018465|Ga0190269_11449453Not Available561Open in IMG/M
3300019356|Ga0173481_10011264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2533Open in IMG/M
3300019356|Ga0173481_10044349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1500Open in IMG/M
3300019356|Ga0173481_10060698Not Available1335Open in IMG/M
3300019361|Ga0173482_10247526All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300019361|Ga0173482_10788267Not Available502Open in IMG/M
3300019867|Ga0193704_1039820Not Available938Open in IMG/M
3300020016|Ga0193696_1038924All Organisms → cellular organisms → Bacteria → Terrabacteria group1266Open in IMG/M
3300021078|Ga0210381_10150453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300021078|Ga0210381_10306194Not Available574Open in IMG/M
3300022915|Ga0247790_10226652Not Available503Open in IMG/M
3300023071|Ga0247752_1070943Not Available570Open in IMG/M
3300024055|Ga0247794_10078914Not Available949Open in IMG/M
3300024055|Ga0247794_10244336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300025321|Ga0207656_10472306Not Available635Open in IMG/M
3300025567|Ga0210076_1044637Not Available956Open in IMG/M
3300025899|Ga0207642_10080281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1582Open in IMG/M
3300025901|Ga0207688_10034864All Organisms → cellular organisms → Bacteria2787Open in IMG/M
3300025901|Ga0207688_10294298Not Available991Open in IMG/M
3300025903|Ga0207680_10820177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria667Open in IMG/M
3300025904|Ga0207647_10322316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria877Open in IMG/M
3300025912|Ga0207707_10777634Not Available799Open in IMG/M
3300025918|Ga0207662_10235120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1198Open in IMG/M
3300025918|Ga0207662_10981494Not Available599Open in IMG/M
3300025923|Ga0207681_10684497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria852Open in IMG/M
3300025935|Ga0207709_11252233Not Available612Open in IMG/M
3300025937|Ga0207669_10511250All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300025961|Ga0207712_10125041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1951Open in IMG/M
3300025972|Ga0207668_10061486All Organisms → cellular organisms → Bacteria2642Open in IMG/M
3300025981|Ga0207640_11384812All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300026025|Ga0208778_1025707Not Available586Open in IMG/M
3300026035|Ga0207703_11789620Not Available590Open in IMG/M
3300027695|Ga0209966_1041049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria964Open in IMG/M
3300027907|Ga0207428_10058580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3056Open in IMG/M
3300028587|Ga0247828_10414836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria779Open in IMG/M
3300028705|Ga0307276_10023149All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300028712|Ga0307285_10098457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300028717|Ga0307298_10153813Not Available669Open in IMG/M
3300028719|Ga0307301_10107878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria885Open in IMG/M
3300028720|Ga0307317_10026698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1787Open in IMG/M
3300028721|Ga0307315_10146602Not Available715Open in IMG/M
3300028722|Ga0307319_10009621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2943Open in IMG/M
3300028754|Ga0307297_10051280All Organisms → cellular organisms → Bacteria → Terrabacteria group1272Open in IMG/M
3300028755|Ga0307316_10017185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2285Open in IMG/M
3300028755|Ga0307316_10107911All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300028771|Ga0307320_10116975All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300028778|Ga0307288_10093471All Organisms → cellular organisms → Bacteria → Terrabacteria group1087Open in IMG/M
3300028791|Ga0307290_10013646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2771Open in IMG/M
3300028791|Ga0307290_10082149All Organisms → cellular organisms → Bacteria → Terrabacteria group1172Open in IMG/M
3300028796|Ga0307287_10022841Not Available2190Open in IMG/M
3300028814|Ga0307302_10015105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3465Open in IMG/M
3300028878|Ga0307278_10466127Not Available553Open in IMG/M
3300031198|Ga0307500_10110861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium747Open in IMG/M
3300031548|Ga0307408_100282159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1384Open in IMG/M
3300031740|Ga0307468_100160586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1460Open in IMG/M
3300031824|Ga0307413_10275329All Organisms → cellular organisms → Bacteria → Terrabacteria group1262Open in IMG/M
3300031852|Ga0307410_10818069Not Available793Open in IMG/M
3300031854|Ga0310904_11097000Not Available570Open in IMG/M
3300031858|Ga0310892_10301473Not Available1010Open in IMG/M
3300031901|Ga0307406_11388994Not Available615Open in IMG/M
3300031938|Ga0308175_100073058All Organisms → cellular organisms → Bacteria3063Open in IMG/M
3300031996|Ga0308176_10790069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria991Open in IMG/M
3300032003|Ga0310897_10009079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2892Open in IMG/M
3300032004|Ga0307414_11729370Not Available583Open in IMG/M
3300032005|Ga0307411_10114257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1939Open in IMG/M
3300032126|Ga0307415_100008477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5701Open in IMG/M
3300033550|Ga0247829_10556847All Organisms → cellular organisms → Bacteria952Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil7.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere4.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.29%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.29%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.63%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.63%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.97%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.97%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.32%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.32%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.32%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.32%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.32%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.32%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.32%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.32%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.66%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.66%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.66%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725004Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025567Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026025Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKC_057793402067725004SoilMKSLCHGELMEAAFLLAFLLLLGPLAYVFGTDSRTGDVRGGWPGEPRR
INPhiseqgaiiFebDRAFT_10530885623300000364SoilMEMLCHGESMVELLIIGFLCLLGPLAYFYGTDSRTSDTRAGWPGEPRR*
JGI10216J12902_10055307843300000956SoilMEMLCHGESMVELLLIGFLCLLGPLAYFYGTDSRTSDTRAGWPGEPRR*
C688J35102_11893347823300002568SoilMEGLCHVETVIVFLILMILLLSGPLAYVYGVDSRTGDARGGWPGEPRR*
C688J35102_11976311523300002568SoilMERLCHVESVIAFIVLTILVLSGPLAYVFGVDSRTGDVRGGWPGEPRR*
soilL1_1003148143300003267Sugarcane Root And Bulk SoilMEMLCHGECMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGNPRR*
soilL2_1007617823300003319Sugarcane Root And Bulk SoilMEMLCHGECMVELLLIAFLCLLGPLAYLYGTDTRTGDARGGWPGNPRR*
soilH2_1000466123300003324Sugarcane Root And Bulk SoilMVELFLIAFLCLMGPLAYVYGADSRTGDRRGGWPGEPRR*
Ga0055468_1028175913300003993Natural And Restored WetlandsMDMLCHGELMVELLLIAFLCLLGPLAYRFGVDSRTGDSRGGWPGEPRR*
Ga0062593_10000730853300004114SoilMKIRCHGEGMFSVFLLGFLLLLGPLAYLYGKDTRTGDPRGGWPGDPRH*
Ga0062593_10034511023300004114SoilMEILCHRECMVELLLIAFICLLGPLAYVYGVDSRTGDSRGGWPGEPRR*
Ga0062593_10046651623300004114SoilVMVELLLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR*
Ga0062589_10027219323300004156SoilMEMLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR*
Ga0062589_10053686123300004156SoilMVELFLIAFLCLMGPLAYVYGADSRTGDSRDGWPGERRR*
Ga0062589_10193765723300004156SoilIITRLALMELLCHGQSMVELLLIGFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR*
Ga0062590_10086570213300004157SoilMKSLCHGELMEAAFLLAFLLLLGPLAYVFGTDSRTGDVRGGWPGEPRR*
Ga0062590_10088952613300004157SoilMELLCHGQSMVELLLIGFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR*
Ga0063356_10012130653300004463Arabidopsis Thaliana RhizosphereMKSLCHGELMEAVFLLAFLLLLGPLAYVFGTDSRTGDVRGGWPGEPRR*
Ga0063356_10017755723300004463Arabidopsis Thaliana RhizosphereMEMLCHGECMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR*
Ga0063356_10589851913300004463Arabidopsis Thaliana RhizosphereRCHGEGMFSVFLLGFLLLLGPLAYLYGKDTRTGDPRGGWPGDPRH*
Ga0062595_10113384523300004479SoilMKRLCHGEIMFDIFLLAFLLLLGPLAYLFGADSRTGDTRGGWPGEPRR*
Ga0062594_10015744323300005093SoilMERLCHRELMVELFLIGFLCLLGPLAYFFGTDTRTGDTRAGWPGEPRR*
Ga0062594_10183551723300005093SoilWKSSATVSSMVELLLIAFLVLMGPLAYVYGADSRSGDSRGGWPGEPRR*
Ga0062594_10339752813300005093SoilCHGESMVELLLIGFLCLLGPLAYFYGTDSRTSGTRAGWPGEPRR*
Ga0065705_1011734123300005294Switchgrass RhizosphereMELLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR*
Ga0065705_1051169023300005294Switchgrass RhizosphereMEMLCHGESMVELLLIGFLCLLGPLAYFYGTDSRTSGTRA
Ga0070676_1046750913300005328Miscanthus RhizosphereMEMVCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR*
Ga0070676_1124478423300005328Miscanthus RhizosphereMELLCHGQSMVELLLIAFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR*
Ga0066388_10113837723300005332Tropical Forest SoilMEKLCHGESVVELLLIGFLCVLGPLAYVYGADSRTGDTRAGWPGERRR*
Ga0066388_10168791123300005332Tropical Forest SoilMEILSHSESMVELLLITVLCLLGPLAYFYGTDSRTGDTRGGWPGNSRR*
Ga0068869_10038319723300005334Miscanthus RhizosphereMEMLCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR*
Ga0070660_10022345523300005339Corn RhizosphereMLCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR*
Ga0070692_1013835033300005345Corn, Switchgrass And Miscanthus RhizosphereMELLCHRELMVELLLIAFLCLLGPLAYVYGVDSRTGDSRGGW
Ga0070692_1028629123300005345Corn, Switchgrass And Miscanthus RhizosphereMEILCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR*
Ga0070668_10017522333300005347Switchgrass RhizosphereLMEMLCHREVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR*
Ga0070668_10090340013300005347Switchgrass RhizosphereMEMLCHGVVMVELLVIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR*
Ga0070659_10135043023300005366Corn RhizosphereMEMLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEP
Ga0070701_1003511043300005438Corn, Switchgrass And Miscanthus RhizosphereMELLCHGQSMVELLLIAFLCLLGPLAYVYGFDSRTGDSRGGWPGEPRR*
Ga0070700_10088593813300005441Corn, Switchgrass And Miscanthus RhizosphereMEMLCHGEVMVELLLIAFICLLGPLAYFYGADTRTGDARGGWPGEPRR*
Ga0066682_1020407923300005450SoilMAVFFLLAFLVLLGPLAYLYGADSRTGDTRGGWPGDPRR*
Ga0068853_10187632613300005539Corn RhizosphereRIITRFALMEILCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR*
Ga0070704_10104637913300005549Corn, Switchgrass And Miscanthus RhizosphereMEMLCHGESMVELLLIGFLCLLGPLAYFYGTDSRTSGTRAGWPGEPRR*
Ga0066905_10204752213300005713Tropical Forest SoilMEKLCHGEPMVELLLIGFLCLLGPLAYVYGADSRTGDTRAGWPGERRR*
Ga0068861_10063633313300005719Switchgrass RhizosphereLMEMLCHGEVMVELLLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR*
Ga0068870_1004878813300005840Miscanthus RhizosphereMELLCHGQSMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR*
Ga0068858_10047316723300005842Switchgrass RhizosphereMKILCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR*
Ga0075289_102817313300005888Rice Paddy SoilVETMITVVILALLLLSGPLAYVFGVDSRTGDARGGWPGERPR*
Ga0081455_1006478023300005937Tabebuia Heterophylla RhizosphereMENLCHGESMVELLLIGFLCLLGPLAYFYGTDSRAGDTRAGWPGEPRR*
Ga0081455_1012272923300005937Tabebuia Heterophylla RhizosphereMEMLCHGECMVELLLIGFLCLLGPLAYLYGTDTRTGDARGGWPGNPRR*
Ga0075432_1041523423300006058Populus RhizosphereMEMLCHGELMVEVFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR*
Ga0082029_126439723300006169Termite NestRIITRFALMETLCHGECMVELLLIAFLCLLGPLAYLYGADTRTGDPRGGWPGDPRR*
Ga0068865_10203349913300006881Miscanthus RhizosphereMEMLCHGEVMVELLLIAFICLLGPLAYFYGADTRTGDA
Ga0075418_1003634723300009100Populus RhizosphereMEMLCHGELMVEVFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGAPRR*
Ga0114129_1101517623300009147Populus RhizosphereMEMLCHGELMVEVFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGE
Ga0105243_1016314833300009148Miscanthus RhizosphereMELLCHGQFMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR*
Ga0111538_10002938283300009156Populus RhizosphereMEMLCHGEVMVEVFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGAPRR*
Ga0105249_1006532843300009553Switchgrass RhizosphereMEMLCHGEVMVELLLIGFICLLGPLAYVYGTDTRTGDARGGWPGEPRR*
Ga0126307_10000134443300009789Serpentine SoilMEMLCHREFMVELLFIAFICLLGPLAYVYGADSRTGDSRGGWPGEPRR*
Ga0126315_1021119023300010038Serpentine SoilMIDANHARFALMDMLCHGEVMVELFLIAFLCLLGPLAYVYGVDSRTGDTRGGWPGEPRR*
Ga0126312_1068061123300010041Serpentine SoilMEMLCHREFMVELLFIAFICLLGPLTYVYGADSRTGDSRGGWPGEPRR*
Ga0126311_1124918023300010045Serpentine SoilMDMLCHGEVMVELFLIAFLCLLGPLAYVYGVDSRTGDTRGGWPGEPRR*
Ga0134125_1028154323300010371Terrestrial SoilMEMLCHGEVMVELLLIAFLCLLGPLAYLYGTDTRTGDPRGGWPGEPRR*
Ga0134127_1132913323300010399Terrestrial SoilMVELLLIAFLVLMGPLAYVYGADSRSGDSRGGWPGEPRR*
Ga0134122_1116457113300010400Terrestrial SoilELLLIAFICLLGPLAYFYGADTRTGDARGGWPGEPRR*
Ga0157285_1004147813300012897SoilHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR*
Ga0157288_1008857513300012901SoilMEMLCHGVVMVELLLIAFICLLGPLAYLYGTDTRTGDARGGWPGEPRR*
Ga0157291_1002532823300012902SoilMEMLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDTRGGWPGEPRR*
Ga0157289_1021351923300012903SoilMEILCHRECMVELLLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR*
Ga0157286_1009650313300012908SoilMEMLCHGEFMVELFLIAFICLLGPLAYVYGTDTRTGDPRGGWPGERRR*
Ga0157290_1007482623300012909SoilMEMLCHGERMVEVLLIAFLCLLGPLVYVYGVDSRTGDSRGGWPGEPRR*
Ga0157301_1021827423300012911SoilKSLCHGELMEAAFLLAFLLLLGPLAYVFGTDSRTGDVRGGWPGEPRR*
Ga0157302_1015593223300012915SoilMEMLCHGEFMVELFLIAFICLLGPLAYLYGTDTRTGDARGGWPGEPRR*
Ga0162651_10002007123300012938SoilMEMVCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR*
Ga0157378_1242164323300013297Miscanthus RhizosphereMEILCHGEVMVELLLIAFICLLGPLAYFYGADTRTGDARGGWPGEPRR*
Ga0157376_1249838423300014969Miscanthus RhizosphereMEMLCHGELMVELFLIAFLCLLGPLANVYGVDSRTGD
Ga0173483_1000678763300015077SoilMLCHGEVMVELLLIAFICLLGPLAYFYGADTRTGDARGGWPGEPRR*
Ga0173483_1014801623300015077SoilMELLCHGQSMVELLLIAFLCLLGPLAYVYGADSRTGDSRDGWPGERRR*
Ga0173483_1031252923300015077SoilMEMLCHGEVMVELLLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR*
Ga0132257_10248359723300015373Arabidopsis RhizosphereELLLIAFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR*
Ga0132255_10004054173300015374Arabidopsis RhizosphereGESMVELFLIAFLCLMGPLAYVYGADSRTGDSRDGWPGERRR*
Ga0190266_1000054063300017965SoilMELLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGQPRR
Ga0190266_1065712323300017965SoilMDMLCHRELMVELFLIAFLCLLGPLAYVYGADSRTGDIRGGWPGDPRR
Ga0184608_1013805223300018028Groundwater SedimentMEILCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Ga0184634_1025261123300018031Groundwater SedimentMEMLCHGEVMVELLLIAFICLLGPLAYLVGTDSRTGDTRGGWPGEPRR
Ga0184624_1014882923300018073Groundwater SedimentFALMEMLCHGECMVELLLIAFLCLLGPLAYVYGADSLTGDSRGGWPGDPRR
Ga0190269_1144945323300018465SoilMELLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Ga0173481_1001126453300019356SoilMEMLCHGVVMVELLVIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR
Ga0173481_1004434923300019356SoilMEMLCHGEFMVELFLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR
Ga0173481_1006069813300019356SoilMEMLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Ga0173482_1024752623300019361SoilMEMLCHGEFMVELFLIAFICLLGPLAYLYGTDTRTGDARGGWPGEPRR
Ga0173482_1078826723300019361SoilMFSVFLLGFLLLLGPLAYLYGKDTRTGDPRGGWPGDPRH
Ga0193704_103982023300019867SoilMKRLCHGEIMFGVFLLAFLLLLGPLAYLFGADSRTGDARGGWPGEPRR
Ga0193696_103892413300020016SoilLFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Ga0210381_1015045323300021078Groundwater SedimentMEILCHGESMVELLLIGFLCLLGPLAYLVGTDSRTGDTRGGWPGEPRR
Ga0210381_1030619423300021078Groundwater SedimentMKRPCHGEIMFGAFLLAFLLLLGPLAYLFGADSRTGDARGGWPGEPRR
Ga0247790_1022665213300022915SoilMVELFLIAFLCLMGPLAYVYGADSRTGDSRDGWPGERRR
Ga0247752_107094323300023071SoilMEMLCHGVVMVELLLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR
Ga0247794_1007891423300024055SoilALMEMLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Ga0247794_1024433623300024055SoilMELLCHGQSMVELLLIGFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR
Ga0207656_1047230623300025321Corn RhizosphereMELLCHGQSMVELLLIAFLCLLGPLAYVYGFDSRTGDSRGGWPGEPRR
Ga0210076_104463723300025567Natural And Restored WetlandsMDMLCHGELMVELLLIAFLCLLGPLAYRFGVDSRTGDSRGGWPGEPRR
Ga0207642_1008028113300025899Miscanthus RhizosphereMEILCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDAR
Ga0207688_1003486433300025901Corn, Switchgrass And Miscanthus RhizosphereMEMLCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR
Ga0207688_1029429813300025901Corn, Switchgrass And Miscanthus RhizosphereMELLCHGQSMVELLLIAFLCLLGPLAYVYGADSRTGDSRG
Ga0207680_1082017723300025903Switchgrass RhizosphereMELLCHGQSMVELLLIAFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR
Ga0207647_1032231623300025904Corn RhizosphereMEMLCHGESMVELLLIGFLCLLGPLAYFYGTDSRTSGTRAGWPGEPRR
Ga0207707_1077763413300025912Corn RhizosphereMEILCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR
Ga0207662_1023512023300025918Switchgrass RhizosphereMELLCHGQSMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR
Ga0207662_1098149413300025918Switchgrass RhizosphereMERLCHRELMVELFLIGFLCLLGPLAYFFGTDTRTGDTRAGWPGEPRR
Ga0207681_1068449723300025923Switchgrass RhizosphereMEMLCHGEVMVELLLIGFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR
Ga0207709_1125223323300025935Miscanthus RhizosphereRIITRLALMELLCHGQFMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR
Ga0207669_1051125023300025937Miscanthus RhizosphereLALMELLCHGQSMVELLLIAFLCLLGPLAYVYGSDSRTGDSRGGWPGEPRR
Ga0207712_1012504123300025961Switchgrass RhizosphereMEMLCHGEVMVELLLIGFICLLGPLAYVYGTDTRTGDARGGWPGEPRR
Ga0207668_1006148643300025972Switchgrass RhizosphereMEMLCHREVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR
Ga0207640_1138481213300025981Corn RhizosphereELFLICFLCLLGPLAYFFGTDTRTGDTRAGWPGEPRR
Ga0208778_102570723300026025Rice Paddy SoilMENVCHVEIMITVLILALLLLSGPLAYVYGVDSRTGDARGGWPGERPR
Ga0207703_1178962023300026035Switchgrass RhizosphereMKILCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR
Ga0209966_104104923300027695Arabidopsis Thaliana RhizosphereMEMLCHGEVMVELLLIAFICLLGPLAYLYGTDTRTGDPRGGWPGERRR
Ga0207428_1005858013300027907Populus RhizosphereMEMLCHGELMVEVFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Ga0247828_1041483623300028587SoilMEMLCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGERRR
Ga0307276_1002314913300028705SoilMDMLCHRELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGDPRR
Ga0307285_1009845723300028712SoilMEMLCHGECMVELLLIAFLCLLGPLAYVYGADSLTGDSRGGWPGDPRR
Ga0307298_1015381323300028717SoilMDMLCHRELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGG
Ga0307301_1010787823300028719SoilMKRLCHGEIMFDVFLLAFLLLLGPLAYLFGADSRTGDARGGWPGEPRR
Ga0307317_1002669823300028720SoilMKRLCHGEIMFDVFPLAFLLLLGPLAYLFGADSRTGDARGGWPGEPRR
Ga0307315_1014660223300028721SoilMEMLCHGECMVELLLIAFLCLLGPLAYVYGADSLTGD
Ga0307319_1000962123300028722SoilMEMLCHGECMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR
Ga0307297_1005128013300028754SoilALMDMLCHRELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Ga0307316_1001718543300028755SoilMEMLCHGECMVELLLIAFLCLLGPLAYVYGADSLTGDSRGGWP
Ga0307316_1010791123300028755SoilRIITRFALMEMLCHGECMVELLLIAFLCLLGPLAYVYGADSRTGDSRGGWPGDPRR
Ga0307320_1011697513300028771SoilVELFLIAFICLLGPLAYVYGADSRTGDTRGGWPREPRR
Ga0307288_1009347113300028778SoilLMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Ga0307290_1001364643300028791SoilMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Ga0307290_1008214923300028791SoilHGEIMFGAFLLAFLLLLGPLAYLFGADSRTGDARGGWPGEPRR
Ga0307287_1002284133300028796SoilMFGAFLLAFLLLLGPLAYLFGADSRTGDARGGWPGEPRR
Ga0307302_1001510523300028814SoilMKRLCHGEIMFDVLLLLGPLAYLFGADSRTGDARGGWPGEPRR
Ga0307278_1046612723300028878SoilLLLIGFLCLLGPLAYLVGTDTRTGDTRGGWPGEPRR
Ga0307500_1011086123300031198SoilLCHGELMVELFLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Ga0307408_10028215923300031548RhizosphereMEMLCHGEFMVELLFIAFICLLGPLAYVYGADSRTGDSRGGWPGERR
Ga0307468_10016058623300031740Hardwood Forest SoilMEMLCHREGMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEPRR
Ga0307413_1027532923300031824RhizosphereMEMLCHGEFMVELLFIAFICLLGPLAYIYGADSRTGDSRGGWPGERR
Ga0307410_1081806913300031852RhizosphereMEMLCHGEFMVELLFIAFICLLGPLAYIYGADSRTGD
Ga0310904_1109700013300031854SoilMEMLCHGEVMVELLLIAFICLLGPLAYVYGTDTRTGDARGGWPGEP
Ga0310892_1030147323300031858SoilHRELMVELLLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Ga0307406_1138899423300031901RhizosphereMEMLCHGEPMVELLLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Ga0308175_10007305853300031938SoilMDMLCHRELMVELFLIAFLCLLGPLAYIYGADSRTGDSSGGWPGDPRR
Ga0308176_1079006923300031996SoilMDMLCHRELMVELFLIAFLCLLGPLAYIYGADSRTGDRRGGWPGDPRR
Ga0310897_1000907953300032003SoilELMVELLLIAFLCLLGPLAYVYGVDSRTGDSRGGWPGEPRR
Ga0307414_1172937013300032004RhizosphereMEMLCHGEFLVELLFIAFICLLGPLAYIYGADSRTGDSRGGWPGERR
Ga0307411_1011425753300032005RhizosphereMEMLCHGEFMVELLFIAFICLLGPLAYVYGADSRTG
Ga0307415_10000847783300032126RhizosphereMEMLCHGEFMVELLFIAFICLLGPLAYVYGADSRT
Ga0247829_1055684723300033550SoilMERLCHGELMVELFLIGFLCLLGPLAYFFGTDTRTGDSRAGWPGQPRR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.