NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F045990

Metagenome Family F045990

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045990
Family Type Metagenome
Number of Sequences 152
Average Sequence Length 48 residues
Representative Sequence KMIFGRLWEEAENGGHSDIHRTNGASRRQVRDSRNTPAPVRISESEPITES
Number of Associated Samples 121
Number of Associated Scaffolds 152

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.03 %
% of genes from short scaffolds (< 2000 bps) 94.08 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.711 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(12.500 % of family members)
Environment Ontology (ENVO) Unclassified
(49.342 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(69.737 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 5.06%    Coil/Unstructured: 94.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 152 Family Scaffolds
PF01128IspD 81.58
PF02542YgbB 8.55
PF02885Glycos_trans_3N 4.61
PF02653BPD_transp_2 1.32
PF07831PYNP_C 1.32
PF01938TRAM 0.66
PF04820Trp_halogenase 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 152 Family Scaffolds
COG0746Molybdopterin-guanine dinucleotide biosynthesis protein ACoenzyme transport and metabolism [H] 81.58
COG1207Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferaseCell wall/membrane/envelope biogenesis [M] 81.58
COG12112-C-methyl-D-erythritol 4-phosphate cytidylyltransferaseLipid transport and metabolism [I] 81.58
COG2068CTP:molybdopterin cytidylyltransferase MocACoenzyme transport and metabolism [H] 81.58
COG02452C-methyl-D-erythritol 2,4-cyclodiphosphate synthaseLipid transport and metabolism [I] 8.55
COG0213Thymidine phosphorylaseNucleotide transport and metabolism [F] 1.32


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.71 %
UnclassifiedrootN/A28.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101189940Not Available778Open in IMG/M
3300000789|JGI1027J11758_11505324All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300000956|JGI10216J12902_110580036All Organisms → cellular organisms → Bacteria → Acidobacteria836Open in IMG/M
3300003316|rootH1_10173787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1040Open in IMG/M
3300003324|soilH2_10001122All Organisms → cellular organisms → Bacteria1199Open in IMG/M
3300004114|Ga0062593_101258060Not Available781Open in IMG/M
3300004157|Ga0062590_101120315Not Available760Open in IMG/M
3300004463|Ga0063356_102697080Not Available764Open in IMG/M
3300005293|Ga0065715_10210746All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300005293|Ga0065715_10546537Not Available713Open in IMG/M
3300005328|Ga0070676_11191038All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300005335|Ga0070666_10702047All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium742Open in IMG/M
3300005336|Ga0070680_101663104All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300005340|Ga0070689_102105542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300005356|Ga0070674_101910270All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300005406|Ga0070703_10343893All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300005438|Ga0070701_11315454All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300005438|Ga0070701_11375921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300005440|Ga0070705_100325573Not Available1111Open in IMG/M
3300005440|Ga0070705_100741369Not Available776Open in IMG/M
3300005441|Ga0070700_100240333All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300005445|Ga0070708_100236664All Organisms → cellular organisms → Bacteria1714Open in IMG/M
3300005445|Ga0070708_101857175Not Available559Open in IMG/M
3300005459|Ga0068867_101096599Not Available727Open in IMG/M
3300005459|Ga0068867_101834905All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300005530|Ga0070679_100639124All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300005543|Ga0070672_100575238Not Available980Open in IMG/M
3300005546|Ga0070696_100177009All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300005546|Ga0070696_101251137All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300005549|Ga0070704_100261509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1426Open in IMG/M
3300005564|Ga0070664_102059589All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300005577|Ga0068857_100701054Not Available962Open in IMG/M
3300005577|Ga0068857_101696155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium618Open in IMG/M
3300005578|Ga0068854_101383187All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300005578|Ga0068854_101623507All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300005578|Ga0068854_101927451All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300005615|Ga0070702_100081749All Organisms → cellular organisms → Bacteria1937Open in IMG/M
3300005617|Ga0068859_101748724All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300005718|Ga0068866_10336943Not Available954Open in IMG/M
3300005719|Ga0068861_100232933All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300005719|Ga0068861_100798515Not Available885Open in IMG/M
3300005719|Ga0068861_101224352Not Available727Open in IMG/M
3300005842|Ga0068858_101245740Not Available731Open in IMG/M
3300005843|Ga0068860_102824957All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005844|Ga0068862_102059286All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005844|Ga0068862_102448166All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300006169|Ga0082029_1270128Not Available594Open in IMG/M
3300006173|Ga0070716_100243554All Organisms → cellular organisms → Bacteria → Acidobacteria1221Open in IMG/M
3300006624|Ga0101567_10500399All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300006755|Ga0079222_11113649All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300006794|Ga0066658_10639948Not Available582Open in IMG/M
3300006806|Ga0079220_11658939All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300006844|Ga0075428_102243756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia563Open in IMG/M
3300006854|Ga0075425_101207239All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300006871|Ga0075434_100331436All Organisms → cellular organisms → Bacteria1542Open in IMG/M
3300006880|Ga0075429_100218730All Organisms → cellular organisms → Bacteria1669Open in IMG/M
3300006894|Ga0079215_11003262All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300006969|Ga0075419_10070642All Organisms → cellular organisms → Bacteria2213Open in IMG/M
3300007004|Ga0079218_10045459All Organisms → cellular organisms → Bacteria2684Open in IMG/M
3300007004|Ga0079218_10867683Not Available880Open in IMG/M
3300007076|Ga0075435_101477322All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300009093|Ga0105240_12367730Not Available550Open in IMG/M
3300009094|Ga0111539_10672266Not Available1206Open in IMG/M
3300009094|Ga0111539_12028004All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300009100|Ga0075418_12020806All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300009101|Ga0105247_10296109All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1121Open in IMG/M
3300009156|Ga0111538_13433167All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300009156|Ga0111538_13798202All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300009176|Ga0105242_10422457All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1249Open in IMG/M
3300009177|Ga0105248_11941495Not Available668Open in IMG/M
3300009177|Ga0105248_12089355All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300009840|Ga0126313_11668210All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300010036|Ga0126305_10131543All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1539Open in IMG/M
3300010037|Ga0126304_10352635All Organisms → cellular organisms → Bacteria → Acidobacteria979Open in IMG/M
3300010038|Ga0126315_11076777All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300010042|Ga0126314_10453682All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300010047|Ga0126382_10517207All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300010047|Ga0126382_10548771Not Available940Open in IMG/M
3300010166|Ga0126306_11694972All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300010358|Ga0126370_10867350Not Available812Open in IMG/M
3300010396|Ga0134126_13010917All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300010397|Ga0134124_10522082All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1152Open in IMG/M
3300010397|Ga0134124_10964110Not Available863Open in IMG/M
3300010399|Ga0134127_10653442All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1086Open in IMG/M
3300010399|Ga0134127_13303138All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300010400|Ga0134122_13187858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes514Open in IMG/M
3300012511|Ga0157332_1027526All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium705Open in IMG/M
3300012918|Ga0137396_11133706All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300012929|Ga0137404_11730969All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300012938|Ga0162651_100090758All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300012987|Ga0164307_11369390All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300013296|Ga0157374_10877207Not Available914Open in IMG/M
3300013297|Ga0157378_10194824All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1914Open in IMG/M
3300013306|Ga0163162_11539648Not Available758Open in IMG/M
3300013307|Ga0157372_12535173All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300014325|Ga0163163_10003486All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes13352Open in IMG/M
3300014326|Ga0157380_11120415Not Available827Open in IMG/M
3300014326|Ga0157380_11709964Not Available687Open in IMG/M
3300014326|Ga0157380_13176405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300014745|Ga0157377_10959910All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300015241|Ga0137418_10102164All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2578Open in IMG/M
3300015249|Ga0180071_1080988All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300015371|Ga0132258_11475660All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1718Open in IMG/M
3300015371|Ga0132258_11622632Not Available1632Open in IMG/M
3300015374|Ga0132255_105557094Not Available533Open in IMG/M
3300018056|Ga0184623_10325139Not Available692Open in IMG/M
3300018422|Ga0190265_11525543All Organisms → cellular organisms → Bacteria → Acidobacteria781Open in IMG/M
3300018422|Ga0190265_11531211Not Available780Open in IMG/M
3300018920|Ga0190273_11809666All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300019377|Ga0190264_10764788Not Available728Open in IMG/M
3300021090|Ga0210377_10196767All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300021445|Ga0182009_10000996All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum7177Open in IMG/M
3300024181|Ga0247693_1069486All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300025903|Ga0207680_10342780Not Available1048Open in IMG/M
3300025914|Ga0207671_11022668All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300025916|Ga0207663_11099243All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300025917|Ga0207660_10686047Not Available835Open in IMG/M
3300025923|Ga0207681_11174637All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300025925|Ga0207650_10488451All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1028Open in IMG/M
3300025927|Ga0207687_10103502All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2100Open in IMG/M
3300025940|Ga0207691_10770101Not Available810Open in IMG/M
3300025942|Ga0207689_10645861Not Available891Open in IMG/M
3300025942|Ga0207689_10957001Not Available722Open in IMG/M
3300025942|Ga0207689_11158984All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300025945|Ga0207679_11270214Not Available676Open in IMG/M
3300025961|Ga0207712_10834752All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300025981|Ga0207640_11134633All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300025981|Ga0207640_11252937All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300026035|Ga0207703_10495137All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1147Open in IMG/M
3300026088|Ga0207641_10118582All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2358Open in IMG/M
3300026095|Ga0207676_11340925Not Available711Open in IMG/M
3300026118|Ga0207675_100486340All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1227Open in IMG/M
3300026118|Ga0207675_102156619Not Available573Open in IMG/M
3300026118|Ga0207675_102478941All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300026121|Ga0207683_11662008All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300026285|Ga0209438_1078173All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1066Open in IMG/M
3300027639|Ga0209387_1121171All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300027907|Ga0207428_11078459All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300028379|Ga0268266_11660370All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300028380|Ga0268265_10609385All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300028380|Ga0268265_12676168All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300028381|Ga0268264_10068897All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2991Open in IMG/M
3300028381|Ga0268264_10920637All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300028381|Ga0268264_12265982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300031538|Ga0310888_10681383All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300031548|Ga0307408_101754009All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300031716|Ga0310813_10298493All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1358Open in IMG/M
3300031858|Ga0310892_10920153All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300031911|Ga0307412_10342712All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1197Open in IMG/M
3300031995|Ga0307409_101296461Not Available753Open in IMG/M
3300033412|Ga0310810_11269331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes585Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere12.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.21%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.95%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.97%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.97%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.32%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.66%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.66%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.66%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.66%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.66%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.66%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.66%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003316Sugarcane root Sample L1Host-AssociatedOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006624Soil microbial communities from the Leymus chinensis steppe, China - after adding 1.75 g N m- 2, yr-1EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015249Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293A_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10118994023300000364SoilFGRLWEEAESGGHNDIHRTNGTXRRQSRESRXAPGPVRITDGDAITEI*
JGI1027J11758_1150532423300000789SoilMIFGRLWEEAESGGHNDIHRTNGTVRRQSRESRNAPGPVRITDGDAITEI*
JGI10216J12902_11058003613300000956SoilKMIFGRLWEEAENGGHGDIHRTNGASRRQARDSRSGPAPVRISETEPITES*
rootH1_1017378713300003316Sugarcane Root And Bulk SoilGKMIFGRLWEEAENGHNDIHRTNGGSRRQMRESRSGPHPVRITDSEPITET*
soilH2_1000112233300003324Sugarcane Root And Bulk SoilAENGGHSDIHRTNGASRRQVRESRNSPAPVRISESEPITES*
Ga0062593_10125806013300004114SoilRLWEEAENGHNDIHRTNGGSRRMRDSRSGPHPVRITDTEPITES*
Ga0062590_10112031513300004157SoilWEEAENGGHSDIHRTNGGSRRPARDTRSSAPGPVRINDSEPITET*
Ga0063356_10269708023300004463Arabidopsis Thaliana RhizosphereTAGKMIFGRLWEEAENGGHSDIHRTNGASRRQARDSRNTPGPVRISDTEPVTES*
Ga0065715_1021074633300005293Miscanthus RhizosphereIFGRLWEEAENGGHSEIHRTNGASRRQLRDRNSPAPVRISESEPITES*
Ga0065715_1054653723300005293Miscanthus RhizosphereKMIFGRLWEEAENGGHSDIHRTNGASRRQVRESRNTPAPVRISESEPITES*
Ga0070676_1119103823300005328Miscanthus RhizosphereENGGHNEIHRTNGSSRRQTRDSRTAPGPVRITDTEAITET*
Ga0070666_1070204723300005335Switchgrass RhizosphereWEEAENGGHNDIHRTNGTSRRQARDSRSAPGPVRITDSDAITET*
Ga0070680_10166310413300005336Corn RhizosphereGKMIFGRLWEEAENGGHNEIHRTNGSSRRQTRDSRTAPGPVRITDTEAITET*
Ga0070689_10210554213300005340Switchgrass RhizosphereAGKMIFGRLWEEAENGGHSDIHRTNGASRRQARDSRNSPAPVRISESEPITES*
Ga0070674_10191027013300005356Miscanthus RhizosphereSENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES*
Ga0070703_1034389313300005406Corn, Switchgrass And Miscanthus RhizosphereMIFGRLWEEAENGGHSDIHRTNGASRRQVRDSRNTPAPVRFSESEPITES*
Ga0070701_1131545423300005438Corn, Switchgrass And Miscanthus RhizosphereEAENGGHSDIHRTNGGSRRPARDTRSSAPGPVRINDSEPITET*
Ga0070701_1137592113300005438Corn, Switchgrass And Miscanthus RhizosphereMIFGRLWEEPENGFSGEHRANGTTRRPTRDARSGSGPVRITDGEPITES*
Ga0070705_10032557313300005440Corn, Switchgrass And Miscanthus RhizosphereGKMIFGRLWEEAENGNGEHRTNGSARRQPRDSRSGPGPVRISDSEPVMD*
Ga0070705_10074136913300005440Corn, Switchgrass And Miscanthus RhizosphereTAGKMIFGRLWEEAENGGHSDIHRTNGASRRQARESRNTPAPVRISESEPITET*
Ga0070700_10024033333300005441Corn, Switchgrass And Miscanthus RhizosphereTAGKMIFGRLWEEPENGNSGEHRINGSVRRQSRSGPLPVRISDGEPITES*
Ga0070708_10023666413300005445Corn, Switchgrass And Miscanthus RhizosphereENGGHSDIHRTNGASRRQTRDSRSAPAPVRISETEPITES*
Ga0070708_10185717513300005445Corn, Switchgrass And Miscanthus RhizosphereTAGKMIFGRLWEEAENGHSDIHRTNGGSRRMRDSRSGPHPVRITDTEPITES*
Ga0068867_10109659913300005459Miscanthus RhizosphereTTAGKMIFGRLWEEAENGGHSDIHRTNGASRRQMRDSRNAPGPVRISDTEPVTES*
Ga0068867_10183490513300005459Miscanthus RhizosphereAGKMIFGRLWEEAENSGHSDIHRTNGGSRRQPRDSRSAPGPVRINDSEPITEI*
Ga0070679_10063912413300005530Corn RhizosphereEEAENGGHSDIHRTNGASRRQARDSRNTPAPVRISESEPITES*
Ga0070672_10057523813300005543Miscanthus RhizosphereQTTAGKMIFGRLWEEAENGGHSDIHRTNGASRRQARESRNTPAPVRISESEPITET*
Ga0070696_10017700913300005546Corn, Switchgrass And Miscanthus RhizosphereKMIFGRLWEEAENGGHSDIHRTNGASRRQMRDSRSTPAPVRISESEPVTES*
Ga0070696_10125113713300005546Corn, Switchgrass And Miscanthus RhizosphereVLQTTAGKMIFGRLWEEAENGGHSEIHRTNGASRRQLRGESRNTPSPVRISESEPITES*
Ga0070704_10026150913300005549Corn, Switchgrass And Miscanthus RhizosphereMIFGRLWEEAENGHSDIHRTNGSSRRQMRDSRSGPHPVRITDSEPITEI*
Ga0070664_10205958913300005564Corn RhizosphereFGRLWEEAENGHSEIHRTNGASRRQLRDRNSPAPVRISESEPITES*
Ga0068857_10070105423300005577Corn RhizosphereAGKMIFGRLWEEAENGGHSDIHRTNGGSRRPARDTRSSAPGPVRINDSEPITET*
Ga0068857_10169615523300005577Corn RhizosphereEAENGGHSDIHRTNGASRRQARDSRNSPAPVRIADSEPVTES*
Ga0068854_10138318713300005578Corn RhizosphereLWEEAENGHNDIHRTNGGSRRQMRESRSGPHPVRITDSEPITET*
Ga0068854_10162350723300005578Corn RhizosphereIFGRLWEEAENGGHSDIHRTNGASRRQVRESRNTPAPVRISESEPITES*
Ga0068854_10192745123300005578Corn RhizosphereTAGKMIFGRLWEEAENGGHSEIHRTNGASRRQLRGDSRNTPSPVRITESEPITES*
Ga0070702_10008174913300005615Corn, Switchgrass And Miscanthus RhizosphereGKMIFGRLWEEAENGGHSDIHRTNGASRRQVRESRNTPSPVRISESEPITES*
Ga0068859_10174872423300005617Switchgrass RhizosphereTAGKMIFGRLWEEPENGNSGEHRINGSVRRQSRSGPLPVRIADGEPITES*
Ga0068866_1033694323300005718Miscanthus RhizosphereWEESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES*
Ga0068861_10023293333300005719Switchgrass RhizosphereRLWEEAENSGHSDIHRTNGGSRRQPRDSRSAPGPVRINDSEPITEI*
Ga0068861_10079851523300005719Switchgrass RhizosphereMIFGRLWEEAENGGHSEIHRTNGASRRQLRDRNSPAPVRISESEPITES*
Ga0068861_10122435223300005719Switchgrass RhizosphereDIHRTNGTSRRQARDSRSAPGPVRITDSDAITET*
Ga0068858_10124574013300005842Switchgrass RhizosphereTTAGKMIFGRLWEEAENGGHSEIHRTNGASRRQLRDRNAPSPVRISESEPITES*
Ga0068860_10282495723300005843Switchgrass RhizosphereAGKMIFGRLWEEPENGSSSGEHRVNGSARRQSRDPRNGPMPVRFNDAEPITET*
Ga0068862_10205928623300005844Switchgrass RhizosphereTAGKMIFGRLWEEAENGGHSDIHRTNGASRRQARDSRNTPAPVRISDSEPVTES*
Ga0068862_10244816613300005844Switchgrass RhizosphereLWEEAENGGHSDIHRTNGGSRRPARDTRSSAPGPVRINDSEPITET*
Ga0082029_127012813300006169Termite NestSDIHRTNGAARRQARESRNTPAPVRISESEPITET*
Ga0070716_10024355413300006173Corn, Switchgrass And Miscanthus RhizosphereGKMIFGRLWEEADNGHNDIHRTNGGSRRQMRESRSGPHPVRITDSEPITES*
Ga0101567_1050039923300006624SoilIFGRLWEEAENGAHNDVHRTNGTTRRPARDSRSTPGPVRITDSEPITEG*
Ga0079222_1111364913300006755Agricultural SoilRLWEEAENGHNDIHRTNGGSRRQMRESRSGPHPVRITDSEPITET*
Ga0066658_1063994823300006794SoilDESENGGHSDIHRTNGASRRQMRDTRSGPTSVRIPESEPITES*
Ga0079220_1165893923300006806Agricultural SoilDIHRTNGASRRQVRESRNSPAPVRISESEPITES*
Ga0075428_10224375623300006844Populus RhizosphereTAGKMIFGRLWEEAENGGHSDIHRTNGASRRQMRDSRNTPGPVRISDTEPVTES*
Ga0075425_10120723913300006854Populus RhizosphereENSGSHNEIHRTNGTSRRQMRDSRSAPGPVRITDTEAITEA*
Ga0075434_10033143613300006871Populus RhizosphereNSGSHNEIHRTNGTSRRQMRDSRSAPGPVRITDTEAITEA*
Ga0075429_10021873013300006880Populus RhizosphereTTAGKMIFGRLWEEAENGGHSDIHRTNGGSRRQMRDSRSAPGPVRITDGEPITES*
Ga0079215_1100326223300006894Agricultural SoilHSDIHRTNGASRRQARDSRNAPAPVRISESEPITES*
Ga0075419_1007064213300006969Populus RhizosphereSDIHRTNGASRRQFRDSRSGPAPVRISESEPITES*
Ga0079218_1004545913300007004Agricultural SoilGKMIFGRLWEEAENGGHSDTHRTNGGSRRQVRDSRSAPGPVRITDSEPITES*
Ga0079218_1086768313300007004Agricultural SoilKMIFGRLWEEAENGGHSDIHRTNGASRRQMRDSRNTPAPVRISDSEPVTES*
Ga0075435_10147732223300007076Populus RhizosphereGRLWEEAENGGHSDIHRTNGASRRQARDSRNSPAPVRIADSEPVTES*
Ga0105240_1236773013300009093Corn RhizosphereTAGKMIFGRLWEEAENGGHSDIHRTNGASRRQARDSRNTPSPVRISESEPVTES*
Ga0111539_1067226633300009094Populus RhizosphereGKMIFGRLWEESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES*
Ga0111539_1202800413300009094Populus RhizosphereKMIFGRLWEESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES*
Ga0075418_1202080623300009100Populus RhizosphereGRLWEEAENGGHSDIHRTNGGSRRQMRDSRSAPGPVRITDSEPITES*
Ga0105247_1029610913300009101Switchgrass RhizosphereAGKMIFGRLWEEAENGGHSDIHRTNGASRRQVRDSRNSPAPVRISESEPITES*
Ga0111538_1343316723300009156Populus RhizosphereESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES*
Ga0111538_1379820223300009156Populus RhizosphereAGKMIFGRLWEEAENGGHSDIHRTNGASRRQARDARNTPAPVRISESEPITES*
Ga0105242_1042245733300009176Miscanthus RhizosphereLQTTAGKMIFGRLWEEAENGGHSEIHRTNGASRRQLRDRNSPAPVRISESEPITES*
Ga0105248_1194149523300009177Switchgrass RhizosphereENGGHSDIHRTNGASRRQVRESRNTPAPVRISESEPITES*
Ga0105248_1208935513300009177Switchgrass RhizosphereSVLQTTAGKMIFGRLWEEAENGHNDIHRTNGGSRRTRESRSAPGPVRINDTEPITET*
Ga0126313_1166821013300009840Serpentine SoilAENGGHSEIHRTNGASRRPARDSRNTPGPVRISESEPITES*
Ga0126305_1013154313300010036Serpentine SoilTAGKMIFGRLWEEAENGGHNEIHRTNGASRRQVRDSRNSPGPVRISEGEPITES*
Ga0126304_1035263513300010037Serpentine SoilGKLIFGRLWEEAENGGHSEIHRTNGASRRPARDSRNTPGPVRISESEPITES*
Ga0126315_1107677723300010038Serpentine SoilHSDIHRTNGASRRQVRDSRNPPAPVRISEGEPITES*
Ga0126314_1045368213300010042Serpentine SoilFGRLWEEAENGGHSDIHRTNGASRRQVRDSRNSPSPVRISESEPITES*
Ga0126382_1051720733300010047Tropical Forest SoilGRLWEEAENGGHSDIHRTNGASRRQARESRNTPAPVRISESEPITES*
Ga0126382_1054877113300010047Tropical Forest SoilKMIFGRLWEEAENGGHSDIHRTNGASRRQVRDSRNTPAPVRISESEPITES*
Ga0126306_1169497213300010166Serpentine SoilHSDIHRTNGASRRQARDSRNTPAPVRISEGEPIAES*
Ga0126370_1086735023300010358Tropical Forest SoilWEETENGGHSDIHRTNGASRRQARDSRNTPAPVRISESEPVTEA*
Ga0134126_1301091713300010396Terrestrial SoilTAGKMIFGRLWEEAENGGHSEIHRTNGASRRQARDSRNTPAPVRISESEPITET*
Ga0134124_1052208213300010397Terrestrial SoilMIFGRLWEEAENGGHSDIHRTNGASRRQARDSRNSPAPVRIADSEPVTES*
Ga0134124_1096411013300010397Terrestrial SoilTAGKMIFGRLWEEAENGGHSDIHRTNGASRRQVRDSRNAPAPVRISESEPITES*
Ga0134127_1065344213300010399Terrestrial SoilAGKMIFGRLWEEAENGHNDIHRTNGGSRRQVRDSRSGPHPVRITDSEPITES*
Ga0134127_1330313823300010399Terrestrial SoilGRLWEEAENGHSDIHRTNGSSRRQMRESRSGPHPVRITDSEPITES*
Ga0134122_1318785823300010400Terrestrial SoilGHSDIHRTNGASRRQARDSRNTPAPVRISESEPITES*
Ga0157332_102752623300012511SoilFGRLWEEAENGGHNDIHRTNGTSRRQARDSRSAPGPVRITDSDAITET*
Ga0137396_1113370613300012918Vadose Zone SoilVLQTTAGKMICGRLWEEPENGTVSGENRMNGSTRRPSRDIRNGPVPVRITDSEPITES*
Ga0137404_1173096923300012929Vadose Zone SoilLQTTAGKMIFGRLWEDPENGSPSGEHRINGSTRRQVRDPRSSGPLPVRITDTEPITEL*
Ga0162651_10009075823300012938SoilTAGKMIFGRLWEEAENGGHSDIHRTHGASRRQVRESRNTPAPVRISESEPITES*
Ga0164307_1136939013300012987SoilLWEEAENGGHNDIHRTNGTSRRQARDSRSAPGPVRITDSDAITET*
Ga0157374_1087720713300013296Miscanthus RhizosphereAVTSVLQTTACNMIFGRLWEEAENGHNDIHRTNGGSRRQMRESRSGPHPVRITDSEPITET*
Ga0157378_1019482443300013297Miscanthus RhizosphereLQTTAGKMIFGRLWEEAENGGGHNEIHRTNGSSRRQTRESRTTPGPVRITDSDAITET*
Ga0163162_1153964823300013306Switchgrass RhizosphereLQTTAGKMIFGRLWEEPENGANTGEHRVNGSTRRPTRESRTGPLPVRINDTEPITES*
Ga0157372_1253517323300013307Corn RhizosphereLWEEAENGHNDIHRTNGSSRRQMRDSRSGPHPVRITDSEPITES*
Ga0163163_10003486153300014325Switchgrass RhizosphereGHNDIHRTNGTSRRQARDSRSAPGPVRITDSDAITET*
Ga0157380_1112041523300014326Switchgrass RhizosphereGGHSEIHRTNGASRRQLRDRNAPSPVRISESEPITES*
Ga0157380_1170996413300014326Switchgrass RhizosphereTAGKMIFGRLWEEAENGGHSDIHRTNGASRRQMRDSRSTPAPVRISESEPITES*
Ga0157380_1317640513300014326Switchgrass RhizosphereGKMIFGRLWEEAENGGHSEIHRTNGASRRQARDSRNNPAPVRISESEPITET*
Ga0157377_1095991013300014745Miscanthus RhizosphereFGRLWEEAENGGHSEIHRTNGASRRQARDSRNTPAPVRISESEPITET*
Ga0137418_1010216433300015241Vadose Zone SoilMIFGRLWEEAENGVHNGEHRTNGATRRQSRDPRSSPGPVRITDSEAITES*
Ga0180071_108098823300015249SoilAVTSVLQTTAGKMIFGRLWEEPENGNSGEHRINGSVRRQSRSGPLPVRITDSEPITES*
Ga0132258_1147566013300015371Arabidopsis RhizosphereGKMIFGRLWEEAENSGSHNEIHRTNGTSRRQMRDSRSAPGPVRITDTEAITEA*
Ga0132258_1162263233300015371Arabidopsis RhizosphereGKMIFGRLWEEAENSGSHNEIHRTNGTSRRQMRDSRSAPGPVRITDTEAITET*
Ga0132255_10555709423300015374Arabidopsis RhizosphereLWEEAENSGSHNEIHRTNGTSRRQMRDSRSAPGPVRITDTEAITET*
Ga0184623_1032513923300018056Groundwater SedimentGKMIFGRLWEEAENGNGEHRTNGATRRPQRDPRGTPVPVRVTDSEPVLE
Ga0184639_1041316713300018082Groundwater SedimentGKMIFGRVWEDAENGNGEYRTNGAARRPQRDSRSTPGPIRITDSEPMIE
Ga0190265_1152554313300018422SoilSDIHRTNGASRRQLRDSRSGPAPVRISESEPITES
Ga0190265_1153121113300018422SoilRLWEEAENGGHSDIHRTNGASRRQLRDSRSGPAPVRISESEPITES
Ga0190273_1180966613300018920SoilKMIFGRLWEDPENSVSGEHRANGAARRPARDVRATPVRIIDGEPITES
Ga0190264_1076478823300019377SoilRLWEEAENGGHSDIHRTNGASRRQMRDSRSTPAPVRISEGEPVTES
Ga0210377_1019676733300021090Groundwater SedimentGKMIFGRLWEEPENGSPGGENRTNGSARRQSRDSRSGPLPVRITDTEPITEL
Ga0182009_1000099613300021445SoilMIFGRLWEEAENGGHSDIHRTNGTSRRGARDPRNSPAPVRIAESEPVTES
Ga0247693_106948623300024181SoilENGHNDIHRTNGGTRRQMRESRSGPHPVRIADSEPVTES
Ga0207680_1034278023300025903Switchgrass RhizosphereWEEAENGGHNEIHRTNGSSRRQTRDSRTAPGPVRITDTEAITET
Ga0207671_1102266813300025914Corn RhizosphereSDIHRTNGASRRQARESRNTPAPVRISESEPITET
Ga0207663_1109924323300025916Corn, Switchgrass And Miscanthus RhizosphereIFGRLWEEAENSGSHNEIHRTNGTSRRQMRESRTAPGPVRITETEAITET
Ga0207660_1068604713300025917Corn RhizosphereTAGKMIFGRLWEEAENGGHNEIHRTNGSSRRQTRDSRTAPGPVRITDTEAITET
Ga0207681_1117463723300025923Switchgrass RhizosphereEAENGGHSEIHRTNGASRRQLRDRNAPAPVRISESEPITES
Ga0207650_1048845113300025925Switchgrass RhizosphereGRLWEEAENGGHSDIHRTNGASRRQARDSRNSPAPVRIADSEPVTES
Ga0207687_1010350243300025927Miscanthus RhizosphereIFGRLWEEAENGGHNEIHRTNGSSRRQTRDSRTAPGPVRITDTEAITET
Ga0207691_1077010123300025940Miscanthus RhizosphereMIFGRLWEESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES
Ga0207689_1064586113300025942Miscanthus RhizosphereGGHSEIHRTNGASRRQLRDSRSGPAPVRISESEPVTES
Ga0207689_1095700113300025942Miscanthus RhizosphereTAGKMIFGRLWEEAENGHSEIHRTNGASRRQLRDRNSPAPVRISESEPITES
Ga0207689_1115898413300025942Miscanthus RhizosphereKMIFGRLWEEPENGFSGEHRANGTTRRPSRDARNSGPVRITDGEPITES
Ga0207679_1127021413300025945Corn RhizosphereSDIHRTNGGSRRPARDTRSSAPGPVRINDSEPITET
Ga0207712_1083475223300025961Switchgrass RhizosphereTAGKMIFGRLWEEPENGFSGEHRANGTTRRPSRDARNSGPVRITDGEPITES
Ga0207640_1113463323300025981Corn RhizosphereTTAGKMIFGRLWEEAENGGGHNEIHRTNGSSRRQTRESRTTPGPVRITDSDAITET
Ga0207640_1125293723300025981Corn RhizosphereLWEEAENGHNDIHRTNGGSRRQMRESRSGPHPVRITDSEPITET
Ga0207703_1049513733300026035Switchgrass RhizosphereGHSDIHRTNGASRRQARESRNTPAPVRISESEPITET
Ga0207641_1011858213300026088Switchgrass RhizosphereNGGHSDIHRTNGASRRQARDSRNSPAPVRIADSEPVTES
Ga0207676_1134092513300026095Switchgrass RhizosphereNDIHRTNGGSRRQMRESRSGPHPVRITDSEPVAES
Ga0207675_10048634013300026118Switchgrass RhizosphereHNEIHRTNGTARRQARDPRSAPGPVRITDSDAITET
Ga0207675_10215661923300026118Switchgrass RhizosphereEAENGGHSDIHRTNGGSRRMRDSRSGPHPVRINDTEPITES
Ga0207675_10247894113300026118Switchgrass RhizosphereEAENGGHNDIHRTNGTSRRQARDSRSAPGPVRITDSDAITET
Ga0207683_1166200813300026121Miscanthus RhizosphereQTTAGKMIFGRLWEEPENGFTGEHRVNGATRRPTRDARNSGPVRITDGEPITES
Ga0209438_107817313300026285Grasslands SoilMIFGRLWEEADNGTHNDVHRTNGATRRPTRDTRSAPGPVRITDSEPVTEI
Ga0209387_112117113300027639Agricultural SoilMIFGRLWEDAENGNGEHRTNGSARRQTRDSRSTPGPVRISDSEPVIE
Ga0207428_1107845913300027907Populus RhizosphereGKMIFGRLWEESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES
Ga0268266_1166037023300028379Switchgrass RhizosphereCGHNEIHRTNGGARRPPRDTRAAAGSVRITDSEPITEA
Ga0268265_1060938513300028380Switchgrass RhizosphereMIFGRLWEEAENGNGEHRTNGSARRQTRDTRTTPGPVRISDTEPVID
Ga0268265_1267616813300028380Switchgrass RhizosphereLWEEAENGGHSDIHRTNGGSRRPARDTRSSAPGPVRINDSEPITET
Ga0268264_1006889713300028381Switchgrass RhizosphereRLWEEAENGGHSEIHRTNGASRRQLRGESRNAPAPVRISESEPITES
Ga0268264_1092063723300028381Switchgrass RhizosphereGKMIFGRLWEEAENGGHSDIHRTNGASRRQVRDSRNTPAPVRISEGEPITES
Ga0268264_1226598223300028381Switchgrass RhizosphereMIFGRLWEEAENGGHSEIHRTNGASRRQLRDRNAPSPVRISESEPITES
Ga0310888_1068138313300031538SoilLWEESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES
Ga0307408_10175400913300031548RhizosphereRLWEEAENGGHSEIHRTNGASRRQLRDSRSGPAPVRISESEPVTES
Ga0310813_1029849313300031716SoilEAENGGHSDIHRTNGASRRQARESRNTPAPVRISESEPIIES
Ga0310892_1092015323300031858SoilNDIHRTNGGSRRQMRDSRSGPHPVRITDSEPITES
Ga0307412_1034271233300031911RhizosphereTAGKMIFGRLWEEAENGGHSEIHRTNGASRRQLRDSRSGPAPVRISESEPVTES
Ga0307409_10129646113300031995RhizosphereEEAENGGHSDIHRTNGASRRQGRDSRNAPGPVRISDSEPVTES
Ga0310810_1126933113300033412SoilQTTAGKMIFGRLWEDAENGGHSDIHRTNGASRRQSRDSRNTPAPVRIAESEPVTES


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.