| Basic Information | |
|---|---|
| Family ID | F045990 |
| Family Type | Metagenome |
| Number of Sequences | 152 |
| Average Sequence Length | 48 residues |
| Representative Sequence | KMIFGRLWEEAENGGHSDIHRTNGASRRQVRDSRNTPAPVRISESEPITES |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.03 % |
| % of genes from short scaffolds (< 2000 bps) | 94.08 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.711 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.342 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (69.737 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 5.06% Coil/Unstructured: 94.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF01128 | IspD | 81.58 |
| PF02542 | YgbB | 8.55 |
| PF02885 | Glycos_trans_3N | 4.61 |
| PF02653 | BPD_transp_2 | 1.32 |
| PF07831 | PYNP_C | 1.32 |
| PF01938 | TRAM | 0.66 |
| PF04820 | Trp_halogenase | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 81.58 |
| COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 81.58 |
| COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 81.58 |
| COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 81.58 |
| COG0245 | 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | Lipid transport and metabolism [I] | 8.55 |
| COG0213 | Thymidine phosphorylase | Nucleotide transport and metabolism [F] | 1.32 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.71 % |
| Unclassified | root | N/A | 28.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101189940 | Not Available | 778 | Open in IMG/M |
| 3300000789|JGI1027J11758_11505324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300000956|JGI10216J12902_110580036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300003316|rootH1_10173787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1040 | Open in IMG/M |
| 3300003324|soilH2_10001122 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300004114|Ga0062593_101258060 | Not Available | 781 | Open in IMG/M |
| 3300004157|Ga0062590_101120315 | Not Available | 760 | Open in IMG/M |
| 3300004463|Ga0063356_102697080 | Not Available | 764 | Open in IMG/M |
| 3300005293|Ga0065715_10210746 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300005293|Ga0065715_10546537 | Not Available | 713 | Open in IMG/M |
| 3300005328|Ga0070676_11191038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300005335|Ga0070666_10702047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 742 | Open in IMG/M |
| 3300005336|Ga0070680_101663104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300005340|Ga0070689_102105542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300005356|Ga0070674_101910270 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005406|Ga0070703_10343893 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005438|Ga0070701_11315454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300005438|Ga0070701_11375921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300005440|Ga0070705_100325573 | Not Available | 1111 | Open in IMG/M |
| 3300005440|Ga0070705_100741369 | Not Available | 776 | Open in IMG/M |
| 3300005441|Ga0070700_100240333 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300005445|Ga0070708_100236664 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300005445|Ga0070708_101857175 | Not Available | 559 | Open in IMG/M |
| 3300005459|Ga0068867_101096599 | Not Available | 727 | Open in IMG/M |
| 3300005459|Ga0068867_101834905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300005530|Ga0070679_100639124 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300005543|Ga0070672_100575238 | Not Available | 980 | Open in IMG/M |
| 3300005546|Ga0070696_100177009 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300005546|Ga0070696_101251137 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005549|Ga0070704_100261509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1426 | Open in IMG/M |
| 3300005564|Ga0070664_102059589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300005577|Ga0068857_100701054 | Not Available | 962 | Open in IMG/M |
| 3300005577|Ga0068857_101696155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300005578|Ga0068854_101383187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300005578|Ga0068854_101623507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300005578|Ga0068854_101927451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300005615|Ga0070702_100081749 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300005617|Ga0068859_101748724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300005718|Ga0068866_10336943 | Not Available | 954 | Open in IMG/M |
| 3300005719|Ga0068861_100232933 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300005719|Ga0068861_100798515 | Not Available | 885 | Open in IMG/M |
| 3300005719|Ga0068861_101224352 | Not Available | 727 | Open in IMG/M |
| 3300005842|Ga0068858_101245740 | Not Available | 731 | Open in IMG/M |
| 3300005843|Ga0068860_102824957 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005844|Ga0068862_102059286 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005844|Ga0068862_102448166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300006169|Ga0082029_1270128 | Not Available | 594 | Open in IMG/M |
| 3300006173|Ga0070716_100243554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
| 3300006624|Ga0101567_10500399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300006755|Ga0079222_11113649 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300006794|Ga0066658_10639948 | Not Available | 582 | Open in IMG/M |
| 3300006806|Ga0079220_11658939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300006844|Ga0075428_102243756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 563 | Open in IMG/M |
| 3300006854|Ga0075425_101207239 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300006871|Ga0075434_100331436 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300006880|Ga0075429_100218730 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300006894|Ga0079215_11003262 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006969|Ga0075419_10070642 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
| 3300007004|Ga0079218_10045459 | All Organisms → cellular organisms → Bacteria | 2684 | Open in IMG/M |
| 3300007004|Ga0079218_10867683 | Not Available | 880 | Open in IMG/M |
| 3300007076|Ga0075435_101477322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300009093|Ga0105240_12367730 | Not Available | 550 | Open in IMG/M |
| 3300009094|Ga0111539_10672266 | Not Available | 1206 | Open in IMG/M |
| 3300009094|Ga0111539_12028004 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300009100|Ga0075418_12020806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300009101|Ga0105247_10296109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1121 | Open in IMG/M |
| 3300009156|Ga0111538_13433167 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009156|Ga0111538_13798202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300009176|Ga0105242_10422457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1249 | Open in IMG/M |
| 3300009177|Ga0105248_11941495 | Not Available | 668 | Open in IMG/M |
| 3300009177|Ga0105248_12089355 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300009840|Ga0126313_11668210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300010036|Ga0126305_10131543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1539 | Open in IMG/M |
| 3300010037|Ga0126304_10352635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300010038|Ga0126315_11076777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300010042|Ga0126314_10453682 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300010047|Ga0126382_10517207 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300010047|Ga0126382_10548771 | Not Available | 940 | Open in IMG/M |
| 3300010166|Ga0126306_11694972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300010358|Ga0126370_10867350 | Not Available | 812 | Open in IMG/M |
| 3300010396|Ga0134126_13010917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300010397|Ga0134124_10522082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1152 | Open in IMG/M |
| 3300010397|Ga0134124_10964110 | Not Available | 863 | Open in IMG/M |
| 3300010399|Ga0134127_10653442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1086 | Open in IMG/M |
| 3300010399|Ga0134127_13303138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300010400|Ga0134122_13187858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 514 | Open in IMG/M |
| 3300012511|Ga0157332_1027526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 705 | Open in IMG/M |
| 3300012918|Ga0137396_11133706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300012929|Ga0137404_11730969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300012938|Ga0162651_100090758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300012987|Ga0164307_11369390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300013296|Ga0157374_10877207 | Not Available | 914 | Open in IMG/M |
| 3300013297|Ga0157378_10194824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1914 | Open in IMG/M |
| 3300013306|Ga0163162_11539648 | Not Available | 758 | Open in IMG/M |
| 3300013307|Ga0157372_12535173 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300014325|Ga0163163_10003486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 13352 | Open in IMG/M |
| 3300014326|Ga0157380_11120415 | Not Available | 827 | Open in IMG/M |
| 3300014326|Ga0157380_11709964 | Not Available | 687 | Open in IMG/M |
| 3300014326|Ga0157380_13176405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300014745|Ga0157377_10959910 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300015241|Ga0137418_10102164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2578 | Open in IMG/M |
| 3300015249|Ga0180071_1080988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300015371|Ga0132258_11475660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1718 | Open in IMG/M |
| 3300015371|Ga0132258_11622632 | Not Available | 1632 | Open in IMG/M |
| 3300015374|Ga0132255_105557094 | Not Available | 533 | Open in IMG/M |
| 3300018056|Ga0184623_10325139 | Not Available | 692 | Open in IMG/M |
| 3300018422|Ga0190265_11525543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300018422|Ga0190265_11531211 | Not Available | 780 | Open in IMG/M |
| 3300018920|Ga0190273_11809666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300019377|Ga0190264_10764788 | Not Available | 728 | Open in IMG/M |
| 3300021090|Ga0210377_10196767 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300021445|Ga0182009_10000996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 7177 | Open in IMG/M |
| 3300024181|Ga0247693_1069486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300025903|Ga0207680_10342780 | Not Available | 1048 | Open in IMG/M |
| 3300025914|Ga0207671_11022668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300025916|Ga0207663_11099243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300025917|Ga0207660_10686047 | Not Available | 835 | Open in IMG/M |
| 3300025923|Ga0207681_11174637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300025925|Ga0207650_10488451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1028 | Open in IMG/M |
| 3300025927|Ga0207687_10103502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2100 | Open in IMG/M |
| 3300025940|Ga0207691_10770101 | Not Available | 810 | Open in IMG/M |
| 3300025942|Ga0207689_10645861 | Not Available | 891 | Open in IMG/M |
| 3300025942|Ga0207689_10957001 | Not Available | 722 | Open in IMG/M |
| 3300025942|Ga0207689_11158984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300025945|Ga0207679_11270214 | Not Available | 676 | Open in IMG/M |
| 3300025961|Ga0207712_10834752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300025981|Ga0207640_11134633 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300025981|Ga0207640_11252937 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300026035|Ga0207703_10495137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1147 | Open in IMG/M |
| 3300026088|Ga0207641_10118582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2358 | Open in IMG/M |
| 3300026095|Ga0207676_11340925 | Not Available | 711 | Open in IMG/M |
| 3300026118|Ga0207675_100486340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1227 | Open in IMG/M |
| 3300026118|Ga0207675_102156619 | Not Available | 573 | Open in IMG/M |
| 3300026118|Ga0207675_102478941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300026121|Ga0207683_11662008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300026285|Ga0209438_1078173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1066 | Open in IMG/M |
| 3300027639|Ga0209387_1121171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300027907|Ga0207428_11078459 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300028379|Ga0268266_11660370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300028380|Ga0268265_10609385 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300028380|Ga0268265_12676168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300028381|Ga0268264_10068897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2991 | Open in IMG/M |
| 3300028381|Ga0268264_10920637 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300028381|Ga0268264_12265982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300031538|Ga0310888_10681383 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300031548|Ga0307408_101754009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300031716|Ga0310813_10298493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1358 | Open in IMG/M |
| 3300031858|Ga0310892_10920153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300031911|Ga0307412_10342712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1197 | Open in IMG/M |
| 3300031995|Ga0307409_101296461 | Not Available | 753 | Open in IMG/M |
| 3300033412|Ga0310810_11269331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 585 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 12.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.95% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.66% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.66% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.66% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.66% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.66% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.66% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003316 | Sugarcane root Sample L1 | Host-Associated | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006624 | Soil microbial communities from the Leymus chinensis steppe, China - after adding 1.75 g N m- 2, yr-1 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015249 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293A_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1011899402 | 3300000364 | Soil | FGRLWEEAESGGHNDIHRTNGTXRRQSRESRXAPGPVRITDGDAITEI* |
| JGI1027J11758_115053242 | 3300000789 | Soil | MIFGRLWEEAESGGHNDIHRTNGTVRRQSRESRNAPGPVRITDGDAITEI* |
| JGI10216J12902_1105800361 | 3300000956 | Soil | KMIFGRLWEEAENGGHGDIHRTNGASRRQARDSRSGPAPVRISETEPITES* |
| rootH1_101737871 | 3300003316 | Sugarcane Root And Bulk Soil | GKMIFGRLWEEAENGHNDIHRTNGGSRRQMRESRSGPHPVRITDSEPITET* |
| soilH2_100011223 | 3300003324 | Sugarcane Root And Bulk Soil | AENGGHSDIHRTNGASRRQVRESRNSPAPVRISESEPITES* |
| Ga0062593_1012580601 | 3300004114 | Soil | RLWEEAENGHNDIHRTNGGSRRMRDSRSGPHPVRITDTEPITES* |
| Ga0062590_1011203151 | 3300004157 | Soil | WEEAENGGHSDIHRTNGGSRRPARDTRSSAPGPVRINDSEPITET* |
| Ga0063356_1026970802 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TAGKMIFGRLWEEAENGGHSDIHRTNGASRRQARDSRNTPGPVRISDTEPVTES* |
| Ga0065715_102107463 | 3300005293 | Miscanthus Rhizosphere | IFGRLWEEAENGGHSEIHRTNGASRRQLRDRNSPAPVRISESEPITES* |
| Ga0065715_105465372 | 3300005293 | Miscanthus Rhizosphere | KMIFGRLWEEAENGGHSDIHRTNGASRRQVRESRNTPAPVRISESEPITES* |
| Ga0070676_111910382 | 3300005328 | Miscanthus Rhizosphere | ENGGHNEIHRTNGSSRRQTRDSRTAPGPVRITDTEAITET* |
| Ga0070666_107020472 | 3300005335 | Switchgrass Rhizosphere | WEEAENGGHNDIHRTNGTSRRQARDSRSAPGPVRITDSDAITET* |
| Ga0070680_1016631041 | 3300005336 | Corn Rhizosphere | GKMIFGRLWEEAENGGHNEIHRTNGSSRRQTRDSRTAPGPVRITDTEAITET* |
| Ga0070689_1021055421 | 3300005340 | Switchgrass Rhizosphere | AGKMIFGRLWEEAENGGHSDIHRTNGASRRQARDSRNSPAPVRISESEPITES* |
| Ga0070674_1019102701 | 3300005356 | Miscanthus Rhizosphere | SENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES* |
| Ga0070703_103438931 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFGRLWEEAENGGHSDIHRTNGASRRQVRDSRNTPAPVRFSESEPITES* |
| Ga0070701_113154542 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | EAENGGHSDIHRTNGGSRRPARDTRSSAPGPVRINDSEPITET* |
| Ga0070701_113759211 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFGRLWEEPENGFSGEHRANGTTRRPTRDARSGSGPVRITDGEPITES* |
| Ga0070705_1003255731 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GKMIFGRLWEEAENGNGEHRTNGSARRQPRDSRSGPGPVRISDSEPVMD* |
| Ga0070705_1007413691 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | TAGKMIFGRLWEEAENGGHSDIHRTNGASRRQARESRNTPAPVRISESEPITET* |
| Ga0070700_1002403333 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | TAGKMIFGRLWEEPENGNSGEHRINGSVRRQSRSGPLPVRISDGEPITES* |
| Ga0070708_1002366641 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ENGGHSDIHRTNGASRRQTRDSRSAPAPVRISETEPITES* |
| Ga0070708_1018571751 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TAGKMIFGRLWEEAENGHSDIHRTNGGSRRMRDSRSGPHPVRITDTEPITES* |
| Ga0068867_1010965991 | 3300005459 | Miscanthus Rhizosphere | TTAGKMIFGRLWEEAENGGHSDIHRTNGASRRQMRDSRNAPGPVRISDTEPVTES* |
| Ga0068867_1018349051 | 3300005459 | Miscanthus Rhizosphere | AGKMIFGRLWEEAENSGHSDIHRTNGGSRRQPRDSRSAPGPVRINDSEPITEI* |
| Ga0070679_1006391241 | 3300005530 | Corn Rhizosphere | EEAENGGHSDIHRTNGASRRQARDSRNTPAPVRISESEPITES* |
| Ga0070672_1005752381 | 3300005543 | Miscanthus Rhizosphere | QTTAGKMIFGRLWEEAENGGHSDIHRTNGASRRQARESRNTPAPVRISESEPITET* |
| Ga0070696_1001770091 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | KMIFGRLWEEAENGGHSDIHRTNGASRRQMRDSRSTPAPVRISESEPVTES* |
| Ga0070696_1012511371 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VLQTTAGKMIFGRLWEEAENGGHSEIHRTNGASRRQLRGESRNTPSPVRISESEPITES* |
| Ga0070704_1002615091 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFGRLWEEAENGHSDIHRTNGSSRRQMRDSRSGPHPVRITDSEPITEI* |
| Ga0070664_1020595891 | 3300005564 | Corn Rhizosphere | FGRLWEEAENGHSEIHRTNGASRRQLRDRNSPAPVRISESEPITES* |
| Ga0068857_1007010542 | 3300005577 | Corn Rhizosphere | AGKMIFGRLWEEAENGGHSDIHRTNGGSRRPARDTRSSAPGPVRINDSEPITET* |
| Ga0068857_1016961552 | 3300005577 | Corn Rhizosphere | EAENGGHSDIHRTNGASRRQARDSRNSPAPVRIADSEPVTES* |
| Ga0068854_1013831871 | 3300005578 | Corn Rhizosphere | LWEEAENGHNDIHRTNGGSRRQMRESRSGPHPVRITDSEPITET* |
| Ga0068854_1016235072 | 3300005578 | Corn Rhizosphere | IFGRLWEEAENGGHSDIHRTNGASRRQVRESRNTPAPVRISESEPITES* |
| Ga0068854_1019274512 | 3300005578 | Corn Rhizosphere | TAGKMIFGRLWEEAENGGHSEIHRTNGASRRQLRGDSRNTPSPVRITESEPITES* |
| Ga0070702_1000817491 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GKMIFGRLWEEAENGGHSDIHRTNGASRRQVRESRNTPSPVRISESEPITES* |
| Ga0068859_1017487242 | 3300005617 | Switchgrass Rhizosphere | TAGKMIFGRLWEEPENGNSGEHRINGSVRRQSRSGPLPVRIADGEPITES* |
| Ga0068866_103369432 | 3300005718 | Miscanthus Rhizosphere | WEESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES* |
| Ga0068861_1002329333 | 3300005719 | Switchgrass Rhizosphere | RLWEEAENSGHSDIHRTNGGSRRQPRDSRSAPGPVRINDSEPITEI* |
| Ga0068861_1007985152 | 3300005719 | Switchgrass Rhizosphere | MIFGRLWEEAENGGHSEIHRTNGASRRQLRDRNSPAPVRISESEPITES* |
| Ga0068861_1012243522 | 3300005719 | Switchgrass Rhizosphere | DIHRTNGTSRRQARDSRSAPGPVRITDSDAITET* |
| Ga0068858_1012457401 | 3300005842 | Switchgrass Rhizosphere | TTAGKMIFGRLWEEAENGGHSEIHRTNGASRRQLRDRNAPSPVRISESEPITES* |
| Ga0068860_1028249572 | 3300005843 | Switchgrass Rhizosphere | AGKMIFGRLWEEPENGSSSGEHRVNGSARRQSRDPRNGPMPVRFNDAEPITET* |
| Ga0068862_1020592862 | 3300005844 | Switchgrass Rhizosphere | TAGKMIFGRLWEEAENGGHSDIHRTNGASRRQARDSRNTPAPVRISDSEPVTES* |
| Ga0068862_1024481661 | 3300005844 | Switchgrass Rhizosphere | LWEEAENGGHSDIHRTNGGSRRPARDTRSSAPGPVRINDSEPITET* |
| Ga0082029_12701281 | 3300006169 | Termite Nest | SDIHRTNGAARRQARESRNTPAPVRISESEPITET* |
| Ga0070716_1002435541 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GKMIFGRLWEEADNGHNDIHRTNGGSRRQMRESRSGPHPVRITDSEPITES* |
| Ga0101567_105003992 | 3300006624 | Soil | IFGRLWEEAENGAHNDVHRTNGTTRRPARDSRSTPGPVRITDSEPITEG* |
| Ga0079222_111136491 | 3300006755 | Agricultural Soil | RLWEEAENGHNDIHRTNGGSRRQMRESRSGPHPVRITDSEPITET* |
| Ga0066658_106399482 | 3300006794 | Soil | DESENGGHSDIHRTNGASRRQMRDTRSGPTSVRIPESEPITES* |
| Ga0079220_116589392 | 3300006806 | Agricultural Soil | DIHRTNGASRRQVRESRNSPAPVRISESEPITES* |
| Ga0075428_1022437562 | 3300006844 | Populus Rhizosphere | TAGKMIFGRLWEEAENGGHSDIHRTNGASRRQMRDSRNTPGPVRISDTEPVTES* |
| Ga0075425_1012072391 | 3300006854 | Populus Rhizosphere | ENSGSHNEIHRTNGTSRRQMRDSRSAPGPVRITDTEAITEA* |
| Ga0075434_1003314361 | 3300006871 | Populus Rhizosphere | NSGSHNEIHRTNGTSRRQMRDSRSAPGPVRITDTEAITEA* |
| Ga0075429_1002187301 | 3300006880 | Populus Rhizosphere | TTAGKMIFGRLWEEAENGGHSDIHRTNGGSRRQMRDSRSAPGPVRITDGEPITES* |
| Ga0079215_110032622 | 3300006894 | Agricultural Soil | HSDIHRTNGASRRQARDSRNAPAPVRISESEPITES* |
| Ga0075419_100706421 | 3300006969 | Populus Rhizosphere | SDIHRTNGASRRQFRDSRSGPAPVRISESEPITES* |
| Ga0079218_100454591 | 3300007004 | Agricultural Soil | GKMIFGRLWEEAENGGHSDTHRTNGGSRRQVRDSRSAPGPVRITDSEPITES* |
| Ga0079218_108676831 | 3300007004 | Agricultural Soil | KMIFGRLWEEAENGGHSDIHRTNGASRRQMRDSRNTPAPVRISDSEPVTES* |
| Ga0075435_1014773222 | 3300007076 | Populus Rhizosphere | GRLWEEAENGGHSDIHRTNGASRRQARDSRNSPAPVRIADSEPVTES* |
| Ga0105240_123677301 | 3300009093 | Corn Rhizosphere | TAGKMIFGRLWEEAENGGHSDIHRTNGASRRQARDSRNTPSPVRISESEPVTES* |
| Ga0111539_106722663 | 3300009094 | Populus Rhizosphere | GKMIFGRLWEESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES* |
| Ga0111539_120280041 | 3300009094 | Populus Rhizosphere | KMIFGRLWEESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES* |
| Ga0075418_120208062 | 3300009100 | Populus Rhizosphere | GRLWEEAENGGHSDIHRTNGGSRRQMRDSRSAPGPVRITDSEPITES* |
| Ga0105247_102961091 | 3300009101 | Switchgrass Rhizosphere | AGKMIFGRLWEEAENGGHSDIHRTNGASRRQVRDSRNSPAPVRISESEPITES* |
| Ga0111538_134331672 | 3300009156 | Populus Rhizosphere | ESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES* |
| Ga0111538_137982022 | 3300009156 | Populus Rhizosphere | AGKMIFGRLWEEAENGGHSDIHRTNGASRRQARDARNTPAPVRISESEPITES* |
| Ga0105242_104224573 | 3300009176 | Miscanthus Rhizosphere | LQTTAGKMIFGRLWEEAENGGHSEIHRTNGASRRQLRDRNSPAPVRISESEPITES* |
| Ga0105248_119414952 | 3300009177 | Switchgrass Rhizosphere | ENGGHSDIHRTNGASRRQVRESRNTPAPVRISESEPITES* |
| Ga0105248_120893551 | 3300009177 | Switchgrass Rhizosphere | SVLQTTAGKMIFGRLWEEAENGHNDIHRTNGGSRRTRESRSAPGPVRINDTEPITET* |
| Ga0126313_116682101 | 3300009840 | Serpentine Soil | AENGGHSEIHRTNGASRRPARDSRNTPGPVRISESEPITES* |
| Ga0126305_101315431 | 3300010036 | Serpentine Soil | TAGKMIFGRLWEEAENGGHNEIHRTNGASRRQVRDSRNSPGPVRISEGEPITES* |
| Ga0126304_103526351 | 3300010037 | Serpentine Soil | GKLIFGRLWEEAENGGHSEIHRTNGASRRPARDSRNTPGPVRISESEPITES* |
| Ga0126315_110767772 | 3300010038 | Serpentine Soil | HSDIHRTNGASRRQVRDSRNPPAPVRISEGEPITES* |
| Ga0126314_104536821 | 3300010042 | Serpentine Soil | FGRLWEEAENGGHSDIHRTNGASRRQVRDSRNSPSPVRISESEPITES* |
| Ga0126382_105172073 | 3300010047 | Tropical Forest Soil | GRLWEEAENGGHSDIHRTNGASRRQARESRNTPAPVRISESEPITES* |
| Ga0126382_105487711 | 3300010047 | Tropical Forest Soil | KMIFGRLWEEAENGGHSDIHRTNGASRRQVRDSRNTPAPVRISESEPITES* |
| Ga0126306_116949721 | 3300010166 | Serpentine Soil | HSDIHRTNGASRRQARDSRNTPAPVRISEGEPIAES* |
| Ga0126370_108673502 | 3300010358 | Tropical Forest Soil | WEETENGGHSDIHRTNGASRRQARDSRNTPAPVRISESEPVTEA* |
| Ga0134126_130109171 | 3300010396 | Terrestrial Soil | TAGKMIFGRLWEEAENGGHSEIHRTNGASRRQARDSRNTPAPVRISESEPITET* |
| Ga0134124_105220821 | 3300010397 | Terrestrial Soil | MIFGRLWEEAENGGHSDIHRTNGASRRQARDSRNSPAPVRIADSEPVTES* |
| Ga0134124_109641101 | 3300010397 | Terrestrial Soil | TAGKMIFGRLWEEAENGGHSDIHRTNGASRRQVRDSRNAPAPVRISESEPITES* |
| Ga0134127_106534421 | 3300010399 | Terrestrial Soil | AGKMIFGRLWEEAENGHNDIHRTNGGSRRQVRDSRSGPHPVRITDSEPITES* |
| Ga0134127_133031382 | 3300010399 | Terrestrial Soil | GRLWEEAENGHSDIHRTNGSSRRQMRESRSGPHPVRITDSEPITES* |
| Ga0134122_131878582 | 3300010400 | Terrestrial Soil | GHSDIHRTNGASRRQARDSRNTPAPVRISESEPITES* |
| Ga0157332_10275262 | 3300012511 | Soil | FGRLWEEAENGGHNDIHRTNGTSRRQARDSRSAPGPVRITDSDAITET* |
| Ga0137396_111337061 | 3300012918 | Vadose Zone Soil | VLQTTAGKMICGRLWEEPENGTVSGENRMNGSTRRPSRDIRNGPVPVRITDSEPITES* |
| Ga0137404_117309692 | 3300012929 | Vadose Zone Soil | LQTTAGKMIFGRLWEDPENGSPSGEHRINGSTRRQVRDPRSSGPLPVRITDTEPITEL* |
| Ga0162651_1000907582 | 3300012938 | Soil | TAGKMIFGRLWEEAENGGHSDIHRTHGASRRQVRESRNTPAPVRISESEPITES* |
| Ga0164307_113693901 | 3300012987 | Soil | LWEEAENGGHNDIHRTNGTSRRQARDSRSAPGPVRITDSDAITET* |
| Ga0157374_108772071 | 3300013296 | Miscanthus Rhizosphere | AVTSVLQTTACNMIFGRLWEEAENGHNDIHRTNGGSRRQMRESRSGPHPVRITDSEPITET* |
| Ga0157378_101948244 | 3300013297 | Miscanthus Rhizosphere | LQTTAGKMIFGRLWEEAENGGGHNEIHRTNGSSRRQTRESRTTPGPVRITDSDAITET* |
| Ga0163162_115396482 | 3300013306 | Switchgrass Rhizosphere | LQTTAGKMIFGRLWEEPENGANTGEHRVNGSTRRPTRESRTGPLPVRINDTEPITES* |
| Ga0157372_125351732 | 3300013307 | Corn Rhizosphere | LWEEAENGHNDIHRTNGSSRRQMRDSRSGPHPVRITDSEPITES* |
| Ga0163163_1000348615 | 3300014325 | Switchgrass Rhizosphere | GHNDIHRTNGTSRRQARDSRSAPGPVRITDSDAITET* |
| Ga0157380_111204152 | 3300014326 | Switchgrass Rhizosphere | GGHSEIHRTNGASRRQLRDRNAPSPVRISESEPITES* |
| Ga0157380_117099641 | 3300014326 | Switchgrass Rhizosphere | TAGKMIFGRLWEEAENGGHSDIHRTNGASRRQMRDSRSTPAPVRISESEPITES* |
| Ga0157380_131764051 | 3300014326 | Switchgrass Rhizosphere | GKMIFGRLWEEAENGGHSEIHRTNGASRRQARDSRNNPAPVRISESEPITET* |
| Ga0157377_109599101 | 3300014745 | Miscanthus Rhizosphere | FGRLWEEAENGGHSEIHRTNGASRRQARDSRNTPAPVRISESEPITET* |
| Ga0137418_101021643 | 3300015241 | Vadose Zone Soil | MIFGRLWEEAENGVHNGEHRTNGATRRQSRDPRSSPGPVRITDSEAITES* |
| Ga0180071_10809882 | 3300015249 | Soil | AVTSVLQTTAGKMIFGRLWEEPENGNSGEHRINGSVRRQSRSGPLPVRITDSEPITES* |
| Ga0132258_114756601 | 3300015371 | Arabidopsis Rhizosphere | GKMIFGRLWEEAENSGSHNEIHRTNGTSRRQMRDSRSAPGPVRITDTEAITEA* |
| Ga0132258_116226323 | 3300015371 | Arabidopsis Rhizosphere | GKMIFGRLWEEAENSGSHNEIHRTNGTSRRQMRDSRSAPGPVRITDTEAITET* |
| Ga0132255_1055570942 | 3300015374 | Arabidopsis Rhizosphere | LWEEAENSGSHNEIHRTNGTSRRQMRDSRSAPGPVRITDTEAITET* |
| Ga0184623_103251392 | 3300018056 | Groundwater Sediment | GKMIFGRLWEEAENGNGEHRTNGATRRPQRDPRGTPVPVRVTDSEPVLE |
| Ga0184639_104131671 | 3300018082 | Groundwater Sediment | GKMIFGRVWEDAENGNGEYRTNGAARRPQRDSRSTPGPIRITDSEPMIE |
| Ga0190265_115255431 | 3300018422 | Soil | SDIHRTNGASRRQLRDSRSGPAPVRISESEPITES |
| Ga0190265_115312111 | 3300018422 | Soil | RLWEEAENGGHSDIHRTNGASRRQLRDSRSGPAPVRISESEPITES |
| Ga0190273_118096661 | 3300018920 | Soil | KMIFGRLWEDPENSVSGEHRANGAARRPARDVRATPVRIIDGEPITES |
| Ga0190264_107647882 | 3300019377 | Soil | RLWEEAENGGHSDIHRTNGASRRQMRDSRSTPAPVRISEGEPVTES |
| Ga0210377_101967673 | 3300021090 | Groundwater Sediment | GKMIFGRLWEEPENGSPGGENRTNGSARRQSRDSRSGPLPVRITDTEPITEL |
| Ga0182009_100009961 | 3300021445 | Soil | MIFGRLWEEAENGGHSDIHRTNGTSRRGARDPRNSPAPVRIAESEPVTES |
| Ga0247693_10694862 | 3300024181 | Soil | ENGHNDIHRTNGGTRRQMRESRSGPHPVRIADSEPVTES |
| Ga0207680_103427802 | 3300025903 | Switchgrass Rhizosphere | WEEAENGGHNEIHRTNGSSRRQTRDSRTAPGPVRITDTEAITET |
| Ga0207671_110226681 | 3300025914 | Corn Rhizosphere | SDIHRTNGASRRQARESRNTPAPVRISESEPITET |
| Ga0207663_110992432 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | IFGRLWEEAENSGSHNEIHRTNGTSRRQMRESRTAPGPVRITETEAITET |
| Ga0207660_106860471 | 3300025917 | Corn Rhizosphere | TAGKMIFGRLWEEAENGGHNEIHRTNGSSRRQTRDSRTAPGPVRITDTEAITET |
| Ga0207681_111746372 | 3300025923 | Switchgrass Rhizosphere | EAENGGHSEIHRTNGASRRQLRDRNAPAPVRISESEPITES |
| Ga0207650_104884511 | 3300025925 | Switchgrass Rhizosphere | GRLWEEAENGGHSDIHRTNGASRRQARDSRNSPAPVRIADSEPVTES |
| Ga0207687_101035024 | 3300025927 | Miscanthus Rhizosphere | IFGRLWEEAENGGHNEIHRTNGSSRRQTRDSRTAPGPVRITDTEAITET |
| Ga0207691_107701012 | 3300025940 | Miscanthus Rhizosphere | MIFGRLWEESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES |
| Ga0207689_106458611 | 3300025942 | Miscanthus Rhizosphere | GGHSEIHRTNGASRRQLRDSRSGPAPVRISESEPVTES |
| Ga0207689_109570011 | 3300025942 | Miscanthus Rhizosphere | TAGKMIFGRLWEEAENGHSEIHRTNGASRRQLRDRNSPAPVRISESEPITES |
| Ga0207689_111589841 | 3300025942 | Miscanthus Rhizosphere | KMIFGRLWEEPENGFSGEHRANGTTRRPSRDARNSGPVRITDGEPITES |
| Ga0207679_112702141 | 3300025945 | Corn Rhizosphere | SDIHRTNGGSRRPARDTRSSAPGPVRINDSEPITET |
| Ga0207712_108347522 | 3300025961 | Switchgrass Rhizosphere | TAGKMIFGRLWEEPENGFSGEHRANGTTRRPSRDARNSGPVRITDGEPITES |
| Ga0207640_111346332 | 3300025981 | Corn Rhizosphere | TTAGKMIFGRLWEEAENGGGHNEIHRTNGSSRRQTRESRTTPGPVRITDSDAITET |
| Ga0207640_112529372 | 3300025981 | Corn Rhizosphere | LWEEAENGHNDIHRTNGGSRRQMRESRSGPHPVRITDSEPITET |
| Ga0207703_104951373 | 3300026035 | Switchgrass Rhizosphere | GHSDIHRTNGASRRQARESRNTPAPVRISESEPITET |
| Ga0207641_101185821 | 3300026088 | Switchgrass Rhizosphere | NGGHSDIHRTNGASRRQARDSRNSPAPVRIADSEPVTES |
| Ga0207676_113409251 | 3300026095 | Switchgrass Rhizosphere | NDIHRTNGGSRRQMRESRSGPHPVRITDSEPVAES |
| Ga0207675_1004863401 | 3300026118 | Switchgrass Rhizosphere | HNEIHRTNGTARRQARDPRSAPGPVRITDSDAITET |
| Ga0207675_1021566192 | 3300026118 | Switchgrass Rhizosphere | EAENGGHSDIHRTNGGSRRMRDSRSGPHPVRINDTEPITES |
| Ga0207675_1024789411 | 3300026118 | Switchgrass Rhizosphere | EAENGGHNDIHRTNGTSRRQARDSRSAPGPVRITDSDAITET |
| Ga0207683_116620081 | 3300026121 | Miscanthus Rhizosphere | QTTAGKMIFGRLWEEPENGFTGEHRVNGATRRPTRDARNSGPVRITDGEPITES |
| Ga0209438_10781731 | 3300026285 | Grasslands Soil | MIFGRLWEEADNGTHNDVHRTNGATRRPTRDTRSAPGPVRITDSEPVTEI |
| Ga0209387_11211711 | 3300027639 | Agricultural Soil | MIFGRLWEDAENGNGEHRTNGSARRQTRDSRSTPGPVRISDSEPVIE |
| Ga0207428_110784591 | 3300027907 | Populus Rhizosphere | GKMIFGRLWEESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES |
| Ga0268266_116603702 | 3300028379 | Switchgrass Rhizosphere | CGHNEIHRTNGGARRPPRDTRAAAGSVRITDSEPITEA |
| Ga0268265_106093851 | 3300028380 | Switchgrass Rhizosphere | MIFGRLWEEAENGNGEHRTNGSARRQTRDTRTTPGPVRISDTEPVID |
| Ga0268265_126761681 | 3300028380 | Switchgrass Rhizosphere | LWEEAENGGHSDIHRTNGGSRRPARDTRSSAPGPVRINDSEPITET |
| Ga0268264_100688971 | 3300028381 | Switchgrass Rhizosphere | RLWEEAENGGHSEIHRTNGASRRQLRGESRNAPAPVRISESEPITES |
| Ga0268264_109206372 | 3300028381 | Switchgrass Rhizosphere | GKMIFGRLWEEAENGGHSDIHRTNGASRRQVRDSRNTPAPVRISEGEPITES |
| Ga0268264_122659822 | 3300028381 | Switchgrass Rhizosphere | MIFGRLWEEAENGGHSEIHRTNGASRRQLRDRNAPSPVRISESEPITES |
| Ga0310888_106813831 | 3300031538 | Soil | LWEESENGGHSDIHRTNGASRRTIRDSRSTPGPVRITDSEPITES |
| Ga0307408_1017540091 | 3300031548 | Rhizosphere | RLWEEAENGGHSEIHRTNGASRRQLRDSRSGPAPVRISESEPVTES |
| Ga0310813_102984931 | 3300031716 | Soil | EAENGGHSDIHRTNGASRRQARESRNTPAPVRISESEPIIES |
| Ga0310892_109201532 | 3300031858 | Soil | NDIHRTNGGSRRQMRDSRSGPHPVRITDSEPITES |
| Ga0307412_103427123 | 3300031911 | Rhizosphere | TAGKMIFGRLWEEAENGGHSEIHRTNGASRRQLRDSRSGPAPVRISESEPVTES |
| Ga0307409_1012964611 | 3300031995 | Rhizosphere | EEAENGGHSDIHRTNGASRRQGRDSRNAPGPVRISDSEPVTES |
| Ga0310810_112693311 | 3300033412 | Soil | QTTAGKMIFGRLWEDAENGGHSDIHRTNGASRRQSRDSRNTPAPVRIAESEPVTES |
| ⦗Top⦘ |