| Basic Information | |
|---|---|
| Family ID | F045969 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LEHEGIGPVYVAPRPDSRPHGAVQRAYAVLREASSYLLWKLGMT |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.47 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.395 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.474 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.658 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.632 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.56% β-sheet: 0.00% Coil/Unstructured: 69.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF12867 | DinB_2 | 41.45 |
| PF02735 | Ku | 3.95 |
| PF03992 | ABM | 1.97 |
| PF00903 | Glyoxalase | 1.97 |
| PF02075 | RuvC | 1.32 |
| PF00069 | Pkinase | 0.66 |
| PF04551 | GcpE | 0.66 |
| PF02978 | SRP_SPB | 0.66 |
| PF00583 | Acetyltransf_1 | 0.66 |
| PF01293 | PEPCK_ATP | 0.66 |
| PF03683 | UPF0175 | 0.66 |
| PF13673 | Acetyltransf_10 | 0.66 |
| PF13519 | VWA_2 | 0.66 |
| PF14067 | LssY_C | 0.66 |
| PF16762 | RHH_6 | 0.66 |
| PF13787 | HXXEE | 0.66 |
| PF01381 | HTH_3 | 0.66 |
| PF00551 | Formyl_trans_N | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 3.95 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.63 |
| COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 1.32 |
| COG0541 | Signal recognition particle GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.66 |
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 0.66 |
| COG1866 | Phosphoenolpyruvate carboxykinase, ATP-dependent | Energy production and conversion [C] | 0.66 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.39 % |
| Unclassified | root | N/A | 4.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001087|JGI12677J13195_1012795 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300001593|JGI12635J15846_10624578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10263206 | Not Available | 701 | Open in IMG/M |
| 3300004152|Ga0062386_100129111 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300005186|Ga0066676_10582490 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005434|Ga0070709_10027616 | All Organisms → cellular organisms → Bacteria | 3376 | Open in IMG/M |
| 3300005537|Ga0070730_10293519 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300005554|Ga0066661_10607446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300005602|Ga0070762_10059817 | All Organisms → cellular organisms → Bacteria | 2120 | Open in IMG/M |
| 3300005764|Ga0066903_100277825 | All Organisms → cellular organisms → Bacteria | 2622 | Open in IMG/M |
| 3300005876|Ga0075300_1059013 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300005921|Ga0070766_10285800 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300005993|Ga0080027_10172721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300006028|Ga0070717_10171199 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300006050|Ga0075028_100274656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300006052|Ga0075029_100044512 | All Organisms → cellular organisms → Bacteria | 2556 | Open in IMG/M |
| 3300006052|Ga0075029_100506351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300006052|Ga0075029_100517986 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300006052|Ga0075029_101272866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300006059|Ga0075017_101369190 | Not Available | 556 | Open in IMG/M |
| 3300006086|Ga0075019_10144324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 1389 | Open in IMG/M |
| 3300006173|Ga0070716_100190694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1354 | Open in IMG/M |
| 3300006854|Ga0075425_100645766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 1216 | Open in IMG/M |
| 3300009521|Ga0116222_1357320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 634 | Open in IMG/M |
| 3300009623|Ga0116133_1141672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300009665|Ga0116135_1048645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1471 | Open in IMG/M |
| 3300009665|Ga0116135_1144473 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300009683|Ga0116224_10588696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300009787|Ga0116226_11796696 | Not Available | 560 | Open in IMG/M |
| 3300009792|Ga0126374_11502919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 553 | Open in IMG/M |
| 3300010048|Ga0126373_10763530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
| 3300010303|Ga0134082_10567411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300010343|Ga0074044_10272878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
| 3300010366|Ga0126379_13157716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300011120|Ga0150983_10517210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300011120|Ga0150983_11940799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1205 | Open in IMG/M |
| 3300012350|Ga0137372_10220408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1506 | Open in IMG/M |
| 3300012354|Ga0137366_10144773 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300012354|Ga0137366_10156814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1711 | Open in IMG/M |
| 3300012357|Ga0137384_10105858 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
| 3300012683|Ga0137398_11159836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300012971|Ga0126369_10099830 | All Organisms → cellular organisms → Bacteria | 2624 | Open in IMG/M |
| 3300013100|Ga0157373_10931004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 646 | Open in IMG/M |
| 3300015195|Ga0167658_1057208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300016357|Ga0182032_10509092 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300016422|Ga0182039_11624240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 590 | Open in IMG/M |
| 3300016750|Ga0181505_10930025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300017927|Ga0187824_10152064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300017931|Ga0187877_1354257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300017942|Ga0187808_10556541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300017961|Ga0187778_10407017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300017972|Ga0187781_10204388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1394 | Open in IMG/M |
| 3300017975|Ga0187782_10834246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300017975|Ga0187782_10923881 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300017995|Ga0187816_10577400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300018006|Ga0187804_10292286 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300018020|Ga0187861_10273907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300018025|Ga0187885_10405282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300018034|Ga0187863_10081626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1819 | Open in IMG/M |
| 3300018035|Ga0187875_10373213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300018037|Ga0187883_10381308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300018043|Ga0187887_10292716 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300018044|Ga0187890_10037635 | All Organisms → cellular organisms → Bacteria | 2919 | Open in IMG/M |
| 3300018046|Ga0187851_10559675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300018085|Ga0187772_10072219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2171 | Open in IMG/M |
| 3300018085|Ga0187772_10281067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300018085|Ga0187772_10447631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
| 3300018086|Ga0187769_10281943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300018086|Ga0187769_11283992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300018088|Ga0187771_11416623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300018088|Ga0187771_11694063 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300018090|Ga0187770_11300431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300019270|Ga0181512_1559213 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300019278|Ga0187800_1136630 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300019278|Ga0187800_1571325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300019284|Ga0187797_1496111 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300019284|Ga0187797_1683357 | Not Available | 833 | Open in IMG/M |
| 3300019786|Ga0182025_1008860 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300020580|Ga0210403_10585131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300020581|Ga0210399_10832251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300020581|Ga0210399_11524475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 518 | Open in IMG/M |
| 3300020582|Ga0210395_10009313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7359 | Open in IMG/M |
| 3300021181|Ga0210388_10984987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300021401|Ga0210393_11441079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300021402|Ga0210385_10309382 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300021402|Ga0210385_10616694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella | 828 | Open in IMG/M |
| 3300021406|Ga0210386_11549085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300021420|Ga0210394_11494506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 571 | Open in IMG/M |
| 3300021433|Ga0210391_10617298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300021478|Ga0210402_10325204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300021478|Ga0210402_10788794 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300021478|Ga0210402_11087739 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300021478|Ga0210402_11653565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300021479|Ga0210410_11305338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300022507|Ga0222729_1025952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300022515|Ga0224546_1016420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300022532|Ga0242655_10091110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300022533|Ga0242662_10004167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2486 | Open in IMG/M |
| 3300022557|Ga0212123_10768678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300022712|Ga0242653_1037603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300022733|Ga0224562_1018374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300022873|Ga0224550_1025492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300025500|Ga0208686_1079716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300025612|Ga0208691_1161864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300025905|Ga0207685_10576662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300025929|Ga0207664_11333443 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300027648|Ga0209420_1015241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2589 | Open in IMG/M |
| 3300027652|Ga0209007_1023010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1606 | Open in IMG/M |
| 3300027825|Ga0209039_10036538 | All Organisms → cellular organisms → Bacteria | 2320 | Open in IMG/M |
| 3300027842|Ga0209580_10649198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 522 | Open in IMG/M |
| 3300027869|Ga0209579_10205975 | Not Available | 1054 | Open in IMG/M |
| 3300027889|Ga0209380_10187283 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300027895|Ga0209624_10343490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300028037|Ga0265349_1009820 | Not Available | 834 | Open in IMG/M |
| 3300028746|Ga0302233_10037853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2021 | Open in IMG/M |
| 3300028766|Ga0302269_1234118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300028789|Ga0302232_10006419 | All Organisms → cellular organisms → Bacteria | 7449 | Open in IMG/M |
| 3300028792|Ga0307504_10192667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300029903|Ga0247271_114323 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300029907|Ga0311329_10637346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300029920|Ga0302142_1116471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300029945|Ga0311330_10251171 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300030051|Ga0302195_10137262 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300030058|Ga0302179_10404248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300030743|Ga0265461_13083160 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300030760|Ga0265762_1022819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
| 3300030874|Ga0265742_1005561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300030879|Ga0265765_1023328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300031010|Ga0265771_1022242 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031236|Ga0302324_100571770 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300031469|Ga0170819_10867514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300031708|Ga0310686_113279285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300031708|Ga0310686_117791644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300031715|Ga0307476_10428247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300031754|Ga0307475_10026854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4125 | Open in IMG/M |
| 3300031754|Ga0307475_11293678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300031823|Ga0307478_10015742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5272 | Open in IMG/M |
| 3300031962|Ga0307479_11770068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 570 | Open in IMG/M |
| 3300032041|Ga0318549_10524676 | Not Available | 532 | Open in IMG/M |
| 3300032160|Ga0311301_12414983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300032205|Ga0307472_101670640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300032828|Ga0335080_11528491 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300032893|Ga0335069_11168934 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300032896|Ga0335075_11648896 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300032896|Ga0335075_11670139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300032954|Ga0335083_10198660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1838 | Open in IMG/M |
| 3300032954|Ga0335083_11144750 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300032955|Ga0335076_11168641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300033134|Ga0335073_10589610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
| 3300033158|Ga0335077_12211123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 505 | Open in IMG/M |
| 3300034163|Ga0370515_0231627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300034163|Ga0370515_0301638 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.47% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.26% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.95% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.29% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.63% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.63% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.97% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.32% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.32% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.32% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.66% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.66% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.66% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.66% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.66% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001087 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028766 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029920 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030874 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12677J13195_10127952 | 3300001087 | Forest Soil | KQLLEHEGISPVYVAPRPDSRPRSALQRIYAVLRESCSYLVWKFGMM* |
| JGI12635J15846_106245782 | 3300001593 | Forest Soil | DAYHVFRIKRLLQHQDIGPVYVAPRPGSRPHSVVQRTYAVLREACSYLLWKLGMT* |
| JGIcombinedJ51221_102632061 | 3300003505 | Forest Soil | KKLLENEGVAPVYLAPRPDSLPRGAVQRAYAVFREACSYLVWKLGFS* |
| Ga0062386_1001291114 | 3300004152 | Bog Forest Soil | IGPVYVAPRPDSRPHSVWQRTVAMFRESASYLLWRAGIT* |
| Ga0066676_105824903 | 3300005186 | Soil | IRKLLEYEGIAPVYTAPRLDTRPHSILQRAQSALRESISYLLWRVGIT* |
| Ga0070709_100276165 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VFRIRKLLEYEGIAPVYVAPRPDSRPRSTWLREVAVLREATSYLLWRVGIT* |
| Ga0070730_102935191 | 3300005537 | Surface Soil | YHVFRIRKLLEHEGVGPVYVAPRPGSKPHSVVQRLYAVMREASSYLLWKVGVT* |
| Ga0066661_106074461 | 3300005554 | Soil | VYTAPRPDSRPHGVFQRAFAVLREATSYMLWRIGIT* |
| Ga0070762_100598173 | 3300005602 | Soil | IRKLLEHEGIGPVYVAPRPDSRPRSTLQREMAVLREVASYLLWRVGIR* |
| Ga0066903_1002778251 | 3300005764 | Tropical Forest Soil | VYIAPRPDSRPRSVFQRATALLRETTSYLFWKLGIT* |
| Ga0075300_10590131 | 3300005876 | Rice Paddy Soil | GIGPVYTAPRVDARPHSLLQRAGSALRESVSYLLWRIGIR* |
| Ga0070766_102858001 | 3300005921 | Soil | KRLLEHEGIGPVYVAPRPDSRPRGAGQRVYAVMREAVSYLLWKLGMS* |
| Ga0080027_101727212 | 3300005993 | Prmafrost Soil | SDAYHVFRIRKLLEREGIGPVYVAPRPDSRPHSVTQSAAAVLREATSYMVWKLGFS* |
| Ga0070717_101711991 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | YHVFRIKRLLQHQGIGPVYVAPRPDSRPHSVIQRAYAVMREASSYLLWKLGMT* |
| Ga0075028_1002746562 | 3300006050 | Watersheds | RIRKLLEREGVGPVYVAPRPDSKPHSVWQRAVAVLREATSYLFWRVGIN* |
| Ga0075029_1000445121 | 3300006052 | Watersheds | VGPVYVAPRADSRPHTVWLRTVAALREAVSYLLWRVGIR* |
| Ga0075029_1005063512 | 3300006052 | Watersheds | GPVYVAPRPDSRPRGAIQRTLAVLREATSYSLWRLGIT* |
| Ga0075029_1005179863 | 3300006052 | Watersheds | GVNPVYVAPRPDSRPHGAFQRALAVIRETTSYMLWRVGIT* |
| Ga0075029_1012728661 | 3300006052 | Watersheds | RLLEHEGLGPVYVSPRADSRPHGVVQRGYAVVREACSYLVWKLGMT* |
| Ga0075017_1013691902 | 3300006059 | Watersheds | VYTAPRPDSRPRNVFQRMFAVLREATSYMLWQIGIT* |
| Ga0075019_101443244 | 3300006086 | Watersheds | LEHEGIGPVYTAPRPDSRPHTVPQRLLAVLREATSYMLWTIGIT* |
| Ga0070716_1001906945 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KLLEHEGIGPVYTAPRPDSRPHGVFQRAFAVLREATSYLLWRIGIT* |
| Ga0075425_1006457661 | 3300006854 | Populus Rhizosphere | EHEGIGPVYVAPRPDSKPHSVLQRTFAVMREATSYMAWRIGIT* |
| Ga0116222_13573203 | 3300009521 | Peatlands Soil | VYVAPRADSRPHTAWLRTVAALREAVSYLLWRVGIR* |
| Ga0116133_11416722 | 3300009623 | Peatland | AYHVFRIRKLLEHEGISPVYMAPRPDSTPHGFFQRAIASLREATSYLLWRMGVR* |
| Ga0116135_10486454 | 3300009665 | Peatland | RIRKLLEHEGIAPVYVAPRPDSRPHSVWQRAVAVTREASSYLLWRVGIT* |
| Ga0116135_11444731 | 3300009665 | Peatland | GPVYVAPRPDSRPHSAAQRFYAVMREASSYLLWKLGMS* |
| Ga0116224_105886962 | 3300009683 | Peatlands Soil | EHEGIGPVYVAPRPDSRPRGVAQRAYALLREASSYLLWKLGMT* |
| Ga0116226_117966961 | 3300009787 | Host-Associated | HEGIHPVYVSPRPDSRLHSPAQRAYAVLREASSYMVWRLGMS* |
| Ga0126374_115029191 | 3300009792 | Tropical Forest Soil | VAPRPDSRPHSVVQRSLAALREAVSYLLWRVGIT* |
| Ga0126373_107635301 | 3300010048 | Tropical Forest Soil | EGLEVYLSPRPDSRPRSVLQRSIAIAKESASYLLWRAGIRG* |
| Ga0134082_105674112 | 3300010303 | Grasslands Soil | EHEGIGPVYVAPRPDSRPHGLVLRMIAVLREASSYLMWKLEMT* |
| Ga0074044_102728781 | 3300010343 | Bog Forest Soil | LLEHEGLGPVYLAPRPGSRPHSVGQRAYAVLREASSYLIWKLGMP* |
| Ga0126379_131577162 | 3300010366 | Tropical Forest Soil | AVSDAYHVFRIRKLLQHEKIGPVYVAPRADSRPHSVVQRTIAALRESISYSLWLLGLT* |
| Ga0150983_105172102 | 3300011120 | Forest Soil | KRLLEHEGIRPVYEAPRPDSRPHSVGQRVYAVLREACSYLVWKIGMT* |
| Ga0150983_119407991 | 3300011120 | Forest Soil | IRELLEHEGIGPVYVAPRPDSKPHGLSQRMLAVLREAISYMSWRLGITGKST* |
| Ga0137372_102204081 | 3300012350 | Vadose Zone Soil | HEGIAPVYVAPRPDSRPRTTWQREVAVLRESTSYLLWRIGIT* |
| Ga0137366_101447734 | 3300012354 | Vadose Zone Soil | VYVAPRLDSRPRSALQRVMAVLREATSYLLWRVGIT* |
| Ga0137366_101568144 | 3300012354 | Vadose Zone Soil | EGVNPVYIAPRPDSRPHNVFQRVVAVLRETTSYLLWRVGIT* |
| Ga0137384_101058585 | 3300012357 | Vadose Zone Soil | RKLLEHEGIAPVYVAPRPDSRPHSVWQRTVAVLREATSYLLWRVGIR* |
| Ga0137398_111598361 | 3300012683 | Vadose Zone Soil | FRIRKLLEHEGVAPVYVAPRPDSRPRSSWQREVAVLRESTSYLLWRIGIT* |
| Ga0126369_100998301 | 3300012971 | Tropical Forest Soil | VYVAPRADSRPHSVVQRTIAALRESISYSLWLLGLT* |
| Ga0157373_109310042 | 3300013100 | Corn Rhizosphere | VFRIRKLLEYEGIAPVYTAPRLDTRPHSMLQRAQSALRESISYLLWRVGIT* |
| Ga0167658_10572082 | 3300015195 | Glacier Forefield Soil | HEGIGPIYVAPRPDSRPHSIVQRAYAVMREASSYLLWKLGMT* |
| Ga0182032_105090923 | 3300016357 | Soil | RKLLLHEGVGPVYVAPRPDSRPHSMVQRAWAVLRESTSYLLWRLGIT |
| Ga0182039_116242401 | 3300016422 | Soil | SDAYHVFRIRKLLQHEGIGPVYVAPRPDSRPHSAVQRSLAVLREATSYLLWRVGIT |
| Ga0181505_109300251 | 3300016750 | Peatland | RLLEHEGVGPVYVAPRPDSRPHGVGQRLYAVLREASSYLLWKLGAP |
| Ga0187824_101520642 | 3300017927 | Freshwater Sediment | LLEHEGLGPVYIAPRPDSRPHSLIQRSVAILRESTSYLLWQIGIT |
| Ga0187877_13542571 | 3300017931 | Peatland | RIERLLEHEGIGPVYVAPRPDSRPHGVLQRLYAVLREASSYLLWKLGMT |
| Ga0187808_105565411 | 3300017942 | Freshwater Sediment | KLLEHEGMGPVYVAPRADSKPHGWTQRAIAVLREAASYSLWKLGIT |
| Ga0187778_104070171 | 3300017961 | Tropical Peatland | HEGIGPVYVAPRPDSRPRGLMQRAVAILRESASYLLWRLGI |
| Ga0187781_102043881 | 3300017972 | Tropical Peatland | RIRKLLEHEGIGPVYVAPRPDSKPRGIFQRIYAVLREASSYLMWKIGLT |
| Ga0187782_108342462 | 3300017975 | Tropical Peatland | FRIRKLLEHEGIGPVYTAPRSDTRPHSILQRGGAALREATSYLVWRVGIR |
| Ga0187782_109238812 | 3300017975 | Tropical Peatland | LEHEGIGPVYTAPRLDTRPHSILQRAGAALREATSYLVWRIGIR |
| Ga0187816_105774001 | 3300017995 | Freshwater Sediment | RIRRLLEHQGVGPVYVAPRADSRPHGLVQRAVAILREATSYMLWRVGV |
| Ga0187804_102922861 | 3300018006 | Freshwater Sediment | HQGIGPVYTAPRLESRPLSILQRAAAASREAVSYFLWKLGIT |
| Ga0187861_102739072 | 3300018020 | Peatland | LEHEGIGPVYVAPRPDSRPHGALQRLYAVLREASSYLLWKLGMT |
| Ga0187885_104052821 | 3300018025 | Peatland | HVFRIKKLLEHEGIGPVYVSSRPDSRPHSVVQRWYAVMREASSYLLWKLGMS |
| Ga0187863_100816264 | 3300018034 | Peatland | VYVAPRPDSLPHSVWQRAVAVTREASSYLLWRVGIT |
| Ga0187875_103732132 | 3300018035 | Peatland | LLEHEGIGPVYVSSRPDSRPHSVVQRWYAVMREASSYLLWKLGMS |
| Ga0187883_103813081 | 3300018037 | Peatland | AYHVFRIRKLLEHEGIHPVYVSPRPDSRLHSPAQRAYAVLREASSYMVWRLGMS |
| Ga0187887_102927163 | 3300018043 | Peatland | LEHEGISPVYMAPRPDSTPHGFFQRAIASLREATSYLLWRMGVR |
| Ga0187890_100376351 | 3300018044 | Peatland | IDPVYVAPRPDSRPHSSWQRSVAVLREATSYLLWRVGIR |
| Ga0187851_105596752 | 3300018046 | Peatland | YHVFRIRKLLEHEGISPVYMAPRPDSTPHGFFQRAIASLREATSYLLWRMGVR |
| Ga0187772_100722195 | 3300018085 | Tropical Peatland | YHVFRIRKLLEHEGIGPVYTAPRLDTRPHSILQRAGAALREATSYLLWRIGIR |
| Ga0187772_102810671 | 3300018085 | Tropical Peatland | PVYVAPRPDSRPHTLTQRAIAVLREATSYSLWKLGIT |
| Ga0187772_104476311 | 3300018085 | Tropical Peatland | HVFRIRRLLEHEGIGPVYVAPRPDSRPHGIVLRIVAVLRETASYFLWKLGMT |
| Ga0187769_102819431 | 3300018086 | Tropical Peatland | EHEGIGPVYVAPRPDSRPHGAVQRGYAVLREASSYLLWKLGMS |
| Ga0187769_112839922 | 3300018086 | Tropical Peatland | LLEHEGIGPVYVAPRLDSRPHGMIQRAIAVLREAVSYSLWKLGIT |
| Ga0187771_114166231 | 3300018088 | Tropical Peatland | HVFRIKRLLEHEGVSPVYVAPRPDSRPHTASLRALAVLREAASYLLWRLHIT |
| Ga0187771_116940632 | 3300018088 | Tropical Peatland | RIRKLLEHEGIGPVYVAPRADSRPHGIISRAIAVLREATSYLLWRVGI |
| Ga0187770_113004312 | 3300018090 | Tropical Peatland | IGPVYVAPRPDSRPHSNVQRMVAVLRETASYFLWKLGMS |
| Ga0181512_15592133 | 3300019270 | Peatland | PVYVAPRPDSLPHSVWQRAVAVTREASSYLLWRVGIT |
| Ga0187800_11366303 | 3300019278 | Peatland | HVFRIRKLLEHEGVGPVYVAPRPDSRPRGIVQRATAVLREATSYWLWRIGIT |
| Ga0187800_15713252 | 3300019278 | Peatland | HLFRIKRLLEHEGIGPVYVSPRPDSRPHSVVQRMYALLREACSYLVWKLGGN |
| Ga0187797_14961111 | 3300019284 | Peatland | VFRIRKLLEHEGIGPVYISPRPDSRPHGAAPRAIAILREATSYLLWKMGIP |
| Ga0187797_16833571 | 3300019284 | Peatland | LAPRPDSRPHALHQRLDAVLREAFSYMLWRLHVTA |
| Ga0182025_10088603 | 3300019786 | Permafrost | HVFRIKRLLEHEGIGPVYVAPRPDSRPHSVLQRGYAVLREACSYLVWKLGIG |
| Ga0210403_105851312 | 3300020580 | Soil | ELLEHEGIGPVYVAPRPDSKPHGLSQRMLAVLREAISYMSWRLGIT |
| Ga0210399_108322511 | 3300020581 | Soil | YHVFRIKRLLEHEGVGPVYVAPRPGSRPHSVVQRAYAVMREASSYLLWKLGMT |
| Ga0210399_115244751 | 3300020581 | Soil | IRKLLEHEGVSPVYVAPRPGSKPHSVAQRFYAVMREASSYLLWRVGIT |
| Ga0210395_100093136 | 3300020582 | Soil | RLLEHEGIGPVYVAPRPDSRPRGAGQRVYAVMREATSYLLWKLGMT |
| Ga0210388_109849871 | 3300021181 | Soil | LEHEGIGPVYVAPRPDSKPHGLSQRMLAVLREAISYMSWRLGITGKST |
| Ga0210393_114410791 | 3300021401 | Soil | EGIGPVYVAPRPDSRPRSILPRAYAVLREACSYLLWKLGAS |
| Ga0210385_103093821 | 3300021402 | Soil | IGPVYVAPRPDSRPHGAVQRAIAITREAASYLLWEIE |
| Ga0210385_106166941 | 3300021402 | Soil | HEGIGPVYVAPRPDSRPRGAGQRVYAVMREATSYLLWKLGMT |
| Ga0210386_115490851 | 3300021406 | Soil | FRIRKLLEHEGIRPVYVSPRPDSKPRGAAQRTLAVLREATSYLLWRMGAS |
| Ga0210394_114945061 | 3300021420 | Soil | LFEYEGIAPVYVAPRPDSRPHGVLQRAVAVLREATSYCLWRIGIT |
| Ga0210391_106172982 | 3300021433 | Soil | YHVFRIKKVLEHEGVGPVYVAPRPDSRPHSVAQRAYAILREASSYLVWKLGMT |
| Ga0210402_103252043 | 3300021478 | Soil | RIRKLLEHEGIGPVYVSPRPDSRPHGTGQRMFAVLREASSYLLWRVGIT |
| Ga0210402_107887943 | 3300021478 | Soil | IYVAPRPDSKPRSAMQRAIAVLRETTSYWLWRVGIN |
| Ga0210402_110877391 | 3300021478 | Soil | KLLEHEGIGPVYTAPRPDSRPHGVAQRTLAVLRESSSYLLWELGMT |
| Ga0210402_116535652 | 3300021478 | Soil | KLLEREGVGPIYVAPRPDSKPHSVLQRAIAVLREATSYLLWRMGIN |
| Ga0210410_113053382 | 3300021479 | Soil | KLLEREGVGPIYVAPRPDSKPHSALQRAIAVLREATSYLLWRVGIN |
| Ga0222729_10259522 | 3300022507 | Soil | VYVAPRPDSRPHTMWQRSVAVLREASSYLLWRVGIK |
| Ga0224546_10164202 | 3300022515 | Soil | LEHEGIGPVYVSPRPDSRQHSVGQRAYAVLREASSYLLWKLGMS |
| Ga0242655_100911101 | 3300022532 | Soil | FRIRKLLEHEGIGPVYVAPRPDSRPRSILPRAYAVLREACSYLLWKLGAS |
| Ga0242662_100041671 | 3300022533 | Soil | VYVAPRPGSRPHSMVQRAYAVMREASSYLLWKLGMS |
| Ga0212123_107686782 | 3300022557 | Iron-Sulfur Acid Spring | YVAPRSESQPHGVLQRTFAVLREATSYLLWRMGIT |
| Ga0242653_10376031 | 3300022712 | Soil | PVYVAPRPDSRPHTMWQRSVAVLREASSYLLWRVGIR |
| Ga0224562_10183742 | 3300022733 | Soil | AYHMFRIKKLLEHEGIGPVYVSPRPESRPHSVVQRAYAVLREACSYLLWKLGMT |
| Ga0224550_10254921 | 3300022873 | Soil | RKLLEHEGVGPVYVAPRPDSRPHSVVQRMYAVLREASSYLLWKIGVI |
| Ga0208686_10797162 | 3300025500 | Peatland | HEGIGPVYVAPRPDSRPHGALQRLYAVLREASSYLLWKLGMT |
| Ga0208691_11618642 | 3300025612 | Peatland | GPVYVAPRPDSRPHSAAQRFYAVMREASSYLLWKLGMS |
| Ga0207685_105766621 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SDAYHVFRIKRLLQHQGIGPVYVAPRPGSRPHSAGQRLYAVLREACSYLLWELGLT |
| Ga0207664_113334431 | 3300025929 | Agricultural Soil | HVFRIRKLLEYEGIAPVYTAPRLDTRPHSILQRAQSALRESISYLLWRVGIT |
| Ga0209420_10152415 | 3300027648 | Forest Soil | DSYHVFRIKRLLQREGVGPVYVAPRSDSRPHGALQRFYAVTREVCSYLAWKLGMT |
| Ga0209007_10230103 | 3300027652 | Forest Soil | IGPVYVAPRPDSRPHSAGQRMYAVMREASSYLLWKLGMS |
| Ga0209039_100365383 | 3300027825 | Bog Forest Soil | HVFRIRKLLEHEGIATVYVAPRPDSRPHGLLQRAVAILRESTSYLLWRVGIT |
| Ga0209580_106491982 | 3300027842 | Surface Soil | QHERVGPVYVAPRPDSRPHDFVQRSVAVLRESSSYMLWLLGIT |
| Ga0209579_102059753 | 3300027869 | Surface Soil | VGPVYTAPRLESRPHSILQRAEAALREAASYLLWKIGIT |
| Ga0209380_101872833 | 3300027889 | Soil | IKKLLEHEGISPVYVALRPDSRPHSALQRIYAVLRESCSYLVWKFGMM |
| Ga0209624_103434902 | 3300027895 | Forest Soil | IKKLLEHEGISPIYVSPRPDSRPHSVAQRSYAVLREACSYLLWKIGVT |
| Ga0265349_10098201 | 3300028037 | Soil | YVAPRPDSRPHGALQRVYAVMREACSYLVWKLGMT |
| Ga0302233_100378531 | 3300028746 | Palsa | FRIKKLLEHEGVGPVYVAPRPDSRPHSVAQRAYAVLREASSYLVWKLGMT |
| Ga0302269_12341181 | 3300028766 | Bog | LEHEGIGPVYVAPRPDSRPHSVVQRAYAILREASSYLLWKLGMT |
| Ga0302232_1000641911 | 3300028789 | Palsa | HEGIGPVYVAPRPDSRPHSVAQRAYAVLREACSYLVWKFGMT |
| Ga0307504_101926671 | 3300028792 | Soil | VGPVYTAPRPDSRPHSFLQRTLAVLREATSYLLWRIGIT |
| Ga0247271_1143232 | 3300029903 | Soil | HVFRIRKLLEHEGIHPVYVSPRPDSRLHSPAQRAYAVLREASSYMVWRLGMS |
| Ga0311329_106373462 | 3300029907 | Bog | IRRLLEHEGLSPVYVAPRPDSRPRGAAQRTYAVLREACSYLLWKLGMS |
| Ga0302142_11164711 | 3300029920 | Bog | VFRIKRLLEHEGIGPVYVAPRPDSRPHSVVQRAYAILREASSYLLWKLGMT |
| Ga0311330_102511711 | 3300029945 | Bog | FRIKKLLEHEGIGPVYVSSRPDSRPHSVVQRLYAVMREASSYLLWKLGMS |
| Ga0302195_101372621 | 3300030051 | Bog | AYHVFRIKKLLEHEGIGPVYVSSRPDSRPHSVVQRLYAVMREASSYLLWKLGMS |
| Ga0302179_104042482 | 3300030058 | Palsa | AYHVFRIKKLLEHEGIGPVYVSPRPDSRPHSVAQRAFAVLREASSYLLWKLGAT |
| Ga0265461_130831602 | 3300030743 | Soil | AYHVFRIKKLLEHEGISPVYVAPRPDSRPHSALQRIYAVLRESCSYLVWKFGMM |
| Ga0265762_10228193 | 3300030760 | Soil | FRIRELLEHEGIGPVYVAPRPDSKPHGQGQRLIAVLREAASYLSWRVGMP |
| Ga0265742_10055612 | 3300030874 | Soil | AYHVFRIRELLEHEAIGPVYVAPRPDSKPHGLSQRMLAVLREAISYMSWRLGIT |
| Ga0265765_10233281 | 3300030879 | Soil | KLLEHEGIAPVYVAPRPDSRPHGALQRVYAVMREACSYLVWKLGMT |
| Ga0265771_10222422 | 3300031010 | Soil | PVYVAPRPDSRPHGALQRAYAVMREACSYLVWKLGMT |
| Ga0302324_1005717701 | 3300031236 | Palsa | LLEHEGLSPVYVAPRPDSRPRGAAQRTYAVLREACSYLLWKLGMS |
| Ga0170819_108675141 | 3300031469 | Forest Soil | PVYVAPRPDSRPHSVWQRTVAVLREATSYLLWRVGIR |
| Ga0310686_1132792852 | 3300031708 | Soil | YHVFRIKRLLEHQGIGPVYVSPRPDSRPHSLTQRIYAVLREACSYFLWKIGVT |
| Ga0310686_1177916441 | 3300031708 | Soil | DAYHVFRIRELLEHEGIGPVYVAPRPDSKPHGQGQRLIAVLREAASYLSWRVGMP |
| Ga0307476_104282472 | 3300031715 | Hardwood Forest Soil | LEHEGIGPVYVAPRPDSRPHGAVQRAYAVLREASSYLLWKLGMT |
| Ga0307475_100268541 | 3300031754 | Hardwood Forest Soil | VYVAPRPDSRPHGAVQRAYAVLREASSYLLWKLGMT |
| Ga0307475_112936781 | 3300031754 | Hardwood Forest Soil | KRLLQHEGVGPVYVSPRPGSRPHNVAQRTYAVLREAFSYLAWKLNLT |
| Ga0307478_100157421 | 3300031823 | Hardwood Forest Soil | KRLLQHQGIGPVYVAPRPGSRPHSVVQRTYAVLREACSYLLWKIGVM |
| Ga0307479_117700682 | 3300031962 | Hardwood Forest Soil | AYHVFRIRKLLEHEGIGPVYLAPRPDSRPHSVMQRMVAVLREATSYLLWRVGIT |
| Ga0318549_105246762 | 3300032041 | Soil | QGVRVYVAPRPDSRPRTERQRAVAVAREALSYVLWKAGLG |
| Ga0311301_124149831 | 3300032160 | Peatlands Soil | GQGIGPVYVAPRPDSKPHTEMQRAVAVLRESSSYLLWRVGIR |
| Ga0307472_1016706401 | 3300032205 | Hardwood Forest Soil | YHVFRIRKLLEHEGIGPVYPAPRPDSRPHGVFQRAFAVLREATSYLLWRIGIT |
| Ga0335080_115284913 | 3300032828 | Soil | EGIGPVYVAPRSDSRPHTVTQRTIAAFREAFSYLLWSVGIH |
| Ga0335069_111689341 | 3300032893 | Soil | RKLLEKQGVGPVYVAPRPDSVPRSFYGRCEAVMREATSYFLWRLGIH |
| Ga0335075_116488961 | 3300032896 | Soil | EGIGPVYVAPRPDSKPRGIPQRALAVLREASSYLVWKLGVM |
| Ga0335075_116701391 | 3300032896 | Soil | RVLEHEGIGPVYEAPRPDSEPRGSLQRLYAVLREACSYLVWKVGVR |
| Ga0335083_101986601 | 3300032954 | Soil | LLEHENVSPVYLAPRPDSRPRSVAQRMIAVLRESASYFLWRVGIT |
| Ga0335083_111447501 | 3300032954 | Soil | VYIAPRPDSRPHSFVQRSIAVLREATSYSLWKIGIT |
| Ga0335076_111686412 | 3300032955 | Soil | KLLEHEGIGPVFVAPRPGSVPHNVFQRTIAVFREAASYSLWWIGFP |
| Ga0335073_105896101 | 3300033134 | Soil | KLLEHEGIGPVFVAPRPDSVPHNVFQRTIAVFREAASYSLWRIGIRV |
| Ga0335077_122111231 | 3300033158 | Soil | EHEGIGPVYTAPRLDTRPHSILQRVSAALREATSYLLWKIGIT |
| Ga0370515_0231627_621_782 | 3300034163 | Untreated Peat Soil | YHVFRIKKLLEHEGVGPVYVAPRPDSRPHSVAQRAYAVLREASSYLVWKLGMT |
| Ga0370515_0301638_520_675 | 3300034163 | Untreated Peat Soil | VFRIKRLLQREGVGPVYVAPRSDSRPHGALQRFYAVTREVCSYLAWKLGMT |
| ⦗Top⦘ |