NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045954

Metagenome / Metatranscriptome Family F045954

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045954
Family Type Metagenome / Metatranscriptome
Number of Sequences 152
Average Sequence Length 42 residues
Representative Sequence VRSGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL
Number of Associated Samples 111
Number of Associated Scaffolds 152

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.17 %
% of genes near scaffold ends (potentially truncated) 85.53 %
% of genes from short scaffolds (< 2000 bps) 88.82 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.868 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(34.868 % of family members)
Environment Ontology (ENVO) Unclassified
(48.684 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.289 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.53%    β-sheet: 20.59%    Coil/Unstructured: 55.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 152 Family Scaffolds
PF04392ABC_sub_bind 2.63
PF08281Sigma70_r4_2 1.32
PF00536SAM_1 1.32
PF02518HATPase_c 1.32
PF104171-cysPrx_C 0.66
PF12833HTH_18 0.66
PF00565SNase 0.66
PF00126HTH_1 0.66
PF01545Cation_efflux 0.66
PF13505OMP_b-brl 0.66
PF10108DNA_pol_B_exo2 0.66
PF05988DUF899 0.66
PF00580UvrD-helicase 0.66
PF00230MIP 0.66
PF06078DUF937 0.66
PF00665rve 0.66
PF00596Aldolase_II 0.66
PF00805Pentapeptide 0.66
PF13589HATPase_c_3 0.66
PF04542Sigma70_r2 0.66
PF08239SH3_3 0.66
PF13356Arm-DNA-bind_3 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 152 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.63
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.66
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.66
COG4584TransposaseMobilome: prophages, transposons [X] 0.66
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.66
COG3973DNA helicase IVReplication, recombination and repair [L] 0.66
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.66
COG3753Uncharacterized conserved protein YidB, DUF937 familyFunction unknown [S] 0.66
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.66
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.66
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.66
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.66
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 0.66
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.66
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.66
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.66
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.66
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.66
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.87 %
UnclassifiedrootN/A15.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459018|G1P06HT01DEGTBAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300000956|JGI10216J12902_100203904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium808Open in IMG/M
3300000956|JGI10216J12902_100786624All Organisms → cellular organisms → Bacteria1271Open in IMG/M
3300000956|JGI10216J12902_117063987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales770Open in IMG/M
3300004463|Ga0063356_103166273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium709Open in IMG/M
3300005187|Ga0066675_10518068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium892Open in IMG/M
3300005332|Ga0066388_106407593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium593Open in IMG/M
3300005332|Ga0066388_107194071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300005332|Ga0066388_108815626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300005363|Ga0008090_14512281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium736Open in IMG/M
3300005406|Ga0070703_10426455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300005439|Ga0070711_100050387All Organisms → cellular organisms → Bacteria2855Open in IMG/M
3300005454|Ga0066687_10208883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1070Open in IMG/M
3300005471|Ga0070698_100715887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium943Open in IMG/M
3300005518|Ga0070699_100190694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1821Open in IMG/M
3300005713|Ga0066905_100262494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1334Open in IMG/M
3300005713|Ga0066905_101093813All Organisms → cellular organisms → Bacteria → Proteobacteria707Open in IMG/M
3300005713|Ga0066905_101953747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300005764|Ga0066903_101567116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1247Open in IMG/M
3300005764|Ga0066903_101702891All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300005764|Ga0066903_102869801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium935Open in IMG/M
3300005764|Ga0066903_106121152All Organisms → cellular organisms → Bacteria → Proteobacteria629Open in IMG/M
3300005764|Ga0066903_107628405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300005764|Ga0066903_107823107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300005764|Ga0066903_108025570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300005764|Ga0066903_108947651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium507Open in IMG/M
3300006051|Ga0075364_10976530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300006173|Ga0070716_100713302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium767Open in IMG/M
3300006797|Ga0066659_10979094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium707Open in IMG/M
3300006904|Ga0075424_100765323Not Available1030Open in IMG/M
3300009100|Ga0075418_12742774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria538Open in IMG/M
3300010043|Ga0126380_10675792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium826Open in IMG/M
3300010047|Ga0126382_10499100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium978Open in IMG/M
3300010047|Ga0126382_10660049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium871Open in IMG/M
3300010358|Ga0126370_10558822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium979Open in IMG/M
3300010358|Ga0126370_10804706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium838Open in IMG/M
3300010358|Ga0126370_12295581Not Available534Open in IMG/M
3300010359|Ga0126376_11380140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium728Open in IMG/M
3300010360|Ga0126372_10621045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1041Open in IMG/M
3300010361|Ga0126378_10769693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1073Open in IMG/M
3300010362|Ga0126377_13516127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium507Open in IMG/M
3300010366|Ga0126379_10385576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1444Open in IMG/M
3300010366|Ga0126379_13257254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300010366|Ga0126379_13603168Not Available519Open in IMG/M
3300010376|Ga0126381_100845419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1316Open in IMG/M
3300010396|Ga0134126_11196771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria844Open in IMG/M
3300010398|Ga0126383_12019897All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300010398|Ga0126383_12622934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium587Open in IMG/M
3300012199|Ga0137383_10310513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1155Open in IMG/M
3300012202|Ga0137363_10566809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium957Open in IMG/M
3300012205|Ga0137362_10688604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga879Open in IMG/M
3300012209|Ga0137379_10837638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium824Open in IMG/M
3300012582|Ga0137358_10593521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium743Open in IMG/M
3300012914|Ga0157297_10004356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2762Open in IMG/M
3300012948|Ga0126375_10036975Not Available2485Open in IMG/M
3300012948|Ga0126375_11681931Not Available550Open in IMG/M
3300012951|Ga0164300_10441772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium727Open in IMG/M
3300012988|Ga0164306_10592402All Organisms → cellular organisms → Bacteria → Acidobacteria867Open in IMG/M
3300012989|Ga0164305_11660281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium572Open in IMG/M
3300012989|Ga0164305_11700497Not Available566Open in IMG/M
3300015245|Ga0137409_11058404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium650Open in IMG/M
3300015373|Ga0132257_103362427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300016270|Ga0182036_10714781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium811Open in IMG/M
3300016294|Ga0182041_11224277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium685Open in IMG/M
3300016319|Ga0182033_10171320All Organisms → cellular organisms → Bacteria1698Open in IMG/M
3300016319|Ga0182033_10230135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1494Open in IMG/M
3300016319|Ga0182033_10438232All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300016319|Ga0182033_11175696Not Available687Open in IMG/M
3300016319|Ga0182033_11992655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300016341|Ga0182035_10213415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1535Open in IMG/M
3300016341|Ga0182035_11735562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium564Open in IMG/M
3300016357|Ga0182032_11531120All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300016404|Ga0182037_10464317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1055Open in IMG/M
3300016404|Ga0182037_11581282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300016422|Ga0182039_11873588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium550Open in IMG/M
3300016445|Ga0182038_10459528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1079Open in IMG/M
3300016445|Ga0182038_11876362Not Available541Open in IMG/M
3300016445|Ga0182038_11880129All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300021168|Ga0210406_10724070Not Available764Open in IMG/M
3300021170|Ga0210400_11311978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300021178|Ga0210408_11122613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300021404|Ga0210389_11324972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria551Open in IMG/M
3300025916|Ga0207663_11652871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300025928|Ga0207700_10803261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium841Open in IMG/M
3300025939|Ga0207665_10061354All Organisms → cellular organisms → Bacteria → Proteobacteria2548Open in IMG/M
3300026277|Ga0209350_1085939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium825Open in IMG/M
3300026524|Ga0209690_1224394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300027874|Ga0209465_10546009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium577Open in IMG/M
3300027875|Ga0209283_10890564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300029636|Ga0222749_10739718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria538Open in IMG/M
3300031226|Ga0307497_10341693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium699Open in IMG/M
3300031545|Ga0318541_10728616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300031546|Ga0318538_10256666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium939Open in IMG/M
3300031561|Ga0318528_10052158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2071Open in IMG/M
3300031561|Ga0318528_10066084All Organisms → cellular organisms → Bacteria1855Open in IMG/M
3300031573|Ga0310915_10460906All Organisms → cellular organisms → Bacteria → Proteobacteria903Open in IMG/M
3300031640|Ga0318555_10762190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria522Open in IMG/M
3300031679|Ga0318561_10198793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1087Open in IMG/M
3300031680|Ga0318574_10280065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria967Open in IMG/M
3300031680|Ga0318574_10431316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium771Open in IMG/M
3300031681|Ga0318572_10818511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300031719|Ga0306917_10232441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1407Open in IMG/M
3300031724|Ga0318500_10446290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium647Open in IMG/M
3300031744|Ga0306918_11256646Not Available570Open in IMG/M
3300031748|Ga0318492_10444670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium684Open in IMG/M
3300031748|Ga0318492_10572582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium602Open in IMG/M
3300031764|Ga0318535_10043020All Organisms → cellular organisms → Bacteria → Proteobacteria1862Open in IMG/M
3300031768|Ga0318509_10145086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1307Open in IMG/M
3300031768|Ga0318509_10684835Not Available569Open in IMG/M
3300031770|Ga0318521_10408635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium809Open in IMG/M
3300031771|Ga0318546_10592864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium779Open in IMG/M
3300031780|Ga0318508_1059242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1023Open in IMG/M
3300031796|Ga0318576_10182372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium985Open in IMG/M
3300031797|Ga0318550_10387836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium676Open in IMG/M
3300031799|Ga0318565_10066893All Organisms → cellular organisms → Bacteria → Acidobacteria1691Open in IMG/M
3300031820|Ga0307473_10969918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium619Open in IMG/M
3300031821|Ga0318567_10655845Not Available596Open in IMG/M
3300031833|Ga0310917_10447825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium878Open in IMG/M
3300031845|Ga0318511_10333845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium689Open in IMG/M
3300031879|Ga0306919_10082535Not Available2220Open in IMG/M
3300031880|Ga0318544_10156949All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300031890|Ga0306925_10188888All Organisms → cellular organisms → Bacteria2220Open in IMG/M
3300031910|Ga0306923_10038302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5220Open in IMG/M
3300031910|Ga0306923_10735768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1095Open in IMG/M
3300031912|Ga0306921_11656821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens693Open in IMG/M
3300031941|Ga0310912_10766221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium746Open in IMG/M
3300031942|Ga0310916_11373390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium579Open in IMG/M
3300031945|Ga0310913_10302313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1129Open in IMG/M
3300031945|Ga0310913_10945047Not Available605Open in IMG/M
3300031946|Ga0310910_10663570Not Available825Open in IMG/M
3300031946|Ga0310910_10997644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium654Open in IMG/M
3300031947|Ga0310909_10182454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1738Open in IMG/M
3300031947|Ga0310909_11480533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300031959|Ga0318530_10386938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300031981|Ga0318531_10433363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium595Open in IMG/M
3300032025|Ga0318507_10139951All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300032035|Ga0310911_10728577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300032059|Ga0318533_11373562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300032066|Ga0318514_10033531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2422Open in IMG/M
3300032076|Ga0306924_12430418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300032090|Ga0318518_10676735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300032205|Ga0307472_101831767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria603Open in IMG/M
3300033289|Ga0310914_11422257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium596Open in IMG/M
3300033290|Ga0318519_10620346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium658Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil34.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.11%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil9.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.26%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.32%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.32%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.66%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.66%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.66%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.66%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.66%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459018Litter degradation MG2EngineeredOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
2MG_006780602170459018Switchgrass, Maize And Mischanthus LitterYRVKFRDRNETTAYYTDSLEDAVNTAVEMTRKRAL
JGI10216J12902_10020390433300000956SoilSGDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARKRGQSPC*
JGI10216J12902_10078662453300000956SoilHLGLTLRKVRSGDYRVNFRDGNETTAYYTDDLEDAVNMGLEMVRKRA*
JGI10216J12902_10701577543300000956SoilHLGLTLRKVRSGDYRVSFRDGNETVAYYTDDLEDAVDVGLEMVRKRA*
JGI10216J12902_11706398723300000956SoilCSGDYRVNFRDGNETTDYYTDSLEDAINTAIGMARRRELHHTELET*
Ga0063356_10316627313300004463Arabidopsis Thaliana RhizosphereLRIVRSGAYRVNFRDGNETTAYYTDNLDDAVNTAIEMACKR*
Ga0066675_1051806813300005187SoilLTLRKVRSGDYRVNFRDGNETTRYYTDSLEDAVKTAVEMTRKRAL*
Ga0066388_10640759313300005332Tropical Forest SoilVRSGDYRVNFRDGNETTAYYTDNLEDAANTAVEMARKRAL*
Ga0066388_10719407113300005332Tropical Forest SoilVRSGDYRVNFRDGNETSAYYTDDLEDAVSAAVEMARKRGQSPC*
Ga0066388_10881562623300005332Tropical Forest SoilKVRSGDYRVNFRDGNETTAYYTDSLEDAVNTAVEMARKRAQSPC*
Ga0008090_1451228123300005363Tropical Rainforest SoilVRSGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMVRKRGK*
Ga0070703_1042645513300005406Corn, Switchgrass And Miscanthus RhizosphereLRKVRSGDYRVNFRDGNEPAPYYTDDLENAVNTAVEMARKRGK*
Ga0070711_10005038713300005439Corn, Switchgrass And Miscanthus RhizosphereRKVRSGDYRVNFRDGNEMTAYYTDNLEDTVNTAVEMARKRAL*
Ga0066687_1020888313300005454SoilLRKVRSGDYRVNFRDGNETTRYYTDSLEDAVKTAVEMTRKRAL*
Ga0070698_10071588733300005471Corn, Switchgrass And Miscanthus RhizosphereRSGNYRVNFRDGNETTAYYTDDLEDAVNTTVEMARKRAL*
Ga0070699_10019069453300005518Corn, Switchgrass And Miscanthus RhizosphereCSGDYRVNFRDGNETTAYYTDDLEDAVNTAVEMARKRALRAAPHRLGT*
Ga0066905_10026249433300005713Tropical Forest SoilYRVNFRDGNETTAYYTDNLEDAVNTAVEMTRRRAL*
Ga0066905_10109381323300005713Tropical Forest SoilLRQLHSGNYRVNFRDGNETTAYYTDKFEDAVNAVVAMARKRAL*
Ga0066905_10195374723300005713Tropical Forest SoilTLRKVRSGDYRVNFRDGNEMTPYYTDNLEDAVSTAVEMARKRG*
Ga0066903_10156711613300005764Tropical Forest SoilMVRFGEYRVNFRDGNETTAYYTDNLEDAVNTAVEIARKRAL*
Ga0066903_10170289113300005764Tropical Forest SoilVRSGDYRVNFRDGNETTAYYTDDLEDAVNVGLEMVRKRA*
Ga0066903_10286980113300005764Tropical Forest SoilMGVSGTLRHVRSGDYRVNFRDGSETAAYYTDSLEDAVNAAVDMARKRAL*
Ga0066903_10612115233300005764Tropical Forest SoilYRVNFRDGNEMTAYYTDSLENAVNTAVEMARKCGQSPC*
Ga0066903_10762840513300005764Tropical Forest SoilKVRSGDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARKRGQSPC*
Ga0066903_10782310723300005764Tropical Forest SoilMMQGGKGRTNFRDGNETSAYYTDNLEDAVNTAVEMARRRAL*
Ga0066903_10802557013300005764Tropical Forest SoilGEYRVNFRDGNETTAYYTDNLEDAVKTAIEMARKRAL*
Ga0066903_10894765133300005764Tropical Forest SoilLGFTLRKVRSGDYRVSFRDGNETTAYYTDTLEAAVNTAVGDGP*
Ga0075364_1097653013300006051Populus EndosphereTLRKVRSGDYRVNFRDINEPYYTDNLEDAVTTAVEMARRRAL*
Ga0070716_10071330233300006173Corn, Switchgrass And Miscanthus RhizosphereLGLTLRKVRSGDYRVNFRDGDEMTAYNTDSLEDAVNTAIEMTRKRAL*
Ga0066659_1097909413300006797SoilLGLTLRKVRSGYRVNFRDGNETTRYYTDSLEDAVKTAVEMTRKRAL*
Ga0075424_10076532343300006904Populus RhizosphereYRVNFRDGNETTAYYTDNLDDAVNTAIEMARERAL*
Ga0075418_1274277413300009100Populus RhizosphereKVRSGDYRVSFPDGGESAYYTDDLEDAVNTAVEMARRRAS*
Ga0126380_1067579223300010043Tropical Forest SoilVRSGDYRVTFRDGDETGSYYTDDLEDAVNTAVEMARKRAF*
Ga0126382_1049910033300010047Tropical Forest SoilLGLTLRKVRSGDYRVNFRDGNETTAYYTGSLEDAVNTAVELARKRALRAAPCD*
Ga0126382_1066004953300010047Tropical Forest SoilYRVNFRDGNEPAPYYTDDLEDAVNTAVEMVRKRGK*
Ga0126370_1055882223300010358Tropical Forest SoilTLRKVRSGDYRVNFRDGNENMAYYTDDLEDAVSAAVEMARNRGQSPC*
Ga0126370_1080470613300010358Tropical Forest SoilSGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMVRKRGK*
Ga0126370_1229558113300010358Tropical Forest SoilDYRVNCRDGNETMAYYTDNLEDAVNTAVEMARIGQGQSD*
Ga0126376_1138014013300010359Tropical Forest SoilRSGDYRVNFRDGNEMTAYYTDSLENAVNTAVEMARKRGQSPC*
Ga0126372_1062104523300010360Tropical Forest SoilVNFRDGSESGPYYTDNLEDAVNTAVEMARKRAKSGAS*
Ga0126378_1076969353300010361Tropical Forest SoilSGDYRVNFRDGSETTVYYTDSLEDAVNTAVEMSRKRGL*
Ga0126377_1351612713300010362Tropical Forest SoilGLTLRQLRSGNYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRGLVE*
Ga0126379_1038557613300010366Tropical Forest SoilVRSGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMARK
Ga0126379_1325725413300010366Tropical Forest SoilHLGLTLRKVRSGDYRVNFRDGNEATAYYTDNLEDAVNTVVEKARKRGQSPC*
Ga0126379_1360316813300010366Tropical Forest SoilFRDGNETTAYYTGSLEDAVNTAVELARKRALRAAPCD*
Ga0126381_10084541943300010376Tropical Forest SoilLRSGNYRVNFRDGNETTAYYTDNLEDAVNTAVEMTRRRAL*
Ga0134126_1119677123300010396Terrestrial SoilYRVSFPDGSEAAYYTDDLEDAVNTAVEMARRRAS*
Ga0126383_1201989723300010398Tropical Forest SoilGLTLRKVRSGNYRVNFRDGNEKTACYTDNFEDAVNTAVEMARKRAKL*
Ga0126383_1262293433300010398Tropical Forest SoilDYRVNFRDGNETTAYYTDNLEDAVNTAVEMTRRRAL*
Ga0137383_1031051313300012199Vadose Zone SoilVRSGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARERAL*
Ga0137363_1056680923300012202Vadose Zone SoilVRKVRSSDYRVNFRDGNEMTAYYTDNLEDAVNTAVVMARKRAKDAILA*
Ga0137362_1068860443300012205Vadose Zone SoilKVRSGDYRVNFRDGNATGACYKDNLEDAVNTAVEMARKKLK*
Ga0137379_1083763813300012209Vadose Zone SoilKVRSGDYRVNFPDGNETEAYYTDNLEDAVNAAVEMTRKRGK*
Ga0137358_1059352133300012582Vadose Zone SoilYRVNFRDGNETTAYYTDNLEDAVNTAIEMTRKRAL*
Ga0157297_1000435613300012914SoilLTLTLRKVRSGDYRVNFPNADDSAAYYTDNLEDAINAAVEMARKGTT
Ga0126375_1003697543300012948Tropical Forest SoilMAPVNFRDGNETTAYYTDDLEDAVNTAVEMARKRGLVE*
Ga0126375_1168193123300012948Tropical Forest SoilKVRSGDYRVSSRDGDETIAYYTQNLEDAINAAVEMARKRAL*
Ga0164300_1044177223300012951SoilVRSGAYRVNFRDGNETTAYYTDSLEDAVTTAVEMVRKRELSA
Ga0164306_1059240223300012988SoilLLRSGKYRVNYRDGKETTAYYTDDLEDAVNTAVEMARKREL*
Ga0164305_1166028143300012989SoilSGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMARKRGK*
Ga0164305_1170049723300012989SoilMAIPIRLDANETTAYYTDSLENAVNTAVEMARKRGQSPC*
Ga0137409_1105840413300015245Vadose Zone SoilVRSGKYRVNFRDGDETTAYYTDNLEDAVNTAVEMARKRVVSAAPYS*
Ga0132257_10336242713300015373Arabidopsis RhizosphereKVRSGDYRVNFRDANETTPYYTDSLEDAVKTAVMTRKRAL*
Ga0182036_1071478113300016270SoilGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL
Ga0182041_1122427713300016294SoilDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL
Ga0182033_1017132033300016319SoilQLRSGNYRVNFRDGNETTAYYADNLEDAVHTAVEMARKRGQSPC
Ga0182033_1023013513300016319SoilMVRSGEYRVNFRDGNETTAYYTDNLEDAIKTAIEMARR
Ga0182033_1043823223300016319SoilLRQLCSGNYRVNFRDGNETTAYYTDKLEDAVNTAVEMARERAL
Ga0182033_1117569613300016319SoilYRVNFRDGNETTAYYTDNLEDAVNTAVEMARERAL
Ga0182033_1199265523300016319SoilTLRQLRSGNYRVNFRDGNETTAYYTDKLEDAVNAVVAMAHKRAL
Ga0182035_1021341523300016341SoilYRVNFRDGNETTAYYTDNLEDAVKTAIEMARKRAL
Ga0182035_1173556213300016341SoilRSGNYRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL
Ga0182032_1153112013300016357SoilGLTLRKVRSGDYRVNFRDGNETSAYYTDNLEDAVNTAVEMAGRRAL
Ga0182037_1046431723300016404SoilRSGDYRVNFRDGNETTAYYTDNLEDAVKTAIEMARKRAL
Ga0182037_1158128213300016404SoilSGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL
Ga0182039_1187358813300016422SoilGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMARKRGK
Ga0182038_1045952833300016445SoilSGNYRVNFRDGNETTAYYTDNVEDAVNTAVAMARKRAL
Ga0182038_1187636213300016445SoilYRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL
Ga0182038_1188012923300016445SoilRSGDYRVNFRDGNETSAYYTDNLEDAVNTAVEMAGRRAL
Ga0210406_1072407013300021168SoilIRVNFRDGNKMTAHYTDNLEDAVNTVIEKARKRGQSPC
Ga0210400_1131197823300021170SoilALHLGLTLRKVRSGHYRVNFRDGDESTACYAVDLEDAVNAAGRDGS
Ga0210408_1112261323300021178SoilVRSGAYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRALELRHTE
Ga0210389_1132497223300021404SoilTLRKVRSGDYRVNFPDGSENAYYTDDLEDAVNTAVEMARQRAQ
Ga0207663_1165287113300025916Corn, Switchgrass And Miscanthus RhizosphereITLRKVRSGDYRVNFRDGDEMTAYNTDSLEDAVNTAIEMTRKRAL
Ga0207700_1080326133300025928Corn, Switchgrass And Miscanthus RhizosphereYRVNFRDGNEPAPYYTDDLEDAVNTAVEMARKRGK
Ga0207665_1006135423300025939Corn, Switchgrass And Miscanthus RhizosphereRSGDYRVNFRDGDETTVHYTDNLEDAVNTAVEMARKREL
Ga0209350_108593943300026277Grasslands SoilGLALRKVRSGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMARKRGK
Ga0209690_122439433300026524SoilDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMARKRGK
Ga0209465_1054600913300027874Tropical Forest SoilTLRKVRSGDYRVNFRDGNETTAYYTGSLEDAVNTAVELARKRALRAAPCD
Ga0209283_1089056433300027875Vadose Zone SoilKVRSGDYRVSSRDGDETTAYYTDTLEDAVCTAVEMARKRAL
Ga0222749_1073971813300029636SoilHLGLTLRKVRSGDYRVSFREGNETAAYYTDSLEDAVKTAVELARRRTF
Ga0307497_1034169333300031226SoilLTLRKVRSGDYRVNFRDGNETTAYYTDNLEDAVNSAVEMARKRALTN
Ga0318516_1017915733300031543SoilMRSGAYRVNFRDGNETTAYYTDHLEDAVNTAVEMARTRGQSRC
Ga0318541_1072861613300031545SoilMVRSGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL
Ga0318538_1025666633300031546SoilELTLRHLRSGNYRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL
Ga0318528_1005215833300031561SoilVRSGDYRVNLRDGNETTAYYADNLEDAVNTAVEMARKRTL
Ga0318528_1006608453300031561SoilTVRNVRSGDYRVSFRDGNGTTAYYTDNLEDAVSTAVDIARKRAL
Ga0310915_1046090633300031573SoilRKVRSGDYRVNFRDGNEMTPYYTDNLEDAVSAAVEMARKRGQSPC
Ga0318555_1076219023300031640SoilYRVNFRDGNETTAYYTDNLEDAANTAVEMARKRAL
Ga0318561_1019879313300031679SoilLRKVRSGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMVRKRGK
Ga0318574_1028006513300031680SoilRVDFRDGNEATAYYTDNLEDAANTAVEMARKRGQSPC
Ga0318574_1043131633300031680SoilLGLTLRKVRSGDYRVNFRDGNEMTAYYTDSLENAVNTAVEMARKRGQSPC
Ga0318572_1081851113300031681SoilYRVNFRDGNETSAYYTDNLEDAVNTAVEMARRRAL
Ga0306917_1023244143300031719SoilTLRMVRSGDYRVNFRDGNETTAYYTDNLEDAIKTAIEMARR
Ga0318500_1044629013300031724SoilRMVRSGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL
Ga0306918_1106902413300031744SoilLRQVRSGDYRVNFRDGNETTAYYTNHLEDAVNTAVEMVRTREQSRC
Ga0306918_1125664613300031744SoilGNYRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL
Ga0318492_1025270543300031748SoilTLRQVRSGAYRVNFRDGNENTAYYTDLLEDAVNTAVEMARTRGQSRC
Ga0318492_1044467013300031748SoilGDYRVNLRDGNETTAYYADNLEDAVNTAVEMARKRTL
Ga0318492_1057258213300031748SoilHLGLTLRKVRSGDYRVNFRDGNEMTPYYTDNLEDAVSAAVEMARKRGQSPC
Ga0318494_1045423613300031751SoilMRSGAYRVNFRDGNETTAYYTDHLEDAVNTAVEMARTRGQS
Ga0318535_1004302013300031764SoilGDYRGNFRDGNEATACYTDNLEDAVNTAVEMARKRAL
Ga0318509_1014508613300031768SoilSGDYRVTFRDGDETGSYYTDDLEDAVNTAVEMARKRAF
Ga0318509_1068483513300031768SoilAGSQIVNFRDRNETTAYYTDNLEDAVNTAVEMARKRAL
Ga0318521_1040863533300031770SoilHLRLTLRKVRSGDYRVNLRDGNETTAYYADKLEDAVNTAVEMARKRTL
Ga0318546_1059286423300031771SoilLGLTLRKVCSGDYRVNFRDGNETTAYYTTNLEDAVKTAVAMARKRAL
Ga0318508_105924213300031780SoilVRSGDYRVNFRDGNETSAYYTDNLEDAVNTAVEMARRRAL
Ga0318576_1018237213300031796SoilGDYRVNFRDGNETSAYYTDNLEDAVNTAVEMARRRAL
Ga0318550_1038783633300031797SoilRKVRSGDYRVNLRDGNETTAYYADKLEDAVNTAVEMARKRTL
Ga0318565_1006689323300031799SoilLGLTLRKVRSGDYRVNFRDGDETTVHYTDNLEDAVNTAVEMARKREL
Ga0307473_1096991813300031820Hardwood Forest SoilGDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARKRGQSPC
Ga0318567_1065584513300031821SoilTMRKVRSGDYRVNFRDGNATTAYYTDSLEDAANTAVEMARKRGQSPC
Ga0310917_1044782523300031833SoilGLTLRKVRSGHYRVNFRDGDETTAYYADDLEDAVNTAVEMARKREL
Ga0318511_1033384533300031845SoilRKVRSGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMVRKRGK
Ga0306919_1008253513300031879SoilGDYRVDFRDGSETTVYYTDSLEDAVNTAVEMSRKRGL
Ga0318544_1015694913300031880SoilLCSGNYRVNFRDGNETSAYYTDKLEDAVNTAVEMARERAL
Ga0306925_1018888813300031890SoilVRSGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL
Ga0306923_1003830253300031910SoilVRSGDYRVNLRDGNETTAYYADKLEDAVNTAVEMARKRTL
Ga0306923_1073576813300031910SoilSGDYRVNFRDGNETTAHYTDNLEDAVNAAVEMARKRPSAP
Ga0306921_1165682123300031912SoilLRQMRSSDYRVNFRDGSETAAYDTDNLEDAVNAAVDMARKRALLSSTVQSGT
Ga0310912_1076622113300031941SoilHLGLTLRKVRSGEYRVNFRDGNETTAYYTDKLEYAVNTAVEMARERAL
Ga0310916_1137339013300031942SoilLGLTLRMVRSGDYRVNFRDGNETTAYYTDNLEDAIKTAIEMARR
Ga0310913_1030231313300031945SoilTLRKVRSGDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARKRGQSPC
Ga0310913_1094504713300031945SoilDYRVNGNETTAYYTDNLEDAVNTVVEKARKRGLVG
Ga0310910_1066357013300031946SoilNYRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL
Ga0310910_1099764423300031946SoilLGLTLRMVRSGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL
Ga0310909_1018245453300031947SoilRSGDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARKRGQSPC
Ga0310909_1148053313300031947SoilLRMVRSGDYRVNFRDGNETTAYYTDNLEDAIKTAIEMARR
Ga0318530_1004745213300031959SoilMRSGAYRVNFRDGNETTAYYTDHLEDAVNTAVEMARTRGQ
Ga0318530_1038693823300031959SoilTLRKVRSGDYRVNFRDGSETTVYYTDSLEDAVNTAVEMSRKRGL
Ga0318531_1043336333300031981SoilGDYRVNFRDGSETTVYYTDSLEDAVNTAVEMSRKRGL
Ga0306922_1092408633300032001SoilVRSGDYRVNFRDGNETTAYYTNHLEDAVNTAVEMVRTREQSRC
Ga0318507_1013995123300032025SoilLTLRQLCSGNYRVNFRDGNETTAYYTDKLEDAVNTAVEMARERAL
Ga0310911_1072857713300032035SoilVRSGEYRVNFRDGNETTAYYTDKLEYAVNTAVEMARERAL
Ga0318533_1137356233300032059SoilLGLTLRKVRSGDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARKRGQSPC
Ga0318514_1003353143300032066SoilTLRKVRSGEYRVNFRDGNETSAYYTDNLEDAVNTAVEMARRRAL
Ga0306924_1243041823300032076SoilSGDYRVNFRDGSETTVYYTDSLEDAVNTAVEMSRKRGL
Ga0318518_1067673523300032090SoilTQRKVRSGDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARTRGQSRC
Ga0318540_1000718083300032094SoilHPAPMRSGAYRVNFRDGNETTAYYTDHLEDAVNTAVEMARTRGQSRC
Ga0307472_10183176713300032205Hardwood Forest SoilRKVRSGDYQVNFRDESESGPYYTDNLEDAVNTAVEMARKRGK
Ga0310914_1142225723300033289SoilHLRSGNYRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL
Ga0318519_1062034613300033290SoilHLGLTLRKVRSGHYRVNFCDGDETTAYYADDLEDAVNTAVEMARKREL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.