| Basic Information | |
|---|---|
| Family ID | F045954 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VRSGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.17 % |
| % of genes near scaffold ends (potentially truncated) | 85.53 % |
| % of genes from short scaffolds (< 2000 bps) | 88.82 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.868 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.868 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.684 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.289 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 20.59% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 2.63 |
| PF08281 | Sigma70_r4_2 | 1.32 |
| PF00536 | SAM_1 | 1.32 |
| PF02518 | HATPase_c | 1.32 |
| PF10417 | 1-cysPrx_C | 0.66 |
| PF12833 | HTH_18 | 0.66 |
| PF00565 | SNase | 0.66 |
| PF00126 | HTH_1 | 0.66 |
| PF01545 | Cation_efflux | 0.66 |
| PF13505 | OMP_b-brl | 0.66 |
| PF10108 | DNA_pol_B_exo2 | 0.66 |
| PF05988 | DUF899 | 0.66 |
| PF00580 | UvrD-helicase | 0.66 |
| PF00230 | MIP | 0.66 |
| PF06078 | DUF937 | 0.66 |
| PF00665 | rve | 0.66 |
| PF00596 | Aldolase_II | 0.66 |
| PF00805 | Pentapeptide | 0.66 |
| PF13589 | HATPase_c_3 | 0.66 |
| PF04542 | Sigma70_r2 | 0.66 |
| PF08239 | SH3_3 | 0.66 |
| PF13356 | Arm-DNA-bind_3 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.63 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.66 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.66 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.66 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.66 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.66 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.66 |
| COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.66 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.66 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.66 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.66 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.66 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.66 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.66 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.66 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.66 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.66 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.66 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.87 % |
| Unclassified | root | N/A | 15.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459018|G1P06HT01DEGTB | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300000956|JGI10216J12902_100203904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 808 | Open in IMG/M |
| 3300000956|JGI10216J12902_100786624 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300000956|JGI10216J12902_117063987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 770 | Open in IMG/M |
| 3300004463|Ga0063356_103166273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300005187|Ga0066675_10518068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 892 | Open in IMG/M |
| 3300005332|Ga0066388_106407593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300005332|Ga0066388_107194071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300005332|Ga0066388_108815626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300005363|Ga0008090_14512281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300005406|Ga0070703_10426455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300005439|Ga0070711_100050387 | All Organisms → cellular organisms → Bacteria | 2855 | Open in IMG/M |
| 3300005454|Ga0066687_10208883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1070 | Open in IMG/M |
| 3300005471|Ga0070698_100715887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 943 | Open in IMG/M |
| 3300005518|Ga0070699_100190694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1821 | Open in IMG/M |
| 3300005713|Ga0066905_100262494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1334 | Open in IMG/M |
| 3300005713|Ga0066905_101093813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300005713|Ga0066905_101953747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300005764|Ga0066903_101567116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1247 | Open in IMG/M |
| 3300005764|Ga0066903_101702891 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300005764|Ga0066903_102869801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 935 | Open in IMG/M |
| 3300005764|Ga0066903_106121152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300005764|Ga0066903_107628405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300005764|Ga0066903_107823107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300005764|Ga0066903_108025570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300005764|Ga0066903_108947651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300006051|Ga0075364_10976530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300006173|Ga0070716_100713302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300006797|Ga0066659_10979094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300006904|Ga0075424_100765323 | Not Available | 1030 | Open in IMG/M |
| 3300009100|Ga0075418_12742774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300010043|Ga0126380_10675792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 826 | Open in IMG/M |
| 3300010047|Ga0126382_10499100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 978 | Open in IMG/M |
| 3300010047|Ga0126382_10660049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 871 | Open in IMG/M |
| 3300010358|Ga0126370_10558822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 979 | Open in IMG/M |
| 3300010358|Ga0126370_10804706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 838 | Open in IMG/M |
| 3300010358|Ga0126370_12295581 | Not Available | 534 | Open in IMG/M |
| 3300010359|Ga0126376_11380140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300010360|Ga0126372_10621045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1041 | Open in IMG/M |
| 3300010361|Ga0126378_10769693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1073 | Open in IMG/M |
| 3300010362|Ga0126377_13516127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300010366|Ga0126379_10385576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1444 | Open in IMG/M |
| 3300010366|Ga0126379_13257254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300010366|Ga0126379_13603168 | Not Available | 519 | Open in IMG/M |
| 3300010376|Ga0126381_100845419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1316 | Open in IMG/M |
| 3300010396|Ga0134126_11196771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 844 | Open in IMG/M |
| 3300010398|Ga0126383_12019897 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300010398|Ga0126383_12622934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300012199|Ga0137383_10310513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1155 | Open in IMG/M |
| 3300012202|Ga0137363_10566809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 957 | Open in IMG/M |
| 3300012205|Ga0137362_10688604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 879 | Open in IMG/M |
| 3300012209|Ga0137379_10837638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 824 | Open in IMG/M |
| 3300012582|Ga0137358_10593521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300012914|Ga0157297_10004356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2762 | Open in IMG/M |
| 3300012948|Ga0126375_10036975 | Not Available | 2485 | Open in IMG/M |
| 3300012948|Ga0126375_11681931 | Not Available | 550 | Open in IMG/M |
| 3300012951|Ga0164300_10441772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300012988|Ga0164306_10592402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300012989|Ga0164305_11660281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300012989|Ga0164305_11700497 | Not Available | 566 | Open in IMG/M |
| 3300015245|Ga0137409_11058404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300015373|Ga0132257_103362427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300016270|Ga0182036_10714781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 811 | Open in IMG/M |
| 3300016294|Ga0182041_11224277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300016319|Ga0182033_10171320 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
| 3300016319|Ga0182033_10230135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1494 | Open in IMG/M |
| 3300016319|Ga0182033_10438232 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300016319|Ga0182033_11175696 | Not Available | 687 | Open in IMG/M |
| 3300016319|Ga0182033_11992655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300016341|Ga0182035_10213415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1535 | Open in IMG/M |
| 3300016341|Ga0182035_11735562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300016357|Ga0182032_11531120 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300016404|Ga0182037_10464317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1055 | Open in IMG/M |
| 3300016404|Ga0182037_11581282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300016422|Ga0182039_11873588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300016445|Ga0182038_10459528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1079 | Open in IMG/M |
| 3300016445|Ga0182038_11876362 | Not Available | 541 | Open in IMG/M |
| 3300016445|Ga0182038_11880129 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300021168|Ga0210406_10724070 | Not Available | 764 | Open in IMG/M |
| 3300021170|Ga0210400_11311978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300021178|Ga0210408_11122613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300021404|Ga0210389_11324972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300025916|Ga0207663_11652871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300025928|Ga0207700_10803261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 841 | Open in IMG/M |
| 3300025939|Ga0207665_10061354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2548 | Open in IMG/M |
| 3300026277|Ga0209350_1085939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 825 | Open in IMG/M |
| 3300026524|Ga0209690_1224394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300027874|Ga0209465_10546009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300027875|Ga0209283_10890564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300029636|Ga0222749_10739718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300031226|Ga0307497_10341693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300031545|Ga0318541_10728616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300031546|Ga0318538_10256666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 939 | Open in IMG/M |
| 3300031561|Ga0318528_10052158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2071 | Open in IMG/M |
| 3300031561|Ga0318528_10066084 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300031573|Ga0310915_10460906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
| 3300031640|Ga0318555_10762190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300031679|Ga0318561_10198793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1087 | Open in IMG/M |
| 3300031680|Ga0318574_10280065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 967 | Open in IMG/M |
| 3300031680|Ga0318574_10431316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300031681|Ga0318572_10818511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300031719|Ga0306917_10232441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1407 | Open in IMG/M |
| 3300031724|Ga0318500_10446290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300031744|Ga0306918_11256646 | Not Available | 570 | Open in IMG/M |
| 3300031748|Ga0318492_10444670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300031748|Ga0318492_10572582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300031764|Ga0318535_10043020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1862 | Open in IMG/M |
| 3300031768|Ga0318509_10145086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1307 | Open in IMG/M |
| 3300031768|Ga0318509_10684835 | Not Available | 569 | Open in IMG/M |
| 3300031770|Ga0318521_10408635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300031771|Ga0318546_10592864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 779 | Open in IMG/M |
| 3300031780|Ga0318508_1059242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1023 | Open in IMG/M |
| 3300031796|Ga0318576_10182372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 985 | Open in IMG/M |
| 3300031797|Ga0318550_10387836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300031799|Ga0318565_10066893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1691 | Open in IMG/M |
| 3300031820|Ga0307473_10969918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300031821|Ga0318567_10655845 | Not Available | 596 | Open in IMG/M |
| 3300031833|Ga0310917_10447825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 878 | Open in IMG/M |
| 3300031845|Ga0318511_10333845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 689 | Open in IMG/M |
| 3300031879|Ga0306919_10082535 | Not Available | 2220 | Open in IMG/M |
| 3300031880|Ga0318544_10156949 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300031890|Ga0306925_10188888 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
| 3300031910|Ga0306923_10038302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5220 | Open in IMG/M |
| 3300031910|Ga0306923_10735768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1095 | Open in IMG/M |
| 3300031912|Ga0306921_11656821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 693 | Open in IMG/M |
| 3300031941|Ga0310912_10766221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300031942|Ga0310916_11373390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300031945|Ga0310913_10302313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1129 | Open in IMG/M |
| 3300031945|Ga0310913_10945047 | Not Available | 605 | Open in IMG/M |
| 3300031946|Ga0310910_10663570 | Not Available | 825 | Open in IMG/M |
| 3300031946|Ga0310910_10997644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300031947|Ga0310909_10182454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1738 | Open in IMG/M |
| 3300031947|Ga0310909_11480533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300031959|Ga0318530_10386938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300031981|Ga0318531_10433363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300032025|Ga0318507_10139951 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300032035|Ga0310911_10728577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300032059|Ga0318533_11373562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300032066|Ga0318514_10033531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2422 | Open in IMG/M |
| 3300032076|Ga0306924_12430418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300032090|Ga0318518_10676735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300032205|Ga0307472_101831767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
| 3300033289|Ga0310914_11422257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300033290|Ga0318519_10620346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 658 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.32% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.32% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.66% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.66% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.66% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459018 | Litter degradation MG2 | Engineered | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2MG_00678060 | 2170459018 | Switchgrass, Maize And Mischanthus Litter | YRVKFRDRNETTAYYTDSLEDAVNTAVEMTRKRAL |
| JGI10216J12902_1002039043 | 3300000956 | Soil | SGDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARKRGQSPC* |
| JGI10216J12902_1007866245 | 3300000956 | Soil | HLGLTLRKVRSGDYRVNFRDGNETTAYYTDDLEDAVNMGLEMVRKRA* |
| JGI10216J12902_1070157754 | 3300000956 | Soil | HLGLTLRKVRSGDYRVSFRDGNETVAYYTDDLEDAVDVGLEMVRKRA* |
| JGI10216J12902_1170639872 | 3300000956 | Soil | CSGDYRVNFRDGNETTDYYTDSLEDAINTAIGMARRRELHHTELET* |
| Ga0063356_1031662731 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LRIVRSGAYRVNFRDGNETTAYYTDNLDDAVNTAIEMACKR* |
| Ga0066675_105180681 | 3300005187 | Soil | LTLRKVRSGDYRVNFRDGNETTRYYTDSLEDAVKTAVEMTRKRAL* |
| Ga0066388_1064075931 | 3300005332 | Tropical Forest Soil | VRSGDYRVNFRDGNETTAYYTDNLEDAANTAVEMARKRAL* |
| Ga0066388_1071940711 | 3300005332 | Tropical Forest Soil | VRSGDYRVNFRDGNETSAYYTDDLEDAVSAAVEMARKRGQSPC* |
| Ga0066388_1088156262 | 3300005332 | Tropical Forest Soil | KVRSGDYRVNFRDGNETTAYYTDSLEDAVNTAVEMARKRAQSPC* |
| Ga0008090_145122812 | 3300005363 | Tropical Rainforest Soil | VRSGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMVRKRGK* |
| Ga0070703_104264551 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LRKVRSGDYRVNFRDGNEPAPYYTDDLENAVNTAVEMARKRGK* |
| Ga0070711_1000503871 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RKVRSGDYRVNFRDGNEMTAYYTDNLEDTVNTAVEMARKRAL* |
| Ga0066687_102088831 | 3300005454 | Soil | LRKVRSGDYRVNFRDGNETTRYYTDSLEDAVKTAVEMTRKRAL* |
| Ga0070698_1007158873 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RSGNYRVNFRDGNETTAYYTDDLEDAVNTTVEMARKRAL* |
| Ga0070699_1001906945 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | CSGDYRVNFRDGNETTAYYTDDLEDAVNTAVEMARKRALRAAPHRLGT* |
| Ga0066905_1002624943 | 3300005713 | Tropical Forest Soil | YRVNFRDGNETTAYYTDNLEDAVNTAVEMTRRRAL* |
| Ga0066905_1010938132 | 3300005713 | Tropical Forest Soil | LRQLHSGNYRVNFRDGNETTAYYTDKFEDAVNAVVAMARKRAL* |
| Ga0066905_1019537472 | 3300005713 | Tropical Forest Soil | TLRKVRSGDYRVNFRDGNEMTPYYTDNLEDAVSTAVEMARKRG* |
| Ga0066903_1015671161 | 3300005764 | Tropical Forest Soil | MVRFGEYRVNFRDGNETTAYYTDNLEDAVNTAVEIARKRAL* |
| Ga0066903_1017028911 | 3300005764 | Tropical Forest Soil | VRSGDYRVNFRDGNETTAYYTDDLEDAVNVGLEMVRKRA* |
| Ga0066903_1028698011 | 3300005764 | Tropical Forest Soil | MGVSGTLRHVRSGDYRVNFRDGSETAAYYTDSLEDAVNAAVDMARKRAL* |
| Ga0066903_1061211523 | 3300005764 | Tropical Forest Soil | YRVNFRDGNEMTAYYTDSLENAVNTAVEMARKCGQSPC* |
| Ga0066903_1076284051 | 3300005764 | Tropical Forest Soil | KVRSGDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARKRGQSPC* |
| Ga0066903_1078231072 | 3300005764 | Tropical Forest Soil | MMQGGKGRTNFRDGNETSAYYTDNLEDAVNTAVEMARRRAL* |
| Ga0066903_1080255701 | 3300005764 | Tropical Forest Soil | GEYRVNFRDGNETTAYYTDNLEDAVKTAIEMARKRAL* |
| Ga0066903_1089476513 | 3300005764 | Tropical Forest Soil | LGFTLRKVRSGDYRVSFRDGNETTAYYTDTLEAAVNTAVGDGP* |
| Ga0075364_109765301 | 3300006051 | Populus Endosphere | TLRKVRSGDYRVNFRDINEPYYTDNLEDAVTTAVEMARRRAL* |
| Ga0070716_1007133023 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLTLRKVRSGDYRVNFRDGDEMTAYNTDSLEDAVNTAIEMTRKRAL* |
| Ga0066659_109790941 | 3300006797 | Soil | LGLTLRKVRSGYRVNFRDGNETTRYYTDSLEDAVKTAVEMTRKRAL* |
| Ga0075424_1007653234 | 3300006904 | Populus Rhizosphere | YRVNFRDGNETTAYYTDNLDDAVNTAIEMARERAL* |
| Ga0075418_127427741 | 3300009100 | Populus Rhizosphere | KVRSGDYRVSFPDGGESAYYTDDLEDAVNTAVEMARRRAS* |
| Ga0126380_106757922 | 3300010043 | Tropical Forest Soil | VRSGDYRVTFRDGDETGSYYTDDLEDAVNTAVEMARKRAF* |
| Ga0126382_104991003 | 3300010047 | Tropical Forest Soil | LGLTLRKVRSGDYRVNFRDGNETTAYYTGSLEDAVNTAVELARKRALRAAPCD* |
| Ga0126382_106600495 | 3300010047 | Tropical Forest Soil | YRVNFRDGNEPAPYYTDDLEDAVNTAVEMVRKRGK* |
| Ga0126370_105588222 | 3300010358 | Tropical Forest Soil | TLRKVRSGDYRVNFRDGNENMAYYTDDLEDAVSAAVEMARNRGQSPC* |
| Ga0126370_108047061 | 3300010358 | Tropical Forest Soil | SGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMVRKRGK* |
| Ga0126370_122955811 | 3300010358 | Tropical Forest Soil | DYRVNCRDGNETMAYYTDNLEDAVNTAVEMARIGQGQSD* |
| Ga0126376_113801401 | 3300010359 | Tropical Forest Soil | RSGDYRVNFRDGNEMTAYYTDSLENAVNTAVEMARKRGQSPC* |
| Ga0126372_106210452 | 3300010360 | Tropical Forest Soil | VNFRDGSESGPYYTDNLEDAVNTAVEMARKRAKSGAS* |
| Ga0126378_107696935 | 3300010361 | Tropical Forest Soil | SGDYRVNFRDGSETTVYYTDSLEDAVNTAVEMSRKRGL* |
| Ga0126377_135161271 | 3300010362 | Tropical Forest Soil | GLTLRQLRSGNYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRGLVE* |
| Ga0126379_103855761 | 3300010366 | Tropical Forest Soil | VRSGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMARK |
| Ga0126379_132572541 | 3300010366 | Tropical Forest Soil | HLGLTLRKVRSGDYRVNFRDGNEATAYYTDNLEDAVNTVVEKARKRGQSPC* |
| Ga0126379_136031681 | 3300010366 | Tropical Forest Soil | FRDGNETTAYYTGSLEDAVNTAVELARKRALRAAPCD* |
| Ga0126381_1008454194 | 3300010376 | Tropical Forest Soil | LRSGNYRVNFRDGNETTAYYTDNLEDAVNTAVEMTRRRAL* |
| Ga0134126_111967712 | 3300010396 | Terrestrial Soil | YRVSFPDGSEAAYYTDDLEDAVNTAVEMARRRAS* |
| Ga0126383_120198972 | 3300010398 | Tropical Forest Soil | GLTLRKVRSGNYRVNFRDGNEKTACYTDNFEDAVNTAVEMARKRAKL* |
| Ga0126383_126229343 | 3300010398 | Tropical Forest Soil | DYRVNFRDGNETTAYYTDNLEDAVNTAVEMTRRRAL* |
| Ga0137383_103105131 | 3300012199 | Vadose Zone Soil | VRSGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARERAL* |
| Ga0137363_105668092 | 3300012202 | Vadose Zone Soil | VRKVRSSDYRVNFRDGNEMTAYYTDNLEDAVNTAVVMARKRAKDAILA* |
| Ga0137362_106886044 | 3300012205 | Vadose Zone Soil | KVRSGDYRVNFRDGNATGACYKDNLEDAVNTAVEMARKKLK* |
| Ga0137379_108376381 | 3300012209 | Vadose Zone Soil | KVRSGDYRVNFPDGNETEAYYTDNLEDAVNAAVEMTRKRGK* |
| Ga0137358_105935213 | 3300012582 | Vadose Zone Soil | YRVNFRDGNETTAYYTDNLEDAVNTAIEMTRKRAL* |
| Ga0157297_100043561 | 3300012914 | Soil | LTLTLRKVRSGDYRVNFPNADDSAAYYTDNLEDAINAAVEMARKGTT |
| Ga0126375_100369754 | 3300012948 | Tropical Forest Soil | MAPVNFRDGNETTAYYTDDLEDAVNTAVEMARKRGLVE* |
| Ga0126375_116819312 | 3300012948 | Tropical Forest Soil | KVRSGDYRVSSRDGDETIAYYTQNLEDAINAAVEMARKRAL* |
| Ga0164300_104417722 | 3300012951 | Soil | VRSGAYRVNFRDGNETTAYYTDSLEDAVTTAVEMVRKRELSA |
| Ga0164306_105924022 | 3300012988 | Soil | LLRSGKYRVNYRDGKETTAYYTDDLEDAVNTAVEMARKREL* |
| Ga0164305_116602814 | 3300012989 | Soil | SGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMARKRGK* |
| Ga0164305_117004972 | 3300012989 | Soil | MAIPIRLDANETTAYYTDSLENAVNTAVEMARKRGQSPC* |
| Ga0137409_110584041 | 3300015245 | Vadose Zone Soil | VRSGKYRVNFRDGDETTAYYTDNLEDAVNTAVEMARKRVVSAAPYS* |
| Ga0132257_1033624271 | 3300015373 | Arabidopsis Rhizosphere | KVRSGDYRVNFRDANETTPYYTDSLEDAVKTAVMTRKRAL* |
| Ga0182036_107147811 | 3300016270 | Soil | GLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL |
| Ga0182041_112242771 | 3300016294 | Soil | DYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL |
| Ga0182033_101713203 | 3300016319 | Soil | QLRSGNYRVNFRDGNETTAYYADNLEDAVHTAVEMARKRGQSPC |
| Ga0182033_102301351 | 3300016319 | Soil | MVRSGEYRVNFRDGNETTAYYTDNLEDAIKTAIEMARR |
| Ga0182033_104382322 | 3300016319 | Soil | LRQLCSGNYRVNFRDGNETTAYYTDKLEDAVNTAVEMARERAL |
| Ga0182033_111756961 | 3300016319 | Soil | YRVNFRDGNETTAYYTDNLEDAVNTAVEMARERAL |
| Ga0182033_119926552 | 3300016319 | Soil | TLRQLRSGNYRVNFRDGNETTAYYTDKLEDAVNAVVAMAHKRAL |
| Ga0182035_102134152 | 3300016341 | Soil | YRVNFRDGNETTAYYTDNLEDAVKTAIEMARKRAL |
| Ga0182035_117355621 | 3300016341 | Soil | RSGNYRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL |
| Ga0182032_115311201 | 3300016357 | Soil | GLTLRKVRSGDYRVNFRDGNETSAYYTDNLEDAVNTAVEMAGRRAL |
| Ga0182037_104643172 | 3300016404 | Soil | RSGDYRVNFRDGNETTAYYTDNLEDAVKTAIEMARKRAL |
| Ga0182037_115812821 | 3300016404 | Soil | SGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL |
| Ga0182039_118735881 | 3300016422 | Soil | GDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMARKRGK |
| Ga0182038_104595283 | 3300016445 | Soil | SGNYRVNFRDGNETTAYYTDNVEDAVNTAVAMARKRAL |
| Ga0182038_118763621 | 3300016445 | Soil | YRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL |
| Ga0182038_118801292 | 3300016445 | Soil | RSGDYRVNFRDGNETSAYYTDNLEDAVNTAVEMAGRRAL |
| Ga0210406_107240701 | 3300021168 | Soil | IRVNFRDGNKMTAHYTDNLEDAVNTVIEKARKRGQSPC |
| Ga0210400_113119782 | 3300021170 | Soil | ALHLGLTLRKVRSGHYRVNFRDGDESTACYAVDLEDAVNAAGRDGS |
| Ga0210408_111226132 | 3300021178 | Soil | VRSGAYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRALELRHTE |
| Ga0210389_113249722 | 3300021404 | Soil | TLRKVRSGDYRVNFPDGSENAYYTDDLEDAVNTAVEMARQRAQ |
| Ga0207663_116528711 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ITLRKVRSGDYRVNFRDGDEMTAYNTDSLEDAVNTAIEMTRKRAL |
| Ga0207700_108032613 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | YRVNFRDGNEPAPYYTDDLEDAVNTAVEMARKRGK |
| Ga0207665_100613542 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RSGDYRVNFRDGDETTVHYTDNLEDAVNTAVEMARKREL |
| Ga0209350_10859394 | 3300026277 | Grasslands Soil | GLALRKVRSGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMARKRGK |
| Ga0209690_12243943 | 3300026524 | Soil | DYRVNFRDGNEPAPYYTDDLEDAVNTAVEMARKRGK |
| Ga0209465_105460091 | 3300027874 | Tropical Forest Soil | TLRKVRSGDYRVNFRDGNETTAYYTGSLEDAVNTAVELARKRALRAAPCD |
| Ga0209283_108905643 | 3300027875 | Vadose Zone Soil | KVRSGDYRVSSRDGDETTAYYTDTLEDAVCTAVEMARKRAL |
| Ga0222749_107397181 | 3300029636 | Soil | HLGLTLRKVRSGDYRVSFREGNETAAYYTDSLEDAVKTAVELARRRTF |
| Ga0307497_103416933 | 3300031226 | Soil | LTLRKVRSGDYRVNFRDGNETTAYYTDNLEDAVNSAVEMARKRALTN |
| Ga0318516_101791573 | 3300031543 | Soil | MRSGAYRVNFRDGNETTAYYTDHLEDAVNTAVEMARTRGQSRC |
| Ga0318541_107286161 | 3300031545 | Soil | MVRSGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL |
| Ga0318538_102566663 | 3300031546 | Soil | ELTLRHLRSGNYRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL |
| Ga0318528_100521583 | 3300031561 | Soil | VRSGDYRVNLRDGNETTAYYADNLEDAVNTAVEMARKRTL |
| Ga0318528_100660845 | 3300031561 | Soil | TVRNVRSGDYRVSFRDGNGTTAYYTDNLEDAVSTAVDIARKRAL |
| Ga0310915_104609063 | 3300031573 | Soil | RKVRSGDYRVNFRDGNEMTPYYTDNLEDAVSAAVEMARKRGQSPC |
| Ga0318555_107621902 | 3300031640 | Soil | YRVNFRDGNETTAYYTDNLEDAANTAVEMARKRAL |
| Ga0318561_101987931 | 3300031679 | Soil | LRKVRSGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMVRKRGK |
| Ga0318574_102800651 | 3300031680 | Soil | RVDFRDGNEATAYYTDNLEDAANTAVEMARKRGQSPC |
| Ga0318574_104313163 | 3300031680 | Soil | LGLTLRKVRSGDYRVNFRDGNEMTAYYTDSLENAVNTAVEMARKRGQSPC |
| Ga0318572_108185111 | 3300031681 | Soil | YRVNFRDGNETSAYYTDNLEDAVNTAVEMARRRAL |
| Ga0306917_102324414 | 3300031719 | Soil | TLRMVRSGDYRVNFRDGNETTAYYTDNLEDAIKTAIEMARR |
| Ga0318500_104462901 | 3300031724 | Soil | RMVRSGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL |
| Ga0306918_110690241 | 3300031744 | Soil | LRQVRSGDYRVNFRDGNETTAYYTNHLEDAVNTAVEMVRTREQSRC |
| Ga0306918_112566461 | 3300031744 | Soil | GNYRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL |
| Ga0318492_102527054 | 3300031748 | Soil | TLRQVRSGAYRVNFRDGNENTAYYTDLLEDAVNTAVEMARTRGQSRC |
| Ga0318492_104446701 | 3300031748 | Soil | GDYRVNLRDGNETTAYYADNLEDAVNTAVEMARKRTL |
| Ga0318492_105725821 | 3300031748 | Soil | HLGLTLRKVRSGDYRVNFRDGNEMTPYYTDNLEDAVSAAVEMARKRGQSPC |
| Ga0318494_104542361 | 3300031751 | Soil | MRSGAYRVNFRDGNETTAYYTDHLEDAVNTAVEMARTRGQS |
| Ga0318535_100430201 | 3300031764 | Soil | GDYRGNFRDGNEATACYTDNLEDAVNTAVEMARKRAL |
| Ga0318509_101450861 | 3300031768 | Soil | SGDYRVTFRDGDETGSYYTDDLEDAVNTAVEMARKRAF |
| Ga0318509_106848351 | 3300031768 | Soil | AGSQIVNFRDRNETTAYYTDNLEDAVNTAVEMARKRAL |
| Ga0318521_104086353 | 3300031770 | Soil | HLRLTLRKVRSGDYRVNLRDGNETTAYYADKLEDAVNTAVEMARKRTL |
| Ga0318546_105928642 | 3300031771 | Soil | LGLTLRKVCSGDYRVNFRDGNETTAYYTTNLEDAVKTAVAMARKRAL |
| Ga0318508_10592421 | 3300031780 | Soil | VRSGDYRVNFRDGNETSAYYTDNLEDAVNTAVEMARRRAL |
| Ga0318576_101823721 | 3300031796 | Soil | GDYRVNFRDGNETSAYYTDNLEDAVNTAVEMARRRAL |
| Ga0318550_103878363 | 3300031797 | Soil | RKVRSGDYRVNLRDGNETTAYYADKLEDAVNTAVEMARKRTL |
| Ga0318565_100668932 | 3300031799 | Soil | LGLTLRKVRSGDYRVNFRDGDETTVHYTDNLEDAVNTAVEMARKREL |
| Ga0307473_109699181 | 3300031820 | Hardwood Forest Soil | GDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARKRGQSPC |
| Ga0318567_106558451 | 3300031821 | Soil | TMRKVRSGDYRVNFRDGNATTAYYTDSLEDAANTAVEMARKRGQSPC |
| Ga0310917_104478252 | 3300031833 | Soil | GLTLRKVRSGHYRVNFRDGDETTAYYADDLEDAVNTAVEMARKREL |
| Ga0318511_103338453 | 3300031845 | Soil | RKVRSGDYRVNFRDGNEPAPYYTDDLEDAVNTAVEMVRKRGK |
| Ga0306919_100825351 | 3300031879 | Soil | GDYRVDFRDGSETTVYYTDSLEDAVNTAVEMSRKRGL |
| Ga0318544_101569491 | 3300031880 | Soil | LCSGNYRVNFRDGNETSAYYTDKLEDAVNTAVEMARERAL |
| Ga0306925_101888881 | 3300031890 | Soil | VRSGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL |
| Ga0306923_100383025 | 3300031910 | Soil | VRSGDYRVNLRDGNETTAYYADKLEDAVNTAVEMARKRTL |
| Ga0306923_107357681 | 3300031910 | Soil | SGDYRVNFRDGNETTAHYTDNLEDAVNAAVEMARKRPSAP |
| Ga0306921_116568212 | 3300031912 | Soil | LRQMRSSDYRVNFRDGSETAAYDTDNLEDAVNAAVDMARKRALLSSTVQSGT |
| Ga0310912_107662211 | 3300031941 | Soil | HLGLTLRKVRSGEYRVNFRDGNETTAYYTDKLEYAVNTAVEMARERAL |
| Ga0310916_113733901 | 3300031942 | Soil | LGLTLRMVRSGDYRVNFRDGNETTAYYTDNLEDAIKTAIEMARR |
| Ga0310913_103023131 | 3300031945 | Soil | TLRKVRSGDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARKRGQSPC |
| Ga0310913_109450471 | 3300031945 | Soil | DYRVNGNETTAYYTDNLEDAVNTVVEKARKRGLVG |
| Ga0310910_106635701 | 3300031946 | Soil | NYRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL |
| Ga0310910_109976442 | 3300031946 | Soil | LGLTLRMVRSGDYRVNFRDGNETTAYYTDNLEDAVNTAVEMARKRAL |
| Ga0310909_101824545 | 3300031947 | Soil | RSGDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARKRGQSPC |
| Ga0310909_114805331 | 3300031947 | Soil | LRMVRSGDYRVNFRDGNETTAYYTDNLEDAIKTAIEMARR |
| Ga0318530_100474521 | 3300031959 | Soil | MRSGAYRVNFRDGNETTAYYTDHLEDAVNTAVEMARTRGQ |
| Ga0318530_103869382 | 3300031959 | Soil | TLRKVRSGDYRVNFRDGSETTVYYTDSLEDAVNTAVEMSRKRGL |
| Ga0318531_104333633 | 3300031981 | Soil | GDYRVNFRDGSETTVYYTDSLEDAVNTAVEMSRKRGL |
| Ga0306922_109240863 | 3300032001 | Soil | VRSGDYRVNFRDGNETTAYYTNHLEDAVNTAVEMVRTREQSRC |
| Ga0318507_101399512 | 3300032025 | Soil | LTLRQLCSGNYRVNFRDGNETTAYYTDKLEDAVNTAVEMARERAL |
| Ga0310911_107285771 | 3300032035 | Soil | VRSGEYRVNFRDGNETTAYYTDKLEYAVNTAVEMARERAL |
| Ga0318533_113735623 | 3300032059 | Soil | LGLTLRKVRSGDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARKRGQSPC |
| Ga0318514_100335314 | 3300032066 | Soil | TLRKVRSGEYRVNFRDGNETSAYYTDNLEDAVNTAVEMARRRAL |
| Ga0306924_124304182 | 3300032076 | Soil | SGDYRVNFRDGSETTVYYTDSLEDAVNTAVEMSRKRGL |
| Ga0318518_106767352 | 3300032090 | Soil | TQRKVRSGDYRVNFRDGNEMTAYYTDNLEDAVNTVVEKARTRGQSRC |
| Ga0318540_100071808 | 3300032094 | Soil | HPAPMRSGAYRVNFRDGNETTAYYTDHLEDAVNTAVEMARTRGQSRC |
| Ga0307472_1018317671 | 3300032205 | Hardwood Forest Soil | RKVRSGDYQVNFRDESESGPYYTDNLEDAVNTAVEMARKRGK |
| Ga0310914_114222572 | 3300033289 | Soil | HLRSGNYRVNFRDGNETTAYYTDKLEDAVDAVVAMARRRAL |
| Ga0318519_106203461 | 3300033290 | Soil | HLGLTLRKVRSGHYRVNFCDGDETTAYYADDLEDAVNTAVEMARKREL |
| ⦗Top⦘ |