Basic Information | |
---|---|
Family ID | F045922 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 152 |
Average Sequence Length | 38 residues |
Representative Sequence | MIEEAMSITPIIFVLVILLFGFDSTGQVKTRRKHNYG |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 152 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 9.21 % |
% of genes near scaffold ends (potentially truncated) | 32.89 % |
% of genes from short scaffolds (< 2000 bps) | 86.18 % |
Associated GOLD sequencing projects | 117 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.553 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.605 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.447 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.053 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.85% β-sheet: 0.00% Coil/Unstructured: 66.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 152 Family Scaffolds |
---|---|---|
PF02776 | TPP_enzyme_N | 14.47 |
PF00903 | Glyoxalase | 5.92 |
PF12697 | Abhydrolase_6 | 4.61 |
PF02261 | Asp_decarbox | 4.61 |
PF08240 | ADH_N | 1.97 |
PF02922 | CBM_48 | 1.32 |
PF06912 | DUF1275 | 1.32 |
PF06081 | ArAE_1 | 1.32 |
PF01568 | Molydop_binding | 1.32 |
PF00724 | Oxidored_FMN | 1.32 |
PF00378 | ECH_1 | 0.66 |
PF00128 | Alpha-amylase | 0.66 |
PF13414 | TPR_11 | 0.66 |
PF13452 | MaoC_dehydrat_N | 0.66 |
PF02931 | Neur_chan_LBD | 0.66 |
PF01988 | VIT1 | 0.66 |
PF04545 | Sigma70_r4 | 0.66 |
PF03466 | LysR_substrate | 0.66 |
PF02515 | CoA_transf_3 | 0.66 |
PF02322 | Cyt_bd_oxida_II | 0.66 |
PF13515 | FUSC_2 | 0.66 |
PF16884 | ADH_N_2 | 0.66 |
PF02771 | Acyl-CoA_dh_N | 0.66 |
PF01575 | MaoC_dehydratas | 0.66 |
PF04632 | FUSC | 0.66 |
PF02775 | TPP_enzyme_C | 0.66 |
PF14833 | NAD_binding_11 | 0.66 |
PF06314 | ADC | 0.66 |
PF00873 | ACR_tran | 0.66 |
PF00582 | Usp | 0.66 |
COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
---|---|---|---|
COG0853 | Aspartate 1-decarboxylase | Coenzyme transport and metabolism [H] | 4.61 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 1.32 |
COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 1.32 |
COG3619 | Uncharacterized membrane protein YoaK, UPF0700 family | Function unknown [S] | 1.32 |
COG4129 | Uncharacterized membrane protein YgaE, UPF0421/DUF939 family | Function unknown [S] | 1.32 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.66 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.66 |
COG1289 | Uncharacterized membrane protein YccC | Function unknown [S] | 0.66 |
COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.66 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.66 |
COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.66 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.66 |
COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.66 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.66 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.66 |
COG4689 | Acetoacetate decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.66 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.55 % |
Unclassified | root | N/A | 16.45 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2065487018|GPINP_F5MS3JC02GTA5W | Not Available | 531 | Open in IMG/M |
2088090014|GPIPI_16976364 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
2088090014|GPIPI_17438355 | Not Available | 1677 | Open in IMG/M |
2166559005|cont_contig33417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1027 | Open in IMG/M |
2166559005|cont_contig74028 | Not Available | 700 | Open in IMG/M |
2170459005|F1BAP7Q01ALTXI | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
2170459009|GA8DASG02GCGCE | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 512 | Open in IMG/M |
2170459013|GO6OHWN01DUZXV | Not Available | 506 | Open in IMG/M |
2170459023|GZGNO2B01D7IC8 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 512 | Open in IMG/M |
2170459024|GZTSFBX01EC6NI | Not Available | 518 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100469861 | Not Available | 610 | Open in IMG/M |
3300000891|JGI10214J12806_12137429 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 770 | Open in IMG/M |
3300000955|JGI1027J12803_105753465 | Not Available | 557 | Open in IMG/M |
3300000955|JGI1027J12803_108590427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1438 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100121134 | All Organisms → cellular organisms → Bacteria | 2463 | Open in IMG/M |
3300005187|Ga0066675_10225053 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
3300005294|Ga0065705_10059222 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1380 | Open in IMG/M |
3300005328|Ga0070676_11460744 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 526 | Open in IMG/M |
3300005457|Ga0070662_100275618 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1360 | Open in IMG/M |
3300005457|Ga0070662_100905932 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 752 | Open in IMG/M |
3300005540|Ga0066697_10130171 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1479 | Open in IMG/M |
3300005540|Ga0066697_10484570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2568 | 705 | Open in IMG/M |
3300005552|Ga0066701_10368319 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 889 | Open in IMG/M |
3300005554|Ga0066661_10909853 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 514 | Open in IMG/M |
3300005559|Ga0066700_10780899 | Not Available | 645 | Open in IMG/M |
3300005576|Ga0066708_10967314 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005586|Ga0066691_10260404 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1020 | Open in IMG/M |
3300005598|Ga0066706_10079065 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2327 | Open in IMG/M |
3300005598|Ga0066706_10226304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. F001 | 1447 | Open in IMG/M |
3300005617|Ga0068859_100358697 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1553 | Open in IMG/M |
3300005713|Ga0066905_100042304 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2713 | Open in IMG/M |
3300005842|Ga0068858_100313333 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1499 | Open in IMG/M |
3300006028|Ga0070717_10087887 | All Organisms → cellular organisms → Bacteria | 2619 | Open in IMG/M |
3300006034|Ga0066656_11130391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. 21-62-4 | 504 | Open in IMG/M |
3300006046|Ga0066652_101539341 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 614 | Open in IMG/M |
3300006046|Ga0066652_102005021 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300006175|Ga0070712_100126055 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
3300006796|Ga0066665_10129203 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
3300006797|Ga0066659_10088024 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2080 | Open in IMG/M |
3300006797|Ga0066659_10292478 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
3300006844|Ga0075428_101835573 | Not Available | 631 | Open in IMG/M |
3300006854|Ga0075425_101331172 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 814 | Open in IMG/M |
3300006854|Ga0075425_102974088 | Not Available | 519 | Open in IMG/M |
3300007255|Ga0099791_10093054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1382 | Open in IMG/M |
3300007255|Ga0099791_10159861 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300007258|Ga0099793_10085103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1447 | Open in IMG/M |
3300009012|Ga0066710_102160798 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 815 | Open in IMG/M |
3300009137|Ga0066709_104346786 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 517 | Open in IMG/M |
3300009147|Ga0114129_11547322 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 813 | Open in IMG/M |
3300009176|Ga0105242_10417879 | Not Available | 1256 | Open in IMG/M |
3300010301|Ga0134070_10029083 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1823 | Open in IMG/M |
3300010323|Ga0134086_10038130 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
3300010358|Ga0126370_11125543 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 725 | Open in IMG/M |
3300010361|Ga0126378_10464604 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1380 | Open in IMG/M |
3300010401|Ga0134121_11882214 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 627 | Open in IMG/M |
3300012189|Ga0137388_11536530 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 602 | Open in IMG/M |
3300012198|Ga0137364_10172638 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1574 | Open in IMG/M |
3300012200|Ga0137382_10019234 | All Organisms → cellular organisms → Bacteria | 3877 | Open in IMG/M |
3300012200|Ga0137382_10151427 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
3300012200|Ga0137382_10775168 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300012202|Ga0137363_11226277 | Not Available | 637 | Open in IMG/M |
3300012202|Ga0137363_11680978 | Not Available | 527 | Open in IMG/M |
3300012203|Ga0137399_10252965 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
3300012204|Ga0137374_10070348 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3451 | Open in IMG/M |
3300012205|Ga0137362_10281369 | Not Available | 1438 | Open in IMG/M |
3300012205|Ga0137362_11699957 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 518 | Open in IMG/M |
3300012208|Ga0137376_11022912 | Not Available | 707 | Open in IMG/M |
3300012208|Ga0137376_11175612 | Not Available | 656 | Open in IMG/M |
3300012210|Ga0137378_11547594 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 573 | Open in IMG/M |
3300012211|Ga0137377_10644923 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300012285|Ga0137370_10033021 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2702 | Open in IMG/M |
3300012350|Ga0137372_10032626 | All Organisms → cellular organisms → Bacteria | 4758 | Open in IMG/M |
3300012351|Ga0137386_10471300 | Not Available | 905 | Open in IMG/M |
3300012355|Ga0137369_10569555 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 791 | Open in IMG/M |
3300012358|Ga0137368_10188245 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
3300012359|Ga0137385_11017372 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300012360|Ga0137375_10539477 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 984 | Open in IMG/M |
3300012361|Ga0137360_10316365 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300012361|Ga0137360_11803420 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 517 | Open in IMG/M |
3300012361|Ga0137360_11889223 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
3300012532|Ga0137373_10649608 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 791 | Open in IMG/M |
3300012683|Ga0137398_10291025 | Not Available | 1096 | Open in IMG/M |
3300012685|Ga0137397_10599695 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300012912|Ga0157306_10238646 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300012917|Ga0137395_10070499 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
3300012917|Ga0137395_10218866 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1331 | Open in IMG/M |
3300012918|Ga0137396_11099680 | Not Available | 568 | Open in IMG/M |
3300012924|Ga0137413_10578868 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300012929|Ga0137404_11144583 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 715 | Open in IMG/M |
3300012930|Ga0137407_11283971 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300012930|Ga0137407_11529991 | Not Available | 635 | Open in IMG/M |
3300012930|Ga0137407_11861018 | Not Available | 574 | Open in IMG/M |
3300012930|Ga0137407_11972899 | Not Available | 557 | Open in IMG/M |
3300012958|Ga0164299_11400041 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 540 | Open in IMG/M |
3300012960|Ga0164301_11339038 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 582 | Open in IMG/M |
3300012961|Ga0164302_10150578 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
3300012971|Ga0126369_10515908 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1255 | Open in IMG/M |
3300012971|Ga0126369_11547204 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300012977|Ga0134087_10596474 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 571 | Open in IMG/M |
3300012984|Ga0164309_10812778 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 754 | Open in IMG/M |
3300013296|Ga0157374_10068651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax | 3335 | Open in IMG/M |
3300013296|Ga0157374_10592862 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
3300014166|Ga0134079_10371147 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 657 | Open in IMG/M |
3300015200|Ga0173480_11220402 | Not Available | 509 | Open in IMG/M |
3300015264|Ga0137403_10495136 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
3300015371|Ga0132258_11103783 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
3300015372|Ga0132256_102497817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. 21-62-4 | 618 | Open in IMG/M |
3300015373|Ga0132257_101299127 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300015374|Ga0132255_101206819 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300015374|Ga0132255_103679920 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 652 | Open in IMG/M |
3300016371|Ga0182034_11311364 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 631 | Open in IMG/M |
3300018072|Ga0184635_10042958 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
3300018431|Ga0066655_11395186 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300018465|Ga0190269_11139361 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 606 | Open in IMG/M |
3300019362|Ga0173479_10051005 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
3300019881|Ga0193707_1191493 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 530 | Open in IMG/M |
3300019886|Ga0193727_1000535 | All Organisms → cellular organisms → Bacteria | 14733 | Open in IMG/M |
3300019887|Ga0193729_1033408 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2156 | Open in IMG/M |
3300019890|Ga0193728_1013660 | All Organisms → cellular organisms → Bacteria | 4078 | Open in IMG/M |
3300020199|Ga0179592_10357701 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300020580|Ga0210403_10033505 | All Organisms → cellular organisms → Bacteria | 4108 | Open in IMG/M |
3300020581|Ga0210399_10952951 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300021078|Ga0210381_10254994 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 625 | Open in IMG/M |
3300021168|Ga0210406_10202278 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
3300021413|Ga0193750_1073388 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300021510|Ga0222621_1025109 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1212 | Open in IMG/M |
3300021560|Ga0126371_11410072 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 827 | Open in IMG/M |
3300025315|Ga0207697_10026973 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
3300025315|Ga0207697_10031671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 2163 | Open in IMG/M |
3300025927|Ga0207687_10669716 | Not Available | 879 | Open in IMG/M |
3300026295|Ga0209234_1188257 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 714 | Open in IMG/M |
3300026331|Ga0209267_1324634 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
3300026332|Ga0209803_1065997 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
3300026536|Ga0209058_1060993 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2079 | Open in IMG/M |
3300026548|Ga0209161_10336587 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 686 | Open in IMG/M |
3300026551|Ga0209648_10094275 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2468 | Open in IMG/M |
3300026557|Ga0179587_10342927 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300027610|Ga0209528_1026017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1292 | Open in IMG/M |
3300027643|Ga0209076_1178306 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300028380|Ga0268265_10616632 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1039 | Open in IMG/M |
3300028536|Ga0137415_10170833 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2004 | Open in IMG/M |
3300028809|Ga0247824_10318909 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 879 | Open in IMG/M |
3300028814|Ga0307302_10572866 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 561 | Open in IMG/M |
3300028878|Ga0307278_10101638 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
3300030844|Ga0075377_11534995 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 738 | Open in IMG/M |
3300030935|Ga0075401_11773217 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300031022|Ga0138301_1859431 | Not Available | 1443 | Open in IMG/M |
3300031122|Ga0170822_16096033 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
3300031122|Ga0170822_16152895 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1487 | Open in IMG/M |
3300031231|Ga0170824_109765027 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 550 | Open in IMG/M |
3300031474|Ga0170818_115644237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
3300032180|Ga0307471_100444854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1434 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.29% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.29% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.63% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.63% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.63% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.63% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.97% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.32% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.32% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.32% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.32% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 1.32% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.66% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.66% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.66% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.66% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.66% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.66% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPINP_00202450 | 2065487018 | Soil | MIKKAMSVTPIVFVMIILLLGFDSTEQVKTARQPNQG |
GPIPI_00216830 | 2088090014 | Soil | MTEGAMSMASIIFVLVILLFGFDSTGQLKTRRKNNYG |
GPIPI_01850120 | 2088090014 | Soil | MIEEAMSITLIICVLVILLFGFDSAGQIKARRQHNYG |
cont_0417.00002540 | 2166559005 | Simulated | MIEEAMSITLIICVLVILLFGFDSAGKVKARRQHNYG |
cont_0028.00005120 | 2166559005 | Simulated | MTEEAMSITPIIFVLLILLFGFGSAEQVKSRRKHNHG |
E41_03423620 | 2170459005 | Grass Soil | MIEEAMSITPIIFVLVILLFGFDSAGQVKTRRKHNYA |
F47_03902640 | 2170459009 | Grass Soil | MIQEAMSITPIIFVLVILLFGFDSAGQVRTQLLASK |
N57_00343940 | 2170459013 | Grass Soil | MTEEAMSITPIIFVLLILLFGFGSAEQVKSRRRHN |
FA3_00306620 | 2170459023 | Grass Soil | MIEQAMSITPIIFVLVILLFGFDLTGQVKARRKHNYG |
FD1_03099000 | 2170459024 | Grass Soil | FLSLTEQAMSITLIICVLVILLFGFDSAGQVKARREHNYG |
INPhiseqgaiiFebDRAFT_1004698611 | 3300000364 | Soil | EAMSITPIVLLLVILLFGFDSTGQLEAGRKHNYG* |
JGI10214J12806_121374293 | 3300000891 | Soil | MEEAMGITAIVFVLIILLFSLDSTGQVKTRQQRNRLRRILR |
JGI1027J12803_1057534652 | 3300000955 | Soil | MTEGAMSMASIIFVLVILLFGFDSTGQLKTRRKNNYG* |
JGI1027J12803_1085904274 | 3300000955 | Soil | SSMSLTPIVFILVILLFGFDSTEQITPGKKTRTF* |
JGIcombinedJ26739_1001211342 | 3300002245 | Forest Soil | MIEEAMTITPIIFVLVILLFGFDSAGQVKTRRKHTYG* |
Ga0066675_102250532 | 3300005187 | Soil | LSMIEEAMSTTLIVFILIILLFGFDATGQVKIRRKHNYD* |
Ga0065705_100592222 | 3300005294 | Switchgrass Rhizosphere | MEEGMGITPIVFALIILLFGFDSIGQVKTRQQRNWLRRVFTVAHMMP* |
Ga0070676_114607442 | 3300005328 | Miscanthus Rhizosphere | PRRGDFLSMIEEAMSITLIIFLLVILLFGFDSTGQVKTHRQHNPG* |
Ga0070662_1002756183 | 3300005457 | Corn Rhizosphere | LSMIEEAMSITLIIFLLVILLFGFDSTGQVKTHRQHNPG* |
Ga0070662_1009059321 | 3300005457 | Corn Rhizosphere | MIEEAMSITPIIFVLIILLFGFDSTGQVKTRRQHNHGYF* |
Ga0066697_101301712 | 3300005540 | Soil | MIEEAMSTTLIVFILIILLFGFDATGQVKIRRKHNYD* |
Ga0066697_104845702 | 3300005540 | Soil | CSDKEAMSITPIIFVLVILLFGFDSAGQVKTRPQHNYG* |
Ga0066701_103683192 | 3300005552 | Soil | MIEEVMSITPIIFLLVILLFGFDSVGQVKTRRQHTQG* |
Ga0066661_109098532 | 3300005554 | Soil | MIEEAMSITPIIFVLVILLFGFDSAEQAKTRQRHNYG* |
Ga0066700_107808991 | 3300005559 | Soil | MSITPIIFVLVILLFGFDSAGQGETRRKHNYGSN* |
Ga0066708_109673141 | 3300005576 | Soil | MIEETMSITPIIFVLVILLFGFDSTGEVKTRRQHNHG* |
Ga0066691_102604041 | 3300005586 | Soil | MIEEAMGMISIIFVLVILVFGFDSAGQVKPHRKHNQG* |
Ga0066706_100790652 | 3300005598 | Soil | MIEETMSTMTIVFVLIILLFGFDSTGQVNTRGQHNHG* |
Ga0066706_102263043 | 3300005598 | Soil | MIEETMSTMTIVFVLIILLFGFDSTGQVKTRRQHNHG* |
Ga0068859_1003586973 | 3300005617 | Switchgrass Rhizosphere | MIEEAMSITLIIFLLVILLFGFDSTGQVKTHRQHNPG* |
Ga0066905_1000423042 | 3300005713 | Tropical Forest Soil | MMEEDMSITAIAFVLIILLLGFDSTGQVKTHRQRN* |
Ga0068858_1003133331 | 3300005842 | Switchgrass Rhizosphere | EQAVSITPIIFLLVILLFGFDSTGQAKTRQQHNHG* |
Ga0070717_100878873 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEEAMSITPIIFLLVILLFGFDSAKQVKTRRQDNYA* |
Ga0066656_111303911 | 3300006034 | Soil | MSITPIIFVLVILLFGFDSAGQVETRRKYNYGSN* |
Ga0066652_1015393412 | 3300006046 | Soil | MIEEAMSITPIIFVLVILLFGFDSTGQVKTRRKHNYG* |
Ga0066652_1020050212 | 3300006046 | Soil | EAMSITPIIFVLVILLFGFDLTGQVKTRRKHNYG* |
Ga0070712_1001260553 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEEAMSITPIIFVLVILLFGFDSTEQVKTRRQHNNG* |
Ga0066665_101292032 | 3300006796 | Soil | MIEEAMSLTPIIFVLVILLFGFDSAGHKTRRQHNHG* |
Ga0066659_100880242 | 3300006797 | Soil | MIEEAMSTMTIVFVLVILLFGFDSTGEAKTRGKNNYG* |
Ga0066659_102924781 | 3300006797 | Soil | LSMIEEAMSITPIIFVLVILLFGFDSAEQAKTRQRHNYG* |
Ga0075428_1018355732 | 3300006844 | Populus Rhizosphere | MEEAMGITLIVFILIILLFGLDPTGQVKTRQQRN* |
Ga0075425_1013311722 | 3300006854 | Populus Rhizosphere | LLIMEEAMGITLIVFILIILLFGLDPTGQVKTRQQRN* |
Ga0075425_1029740881 | 3300006854 | Populus Rhizosphere | MIEEAMSITPIIFVLVILLFGFDSAGQVKTRRKHNYG* |
Ga0099791_100930543 | 3300007255 | Vadose Zone Soil | MIEETMSTMTIVFVLIILLFGFDSTGEVKTRRKHA |
Ga0099791_101598612 | 3300007255 | Vadose Zone Soil | EEAMSITPIIFVLVILLFGFDLTGQVKTRRKHNYG* |
Ga0099793_100851032 | 3300007258 | Vadose Zone Soil | MIEEAMSMISIIFVLVILLFGFDSAGQVKPHRKHNHG* |
Ga0066710_1021607983 | 3300009012 | Grasslands Soil | LSMIEETMSTMTIVFVLIILLFGFDSTGEVKTRRQHNHG |
Ga0066709_1043467862 | 3300009137 | Grasslands Soil | LSMIEETMSTMTIVFVLIILLFGFDSTGQVKTRRQHNHG* |
Ga0114129_115473222 | 3300009147 | Populus Rhizosphere | MIEEDMSITLIVFVLVILLFGFDSTGQVKTRRQHNHG* |
Ga0105242_104178791 | 3300009176 | Miscanthus Rhizosphere | RGDFLSMIEEAMSITPIIFVLIILLFGFDSTGQVKTRRQHNHGYF* |
Ga0134070_100290834 | 3300010301 | Grasslands Soil | MIKEAMSTTPIVFFLIILLFGFDSAGQVKTRREHNYG* |
Ga0134086_100381302 | 3300010323 | Grasslands Soil | MIEETMSTMTIVFVLIILLFGFDSTGQVKTRRKHNYG* |
Ga0126370_111255432 | 3300010358 | Tropical Forest Soil | MIEKAMSATLIVFLLIILLFGFDSTGQVKTRKQHNHG* |
Ga0126378_104646042 | 3300010361 | Tropical Forest Soil | MSEEAMSITAIIFVLVILLFGFDSTEQVNAPPGEVES* |
Ga0134121_118822142 | 3300010401 | Terrestrial Soil | MTEEALSITPIIFLLVILLFGFDSTGQAKTRQQHNHG* |
Ga0137388_115365302 | 3300012189 | Vadose Zone Soil | MIEEAMSITSIIFVLVILLFGFDSTEEVKTRRQHNYG* |
Ga0137364_101726382 | 3300012198 | Vadose Zone Soil | MIEEAMSTMTIIFVLVILLFGFDSAEQAKTRQRHNYG* |
Ga0137382_100192344 | 3300012200 | Vadose Zone Soil | MIEESMSITAIIFVLVILLFGSDSTGQVKTRRQHHHG* |
Ga0137382_101514272 | 3300012200 | Vadose Zone Soil | MIEETMSITPIIFVLVILLFGFDLTGHVKTRRKHNYG* |
Ga0137382_107751682 | 3300012200 | Vadose Zone Soil | RGDFLSMIEETMSITPIIFVLVILLFGFDSAGQAKTRQRHKYG* |
Ga0137363_112262773 | 3300012202 | Vadose Zone Soil | MIEEAMSITPIIFILVILLFGFNSTGQVNARRKHNYG* |
Ga0137363_116809781 | 3300012202 | Vadose Zone Soil | LPVIEQAMSITPIIFVLVILLFGFDSAGQVKPHRKHNGG* |
Ga0137399_102529652 | 3300012203 | Vadose Zone Soil | LSLTEEAMSITPIIFVLVILLFGFDLTGQVKVRRKHNYG* |
Ga0137374_100703482 | 3300012204 | Vadose Zone Soil | MIEEAMSLTPIIFVLVILLFGFDSTGQVKTRRKHNHG* |
Ga0137362_102813693 | 3300012205 | Vadose Zone Soil | MIEEAMSMISIIFVLAILLFGFDLAGQVKPHRKHNHG* |
Ga0137362_116999571 | 3300012205 | Vadose Zone Soil | MTQEAMSITPIIFALVILLFGFDSAGQVKTRRKHNYG* |
Ga0137376_110229122 | 3300012208 | Vadose Zone Soil | EETMSTMTIVFVLIILLFGFDSTGPVEPGRKHTYG* |
Ga0137376_111756122 | 3300012208 | Vadose Zone Soil | SMMEEAMSITPIVFVLVILLFGFDSAGPVKKHQN* |
Ga0137378_115475942 | 3300012210 | Vadose Zone Soil | FLSLTEEAMSITLIICVLVILLFGFDSTRQVKAPRQHNYG* |
Ga0137377_106449231 | 3300012211 | Vadose Zone Soil | MIEEAMSTMTIIFVLVILLFGFDSAEQAETRQRHNYG* |
Ga0137370_100330213 | 3300012285 | Vadose Zone Soil | MIEEAMSTMTIIFVLLILLFGFDSGGQVRTRQHG* |
Ga0137372_100326264 | 3300012350 | Vadose Zone Soil | MIEEAMSITLIIFVLVILLFGFDSTGEVKTRRQHDPD* |
Ga0137386_104713002 | 3300012351 | Vadose Zone Soil | PRRGDFLSMIEEVMSITPIIFLLVILLFGFDSAGQVKTRRKQNYG* |
Ga0137369_105695551 | 3300012355 | Vadose Zone Soil | MMEQAMSITPIIFVLVILLFGFDSAGQAKTRQRHKYG* |
Ga0137368_101882452 | 3300012358 | Vadose Zone Soil | MIEEAMSLTPTIFVLVILLFDCDSTGQVKTRRKHNHG* |
Ga0137385_110173722 | 3300012359 | Vadose Zone Soil | MIEETMSTMTIVFVLVILLFGFDSTAEAKIRRKNNYG* |
Ga0137375_105394771 | 3300012360 | Vadose Zone Soil | MMEQAMSITPIIFVLVILLFGFDSTGQVKTRRKHNYG* |
Ga0137360_103163652 | 3300012361 | Vadose Zone Soil | MIEDAMSTTLIVFVLIILLFGFDSTGEVKTRRQHNHG* |
Ga0137360_118034202 | 3300012361 | Vadose Zone Soil | MIEEAMSITPIIFVLVILLFGFNSTGQIKTRRKHNYD* |
Ga0137360_118892231 | 3300012361 | Vadose Zone Soil | MIEEGMSVTPIIFVLVILLFGFDSTGQVKTRPQHNHG* |
Ga0137373_106496082 | 3300012532 | Vadose Zone Soil | MIEEAMSITPIIFVLVILLFGFDSTGQVKTRRKHNHG* |
Ga0137398_102910253 | 3300012683 | Vadose Zone Soil | FLSMIEEAMSMISIIFVLVILLFGFDSAGQVKPHRKHNHG* |
Ga0137397_105996952 | 3300012685 | Vadose Zone Soil | LSLTEEAMSITPIIFVLVILLFGFDLTGQIKTRRKHNYG* |
Ga0157306_102386461 | 3300012912 | Soil | MEEAMGITAIVFVLIILLFGFDSAGQVNTRPKRNYG* |
Ga0137395_100704992 | 3300012917 | Vadose Zone Soil | MIEEAMSMISIIFVLVIFLFGFDSAGQVKPHRKHNHG* |
Ga0137395_102188661 | 3300012917 | Vadose Zone Soil | MIEEGMSLTPIIFVLVILLFGFDSTEQVRTQLALK |
Ga0137396_110996801 | 3300012918 | Vadose Zone Soil | IEEAMSMISIIFVLVILLFGFDSAGQVKTYRKNNYG* |
Ga0137413_105788682 | 3300012924 | Vadose Zone Soil | MIEEAMSITPIIFVLVILLFGFDSTGQVKARQEHNYS* |
Ga0137404_111445831 | 3300012929 | Vadose Zone Soil | MIEEAMSITPIIFVLVILLFGFDSTGQVKTRRQHNHG* |
Ga0137407_112839711 | 3300012930 | Vadose Zone Soil | SMIEEAVSITPIVFVLIILLFGFDSAGQVKTRRKHTYG* |
Ga0137407_115299911 | 3300012930 | Vadose Zone Soil | PRGGDFLSMIEEAMSITPIIFVLLILLFGFDLAGQVEIPRDHNND* |
Ga0137407_118610181 | 3300012930 | Vadose Zone Soil | IEEAMSITPIIFVLVILLFGFDSAGQVNTRPKHNYG* |
Ga0137407_119728991 | 3300012930 | Vadose Zone Soil | RGRGDFLSMIEEAMSMISIIFVLAILLFGFDLAGQVKPHRKHNHG* |
Ga0164299_114000412 | 3300012958 | Soil | SMIEETMSTMTIVFVLIILLFGFDSTEEVKTRRQHNHG* |
Ga0164301_113390381 | 3300012960 | Soil | MSEEAMSITSIAFFLIILLFGFDSAGQAKTRRKHNYG* |
Ga0164302_101505782 | 3300012961 | Soil | MIEEAMSTTPIVFILISLLFGFDSTGQVEARPKQTYG* |
Ga0126369_105159082 | 3300012971 | Tropical Forest Soil | MEEAMGITLIVFVLIILLFGLDSTEQVKTRQQRN* |
Ga0126369_115472042 | 3300012971 | Tropical Forest Soil | MKEAMGITLIVFVLIILLFGLDSTGQVKARQQRN* |
Ga0134087_105964741 | 3300012977 | Grasslands Soil | MIEEAMSITLIIFVLVILLFGFDWTGQVRTRQHNN |
Ga0164309_108127782 | 3300012984 | Soil | MIEEAMSITPIIFLLVILLFGFDSTGEVKIRRQHEHG* |
Ga0157374_100686512 | 3300013296 | Miscanthus Rhizosphere | MEEAMGITLIVFVLIILLFGLDSTGQVKTRQNRN* |
Ga0157374_105928623 | 3300013296 | Miscanthus Rhizosphere | LPSRGDLLSMIEEAMSITLIIFLLVILLFGFDSTGQVKTHRQHNPG* |
Ga0134079_103711471 | 3300014166 | Grasslands Soil | MIEEAMSITPIIFVLVISLFGFDSTGQVQDPPKTQSRL |
Ga0173480_112204021 | 3300015200 | Soil | GNFLSMIEEAMSITPIIFVLVILLFGFDSTGQVKARRQHNYG* |
Ga0137403_104951362 | 3300015264 | Vadose Zone Soil | SMIEETMSTMTIVFVLIILLFGFDSTGEVKTRRQHNHG* |
Ga0132258_111037831 | 3300015371 | Arabidopsis Rhizosphere | MIEEAMSITPIIFLLVILLFGFDSTGQVKIRRQHNHG* |
Ga0132256_1024978171 | 3300015372 | Arabidopsis Rhizosphere | QAMSAISIIFVLIILLFGFDSAEQVKARRKHNYGSH* |
Ga0132257_1012991271 | 3300015373 | Arabidopsis Rhizosphere | MEEAMGITLIVFVLIILLFGLDSTGQVKTRQQRD* |
Ga0132255_1012068192 | 3300015374 | Arabidopsis Rhizosphere | PRGSDFLSIIKEAMSITPIIFVLVILLFGFDLTGHVEIPRRPQ* |
Ga0132255_1036799202 | 3300015374 | Arabidopsis Rhizosphere | LSMIEEAMSITPIIFLLVILLFGFDSTGKVKTRQQPNHG* |
Ga0182034_113113642 | 3300016371 | Soil | MIEEAMSITLILFVLVILLFGFDSAGQVKARRQHNHG |
Ga0184635_100429582 | 3300018072 | Groundwater Sediment | MIEETMSTMTIVFVLIILLFGCDSTEEVKARQQHNHG |
Ga0066655_113951862 | 3300018431 | Grasslands Soil | MIEEAMSTTLIVFILIILLFGFDATGQVKIRRKHNYD |
Ga0190269_111393612 | 3300018465 | Soil | MIEETMSITPIIFVLVILLFGFDSTEQVKTRRQHNNG |
Ga0173479_100510051 | 3300019362 | Soil | MIEEAMSITPIIFVLVILLFGFDSAGQVKTRRKHNYG |
Ga0193707_11914931 | 3300019881 | Soil | DFLSMIEKAISITPIVLLLIILLFGFDLTGQVETRREHNNG |
Ga0193727_100053512 | 3300019886 | Soil | MIEEAMSIMPIVFVLIILLFGLDSTEEVKTRRQHNNG |
Ga0193729_10334083 | 3300019887 | Soil | LSIIEEAMSITPIIFVLVILLFGFDSAGQINTRPKHNHG |
Ga0193728_10136602 | 3300019890 | Soil | MIEETMSTMTIVFVLIILLFGFDSTGQVKTRRQHNHG |
Ga0179592_103577011 | 3300020199 | Vadose Zone Soil | LSLTEEAMSITPIIFVLVILLFGFDLTGQVKVRRKHNYG |
Ga0210403_100335055 | 3300020580 | Soil | MIEEAMSITPIIFVLVILLFGFNSTGQIKTRRKHNYG |
Ga0210399_109529512 | 3300020581 | Soil | DFFSMIEQAMSITPIIFVLVILLFGFNSTGQIKTRRKHNYG |
Ga0210381_102549941 | 3300021078 | Groundwater Sediment | MIEETMSITPIIFVLVILLFGFDLTEQVETRREHNNG |
Ga0210406_102022783 | 3300021168 | Soil | MIEEAMSITPIIFVLVILLFGFNSAGQIKTRRKHNHG |
Ga0193750_10733882 | 3300021413 | Soil | MEGAMSITPIIFVLVILLFGFDSTGQVKARQEHNYS |
Ga0222621_10251092 | 3300021510 | Groundwater Sediment | MIEEIMNTMTIIFVLVILLFGFDSTAEVKTRRQHNHG |
Ga0126371_114100722 | 3300021560 | Tropical Forest Soil | MSEEAMSITAIIFVLVILLFGFDSTEQVNAPRGEVES |
Ga0207697_100269733 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEEAMSITLIIFLLVILLFGFDSTGQVKTHRQHNPG |
Ga0207697_100316712 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEEAMSITPIIFVLIILLFGFDSTGQVKTRRQHNHGYF |
Ga0207687_106697161 | 3300025927 | Miscanthus Rhizosphere | LSMIEEAMSITPIIFVLIILLFGFDSTGQVKTRRQHNHGYF |
Ga0209234_11882571 | 3300026295 | Grasslands Soil | MIEEAMSLTPIIFVLVILLFGFDSAGHKTRRQHNHG |
Ga0209267_13246342 | 3300026331 | Soil | MIEEAMSITPIIFVLVILLFGFDSAEQAKTRQRHNYG |
Ga0209803_10659972 | 3300026332 | Soil | MIEEAMTITPIIFVFVLIILLFGFDSTGQVKTRRKHNYG |
Ga0209058_10609931 | 3300026536 | Soil | DLLSMIEETMSTMTIVFVLIILLFGFDSTGQVKTRRQHNHG |
Ga0209161_103365872 | 3300026548 | Soil | IIEETMSTMTIVFVLIILLFGFDSTGEVKTRRQHNHG |
Ga0209648_100942755 | 3300026551 | Grasslands Soil | MIEEAVSITPIIFVLVILLFGFDSAGQVNTRPKHNHG |
Ga0179587_103429272 | 3300026557 | Vadose Zone Soil | MIEEAMSITPIIFVLVILLFGFDLTGQVKVRRKHNYG |
Ga0209528_10260173 | 3300027610 | Forest Soil | MIEEAMTITPIIFVLVILLFGFDSAGQVKTRRKHTYG |
Ga0209076_11783062 | 3300027643 | Vadose Zone Soil | MIEEAMSMISIIFVLVILLFGFDSAGQVKPHRKHNHG |
Ga0268265_106166322 | 3300028380 | Switchgrass Rhizosphere | MIEEAMSITAIIFVLVTLLFGFDSAGQVEAGRKHTYG |
Ga0137415_101708334 | 3300028536 | Vadose Zone Soil | ARAGDFLSMIEEAMSMISIIFVLVILLFGFDSAGQVKPHRKHNHG |
Ga0247824_103189092 | 3300028809 | Soil | MIEEAMSITTIIFVLVILLFGFDSAGQVKTRRKNNYG |
Ga0307302_105728661 | 3300028814 | Soil | RRGDFLSMIEETMSITPIIFVLVILLFGFDLTEQVETRREHNNG |
Ga0307278_101016383 | 3300028878 | Soil | LSVIEEAMSITPIIFVLVILLFGFDSVGQAKTRRQHNYG |
Ga0075377_115349952 | 3300030844 | Soil | MTEEAMSITPIIFVLLILLFGFDSAEQVKSRRKHNHG |
Ga0075401_117732171 | 3300030935 | Soil | MIEDAMSTTLIVFVLVILLFGFDSAGQVNTRPKHTHD |
Ga0138301_18594312 | 3300031022 | Soil | MTQEAIHPMRITPIIFALVILLFGCDSAGQVKTRWKHNYG |
Ga0170822_160960332 | 3300031122 | Forest Soil | MIEEAMSITPIVFVLIILLFGFDSTGQVNARRQHNNG |
Ga0170822_161528952 | 3300031122 | Forest Soil | MIEDAMSTTLIVFVLVILLFGFDSTGQVKTRRQHNHG |
Ga0170824_1097650272 | 3300031231 | Forest Soil | LSLTEQAMSLTPIIFVLLILLFGFDSAEQVNSHRKNNHG |
Ga0170818_1156442372 | 3300031474 | Forest Soil | MIEEAMSITAIIFVLVILLFGFDSAAQVNARRKHNYG |
Ga0307471_1004448543 | 3300032180 | Hardwood Forest Soil | MIEEAMTITPIVFVLIILLFGFDSTGEVKTRRQHNHG |
⦗Top⦘ |