| Basic Information | |
|---|---|
| Family ID | F045899 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 43 residues |
| Representative Sequence | ALLDGRLAIGWGDAVAVVVAVALFAGGRWVFLRLSPHFEDFV |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.34 % |
| % of genes from short scaffolds (< 2000 bps) | 93.42 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.684 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (5.263 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.105 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.421 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 78.29 |
| PF14524 | Wzt_C | 5.26 |
| PF08241 | Methyltransf_11 | 1.32 |
| PF13186 | SPASM | 0.66 |
| PF01061 | ABC2_membrane | 0.66 |
| PF00535 | Glycos_transf_2 | 0.66 |
| PF13180 | PDZ_2 | 0.66 |
| PF13091 | PLDc_2 | 0.66 |
| PF13432 | TPR_16 | 0.66 |
| PF00296 | Bac_luciferase | 0.66 |
| PF13489 | Methyltransf_23 | 0.66 |
| PF03062 | MBOAT | 0.66 |
| PF13353 | Fer4_12 | 0.66 |
| PF13649 | Methyltransf_25 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.68 % |
| Unclassified | root | N/A | 1.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_143590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 594 | Open in IMG/M |
| 3300000506|Soeholt_1058388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1089 | Open in IMG/M |
| 3300001593|JGI12635J15846_10391984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 840 | Open in IMG/M |
| 3300004091|Ga0062387_101620543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300004156|Ga0062589_102526143 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005179|Ga0066684_10331363 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300005328|Ga0070676_11524022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300005329|Ga0070683_101952585 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005366|Ga0070659_100374868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1198 | Open in IMG/M |
| 3300005367|Ga0070667_101929258 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005451|Ga0066681_10200348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1194 | Open in IMG/M |
| 3300005459|Ga0068867_101742715 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005518|Ga0070699_100147716 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
| 3300005544|Ga0070686_101264367 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005544|Ga0070686_101665470 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005548|Ga0070665_101924751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300005553|Ga0066695_10071794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2093 | Open in IMG/M |
| 3300005578|Ga0068854_100969572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
| 3300005598|Ga0066706_10654630 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005614|Ga0068856_101960961 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005616|Ga0068852_100176416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2007 | Open in IMG/M |
| 3300005617|Ga0068859_101817597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300005618|Ga0068864_102175639 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005764|Ga0066903_102933594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 925 | Open in IMG/M |
| 3300005842|Ga0068858_101713658 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005844|Ga0068862_100382111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1314 | Open in IMG/M |
| 3300006175|Ga0070712_101611826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 568 | Open in IMG/M |
| 3300006578|Ga0074059_10548364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300006755|Ga0079222_11792260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300006844|Ga0075428_101016949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300006904|Ga0075424_102603635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300006950|Ga0075524_10375908 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006954|Ga0079219_10396425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 912 | Open in IMG/M |
| 3300009091|Ga0102851_10057693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3159 | Open in IMG/M |
| 3300009101|Ga0105247_10306056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1104 | Open in IMG/M |
| 3300009148|Ga0105243_11162975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 783 | Open in IMG/M |
| 3300009177|Ga0105248_13402399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300009870|Ga0131092_10249914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1783 | Open in IMG/M |
| 3300010046|Ga0126384_12074313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300010301|Ga0134070_10358728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300010329|Ga0134111_10555485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300010343|Ga0074044_10625553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300010357|Ga0116249_11179667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300010361|Ga0126378_10701520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1124 | Open in IMG/M |
| 3300010366|Ga0126379_11053357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 919 | Open in IMG/M |
| 3300010376|Ga0126381_100943680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1243 | Open in IMG/M |
| 3300010398|Ga0126383_11308943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300010399|Ga0134127_12750122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300012039|Ga0137421_1252918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 510 | Open in IMG/M |
| 3300012045|Ga0136623_10149557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1012 | Open in IMG/M |
| 3300012187|Ga0136622_10268553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300012208|Ga0137376_10427212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1151 | Open in IMG/M |
| 3300012210|Ga0137378_11372960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300012285|Ga0137370_10540329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300012351|Ga0137386_10733416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300012353|Ga0137367_11073181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 545 | Open in IMG/M |
| 3300012903|Ga0157289_10431041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300012929|Ga0137404_12203968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300012930|Ga0137407_11326025 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 684 | Open in IMG/M |
| 3300012957|Ga0164303_10621458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300012957|Ga0164303_11229893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300012972|Ga0134077_10341258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300012976|Ga0134076_10581166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300012988|Ga0164306_10474143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 957 | Open in IMG/M |
| 3300013104|Ga0157370_10239137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1680 | Open in IMG/M |
| 3300013104|Ga0157370_10857380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 825 | Open in IMG/M |
| 3300013105|Ga0157369_10547241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1196 | Open in IMG/M |
| 3300013307|Ga0157372_10733200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1149 | Open in IMG/M |
| 3300013308|Ga0157375_12353205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300013308|Ga0157375_13159306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 549 | Open in IMG/M |
| 3300014056|Ga0120125_1190290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300014321|Ga0075353_1192048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300014326|Ga0157380_11933973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300015193|Ga0167668_1088821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300015371|Ga0132258_10239898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4423 | Open in IMG/M |
| 3300015372|Ga0132256_101258029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 853 | Open in IMG/M |
| 3300015373|Ga0132257_101789635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300015373|Ga0132257_102336327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300015374|Ga0132255_100926351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1304 | Open in IMG/M |
| 3300015374|Ga0132255_103898940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300016404|Ga0182037_10992976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300016445|Ga0182038_10457548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1081 | Open in IMG/M |
| 3300017930|Ga0187825_10427360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 512 | Open in IMG/M |
| 3300017959|Ga0187779_10431616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 863 | Open in IMG/M |
| 3300017973|Ga0187780_11068256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300018060|Ga0187765_11089866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300018064|Ga0187773_11087463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300018076|Ga0184609_10527857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300018081|Ga0184625_10097513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1516 | Open in IMG/M |
| 3300020061|Ga0193716_1200665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300021080|Ga0210382_10030029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2037 | Open in IMG/M |
| 3300021478|Ga0210402_11221466 | Not Available | 679 | Open in IMG/M |
| 3300021560|Ga0126371_10685160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1173 | Open in IMG/M |
| 3300024177|Ga0247686_1010000 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1006 | Open in IMG/M |
| 3300025321|Ga0207656_10288974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300025898|Ga0207692_10468252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300025899|Ga0207642_10988773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300025906|Ga0207699_11160101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300025913|Ga0207695_11595440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 533 | Open in IMG/M |
| 3300025921|Ga0207652_10019808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5538 | Open in IMG/M |
| 3300025924|Ga0207694_10754135 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300025924|Ga0207694_11747240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300025931|Ga0207644_10108667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2094 | Open in IMG/M |
| 3300025931|Ga0207644_10849062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 764 | Open in IMG/M |
| 3300025938|Ga0207704_11662887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300025944|Ga0207661_10440491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1186 | Open in IMG/M |
| 3300025972|Ga0207668_10521529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1025 | Open in IMG/M |
| 3300025981|Ga0207640_11651122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300026023|Ga0207677_10555137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1002 | Open in IMG/M |
| 3300026023|Ga0207677_10792767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 848 | Open in IMG/M |
| 3300026035|Ga0207703_11608005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300026088|Ga0207641_10730837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 976 | Open in IMG/M |
| 3300026089|Ga0207648_11559659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300026095|Ga0207676_10033799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3867 | Open in IMG/M |
| 3300026116|Ga0207674_12220017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300026142|Ga0207698_11773040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300026310|Ga0209239_1311578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300026330|Ga0209473_1103605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1188 | Open in IMG/M |
| 3300026548|Ga0209161_10270774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 860 | Open in IMG/M |
| 3300027614|Ga0209970_1024953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1023 | Open in IMG/M |
| 3300027979|Ga0209705_10047217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 2380 | Open in IMG/M |
| 3300028381|Ga0268264_11875838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300028743|Ga0302262_10124448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 884 | Open in IMG/M |
| 3300030002|Ga0311350_11332571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300031231|Ga0170824_111385232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
| 3300031713|Ga0318496_10417501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300031824|Ga0307413_11330794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300031834|Ga0315290_10787756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 814 | Open in IMG/M |
| 3300031834|Ga0315290_10833341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300031894|Ga0318522_10118367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 989 | Open in IMG/M |
| 3300031912|Ga0306921_11929200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300031938|Ga0308175_102060579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300031939|Ga0308174_11191981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300032005|Ga0307411_11915435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300032143|Ga0315292_10267520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1417 | Open in IMG/M |
| 3300032173|Ga0315268_12324092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300032180|Ga0307471_104053805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300032205|Ga0307472_102363151 | Not Available | 539 | Open in IMG/M |
| 3300032256|Ga0315271_10602562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 939 | Open in IMG/M |
| 3300032256|Ga0315271_11639383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300032401|Ga0315275_12180880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300032421|Ga0310812_10258722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300033412|Ga0310810_11240123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300033418|Ga0316625_100957936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300033418|Ga0316625_102254972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300033419|Ga0316601_100665105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1019 | Open in IMG/M |
| 3300033475|Ga0310811_11400776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300033487|Ga0316630_11554325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300033513|Ga0316628_102978826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300033803|Ga0314862_0014822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1454 | Open in IMG/M |
| 3300034129|Ga0370493_0068267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1114 | Open in IMG/M |
| 3300034177|Ga0364932_0333277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 573 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.26% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.97% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.32% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.32% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.32% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.32% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.66% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.66% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.66% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.66% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.66% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.66% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.66% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.66% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.66% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.66% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.66% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.66% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.66% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.66% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.66% |
| Anaerobic Digester | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000506 | Anaerobic digester microbial communities from Northern Denmark, sample from Soeholt sludge | Engineered | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_02627030 | 2199352024 | Soil | LTPTWNDAAAAVTAVLLLLAGRWLFRRLSPHFEDFI |
| Soeholt_10583881 | 3300000506 | Anaerobic Digester | IAPEAGDLAALVVALALFAAGRWTFRRLSPHFEDFV* |
| JGI12635J15846_103919841 | 3300001593 | Forest Soil | SLALHWGDAVAVIVALALFVAGRWVFLRLSPHFEDFV* |
| Ga0062387_1016205432 | 3300004091 | Bog Forest Soil | ALLDGRLGLEWGDAVAAGVAVALFAAGRWMFRRLSPHFEDFV* |
| Ga0062589_1025261431 | 3300004156 | Soil | VGRLREGFLEGRMAPQWSDAVALVVAVLLFLGGRWVFRRLSPHFEDFV* |
| Ga0066684_103313632 | 3300005179 | Soil | GRLRDALLDGRLELYWGDGLALAVAIAVFCAGRWIFRRLSPHFEDFV* |
| Ga0070676_115240221 | 3300005328 | Miscanthus Rhizosphere | RMRDALLEGHLALQWGDALAAMVALALFAAGRALFVRLSPHFEDFVG* |
| Ga0070683_1019525851 | 3300005329 | Corn Rhizosphere | ARLREALLEGRIAFHASDAVALVVALLLLAGGHWVFRRLSPHFEDFV* |
| Ga0070659_1003748681 | 3300005366 | Corn Rhizosphere | DGRLALEPSDAIALVVAVLIFLAGRWMFRRLSPYFEDFL* |
| Ga0070667_1019292582 | 3300005367 | Switchgrass Rhizosphere | EGRLALQWGDAIAVAVAVALYFGGLWVFRRLSPHFEDFV* |
| Ga0066681_102003482 | 3300005451 | Soil | WIVGRLRDALLDGRLAIDWTDGIALGVALLLFFAGRAVFRRLSPHFEDFV* |
| Ga0068867_1017427152 | 3300005459 | Miscanthus Rhizosphere | REALIDGRLALEWGDGVAAVVAIALYLGGRWVFRRLSPHFEDFV* |
| Ga0070699_1001477161 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RLREALLDGRIVFRWSDLLALIVALALFAGGRWVFRRLSPHFEDFV* |
| Ga0070686_1012643671 | 3300005544 | Switchgrass Rhizosphere | ALLDGRLALHWGDAVALVAALLLFFAGRWVFRRLSPHFEDFL* |
| Ga0070686_1016654702 | 3300005544 | Switchgrass Rhizosphere | LDGRLALEWGDAVAVVVALAIFAGGQWVFRRLSPQFEDFV* |
| Ga0070665_1019247511 | 3300005548 | Switchgrass Rhizosphere | ALLDGKIAFEWQDAVALAVSLALFALGRAVFQRLSPHFEDFV* |
| Ga0066695_100717943 | 3300005553 | Soil | DGKLTLDWGDAVAVVVAVAIFALGRWVFLRLSPYFEDFV* |
| Ga0068854_1009695721 | 3300005578 | Corn Rhizosphere | PFGWIVARLREALLDGRLAVHASDAIALVVALLLFTGGRWVFRRLSPHFEDFV* |
| Ga0066706_106546301 | 3300005598 | Soil | LRDALLDGSLALHWGDAVAVIVALALFVGGRWVFLRLSPHFEDFV* |
| Ga0068856_1019609611 | 3300005614 | Corn Rhizosphere | ARLRESLLDGQLRLHASDAVALAVALLLFAGGRWVFRRLSPHFEDFV* |
| Ga0068852_1001764161 | 3300005616 | Corn Rhizosphere | LIDGRLGFEWGDAIAAIGAIALYLAGRWVFRRLSPHFEDFV* |
| Ga0068859_1018175972 | 3300005617 | Switchgrass Rhizosphere | RLAPEPGDFVALAVAVALFVAGRWMFRRLSPYFEDFV* |
| Ga0068864_1021756391 | 3300005618 | Switchgrass Rhizosphere | GRLALEWGDAVAAIVAVALYLGGLWVFRRLSPHFEDFV* |
| Ga0066903_1029335941 | 3300005764 | Tropical Forest Soil | RDALLEGRLELMPGDAIAVLAALALFFAGRVVFRRLSPSFEDFV* |
| Ga0068858_1017136581 | 3300005842 | Switchgrass Rhizosphere | GRLREALIDGRLALEWGDGVAAVVAIALYLGGRWVFRRLSPHFEDFV* |
| Ga0068862_1003821111 | 3300005844 | Switchgrass Rhizosphere | LEGNLAARPGDAVALAVAIALFFGGRWVFRRLSPHFEDFL* |
| Ga0070712_1016118262 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VVARLREALLDGQLGVHPSDVVAVAVALLLFAGGRWVFRRLSPHFEDFV* |
| Ga0074059_105483641 | 3300006578 | Soil | CLLDGHLALEWEDAIALAVALAVFAAGCWVFRRLTPQFEDFV* |
| Ga0079222_117922602 | 3300006755 | Agricultural Soil | VSRLRDAFIEGRLAPSASDAVALIIAVIVFLVGRWVFRRLSPHFEDFV* |
| Ga0075428_1010169492 | 3300006844 | Populus Rhizosphere | ALQWSDALAALVAVALFVAGLTVFRRLSPHFEDFVG* |
| Ga0075424_1026036352 | 3300006904 | Populus Rhizosphere | LVGRLRDALLDGQLALRWSDAVATLVALAVFFAGRAVFQRLSPHFEDFVG* |
| Ga0075524_103759082 | 3300006950 | Arctic Peat Soil | VLEWSDGLALLVAIIVFVGGRWMFRRLSPHFEDFI* |
| Ga0079219_103964251 | 3300006954 | Agricultural Soil | LALDWSDAAALAIALLLLVAGRAVFRRLSPHFEDFV* |
| Ga0102851_100576931 | 3300009091 | Freshwater Wetlands | LEGRIAPQWSDAVAVAVALALFAGGLWMFRRLSPYFEDFV* |
| Ga0105247_103060561 | 3300009101 | Switchgrass Rhizosphere | VAAIPFGWLVGRLRDALLDGHLALQPGDAVAALIAAAIFAAGLTVFRRLSPHFEDFVG* |
| Ga0105243_111629753 | 3300009148 | Miscanthus Rhizosphere | EGRLSLQPSDALAVAISIALFVAGRWVFRRLSPHFEDFV* |
| Ga0105248_134023992 | 3300009177 | Switchgrass Rhizosphere | PWVAFNPFGWLVTRMRDALLDGHLALQGGDALAALVAVAIFAAGRALFLRLSPHFEDLVG |
| Ga0131092_102499143 | 3300009870 | Activated Sludge | LAFDWSDAVALAVALALYFGGRWVFRRLSPHFEDFI* |
| Ga0126384_120743132 | 3300010046 | Tropical Forest Soil | MRDALLEGRLALSWGDGVAVLVAAALFAGGRWVFLRLSPHFEDFV* |
| Ga0134070_103587282 | 3300010301 | Grasslands Soil | RLAIAWGDVVAVVVAVALFAGGRWVFLRLSPHFEDFV* |
| Ga0134111_105554852 | 3300010329 | Grasslands Soil | ERLRDALLEGRLAIGWGDAVAVVVAVALFAGGRGVCLRLSPHFEEFV* |
| Ga0074044_106255532 | 3300010343 | Bog Forest Soil | GRLRDALLDGRLALHWADAVAVVVALGLLAGGRWIFLRLSPHFEDFV* |
| Ga0116249_111796671 | 3300010357 | Anaerobic Digestor Sludge | LEGRISFEVGDLAALAVALALFAAGRWMFVRLSPHFEDFV* |
| Ga0126378_107015202 | 3300010361 | Tropical Forest Soil | AANPFGWLVERLRDALLEGRLELMRGDAIAVLAALALFFAGRVVFRRLSPSFEDFV* |
| Ga0126379_110533572 | 3300010366 | Tropical Forest Soil | DGRLDVGAGDALAVIVALALFAGGRWIFLRLSPHFEDFV* |
| Ga0126381_1009436802 | 3300010376 | Tropical Forest Soil | DGRVAARVGDAVALAVALALFFAGRWVFRRLSPYFEDFV* |
| Ga0126383_113089432 | 3300010398 | Tropical Forest Soil | LSIGASDAVAVALAVALFFGGRWVFRRLSPTFEDFL* |
| Ga0134127_127501221 | 3300010399 | Terrestrial Soil | LIDGRLAFTAGDALALAIALVLFVAGRWVFRRLSPHFEDFV* |
| Ga0137421_12529182 | 3300012039 | Soil | LREALLEGRLAPRWGDAVALAAALALYFAGRWVFRRLSPHFEDFL* |
| Ga0136623_101495572 | 3300012045 | Polar Desert Sand | LIGRLRDALLEGKLALAWSDAVAVIAAAAIFFAGRWVFRRLSPQFEDFV* |
| Ga0136622_102685532 | 3300012187 | Polar Desert Sand | LRDALLDGKLALVWSDAVAVIAAVAIFFAGRWVFRRLSPQFEDFV* |
| Ga0137376_104272122 | 3300012208 | Vadose Zone Soil | LVDRLRDALLDGSLALHWGDAVAVIVALALFVAGRWVFLRLSPHFEDFV* |
| Ga0137378_113729601 | 3300012210 | Vadose Zone Soil | LAIGWGDAVAVGAAVALFVGGRWVFLRLSPHFEDFV* |
| Ga0137370_105403292 | 3300012285 | Vadose Zone Soil | GYLVDRLRDALLDGSLALHWGDAVAVIVALALFVGGRWVFLRLSPHFEDFV* |
| Ga0137386_107334161 | 3300012351 | Vadose Zone Soil | GRLAVHWGDAVAVVVALALFAGGRWIFLRLSPHFEDFV* |
| Ga0137367_110731812 | 3300012353 | Vadose Zone Soil | ALHWGDAVALTAALAIFFAGRWVFRRLSPHFEDFV* |
| Ga0157289_104310411 | 3300012903 | Soil | RDALIDGRIALQWSDAVALGVALALFFGGRWVFARLSPHFEDFL* |
| Ga0137404_122039681 | 3300012929 | Vadose Zone Soil | NPFSWLVDRLREALLDGRMTFEWTDGVALLAALAVFAAGRAMFVRLSPHFEDFV* |
| Ga0137407_113260252 | 3300012930 | Vadose Zone Soil | AGLLDGRLAFELGDLAAALVAVALFFGGRWVFRRLSPTFEDFL* |
| Ga0164303_106214583 | 3300012957 | Soil | DGLLEGRLSLQPSDALAVAISIALFVAGRWVFRRLSPHFEDFV* |
| Ga0164303_112298932 | 3300012957 | Soil | LDGRLGLVWGDALAVVVALALFAAGRWVFLRLSPHFEDFV* |
| Ga0134077_103412582 | 3300012972 | Grasslands Soil | ALLDGRLAIGWGDAVAVVVAVALFAGGRWVFLRLSPHFEDFV* |
| Ga0134076_105811661 | 3300012976 | Grasslands Soil | RLRDSLLDGKLALQWSDAIALIVALLIFAAGRAVFRRLSPHFEDFI* |
| Ga0164306_104741432 | 3300012988 | Soil | GRLSLQPSDALAVAISIALFVAGRWVFRRLSPHFEDFV* |
| Ga0157370_102391373 | 3300013104 | Corn Rhizosphere | APHWTDVIAMAVALLLFAGGRFVFRRLSPHFEDFV* |
| Ga0157370_108573801 | 3300013104 | Corn Rhizosphere | AANPFGWIVARLREALLDGRLAVHASDAIALVVALLLFTGGRWVFRRLSPHFEDFV* |
| Ga0157369_105472412 | 3300013105 | Corn Rhizosphere | AFVAANPFGWIVARLREALLDGRLAVHASDAIALVVALLLFTGGRWVFRRLSPHFEDFV* |
| Ga0157372_107332001 | 3300013307 | Corn Rhizosphere | LEWSDALALAVALALFAGGRWVFRRLSPHFEDFV* |
| Ga0157375_123532052 | 3300013308 | Miscanthus Rhizosphere | LVGRLRDALLEGKLLVQWDDALAVVVALVLFHAGRWVFRRLSPHFEDFV* |
| Ga0157375_131593061 | 3300013308 | Miscanthus Rhizosphere | LLEGRLSLQPSDALAVAISIALFVAGRWVFRRLSPHFEDFV* |
| Ga0120125_11902902 | 3300014056 | Permafrost | RAVSAFVVALVVALALFVGGRWLFRRLSPHFEDFV* |
| Ga0075353_11920481 | 3300014321 | Natural And Restored Wetlands | NPFSWLVDRLRDALIDGRVALHWGDALALVVALALFGAGRWMFRRLSRHFEDFV* |
| Ga0157380_119339732 | 3300014326 | Switchgrass Rhizosphere | DGRLALEWGDGVAAVVAIALYLGGRWVFRRLSPHFEDFV* |
| Ga0167668_10888211 | 3300015193 | Glacier Forefield Soil | RLRDALLDGRLALQWGDAMAVIVALALFVAGRWVFLRLSPHFEDFV* |
| Ga0132258_102398984 | 3300015371 | Arabidopsis Rhizosphere | RLSLQPSDALAVAISIALFVAGRWVFRRLSPHFEDFV* |
| Ga0132256_1012580291 | 3300015372 | Arabidopsis Rhizosphere | RLRDALLDGRLGLAWSDALAVVVALAMFAAGRWVFLRLSPHFEDFV* |
| Ga0132257_1017896352 | 3300015373 | Arabidopsis Rhizosphere | VTRLREALLDGNLTLRSGDVLALFIACAIFVAGRWVFMRLSPHFEDFV* |
| Ga0132257_1023363272 | 3300015373 | Arabidopsis Rhizosphere | FGWLVGRLRDGLLDGNVALQGSDAVALLAAVALFVAGRAFFRRLSPHFEDFV* |
| Ga0132255_1009263512 | 3300015374 | Arabidopsis Rhizosphere | RDALLEGRLALGWGDAVAVVVAAGLFLGGRWVFLRLSPHFEDFV* |
| Ga0132255_1038989401 | 3300015374 | Arabidopsis Rhizosphere | GNVAPRAGDAVALAVALAVFFGGRWVFRRLSPHFEDFL* |
| Ga0182037_109929762 | 3300016404 | Soil | LSIGVGDLAAAVVVVALFFGGRWVFRRLSPTFEDFL |
| Ga0182038_104575482 | 3300016445 | Soil | GRLELMPGDGIAVLVALALFFAGRVVFRRLSPHFEDFV |
| Ga0187825_104273601 | 3300017930 | Freshwater Sediment | RLREALLEGRLAVHPTDAIALAVALLLFAGGRWVFRRLSPHFEDFV |
| Ga0187779_104316162 | 3300017959 | Tropical Peatland | LLDGRLAVSWRDAVALAVALAIFAGGRWMFLRLSPHFEDFV |
| Ga0187780_110682562 | 3300017973 | Tropical Peatland | ALLEGRLALGWGDAVALAVALAVFAAGRWMFLRLSPHFEDFA |
| Ga0187765_110898661 | 3300018060 | Tropical Peatland | GRLAVHGSDALAVLAAVLIFAGGRWIFLRLSPHFEDFV |
| Ga0187773_110874632 | 3300018064 | Tropical Peatland | ANPFGYLVDRLRDALLDGRLAIHGSDAVAVLAAVLIFAGGRWVFLRLSPHFDDFV |
| Ga0184609_105278572 | 3300018076 | Groundwater Sediment | AVYWGDAIAVVVAIALFAGGRWIFLRLSPHFEDFV |
| Ga0184625_100975133 | 3300018081 | Groundwater Sediment | RDALLDGRLAVHWGDAVAVVVAIALFAGGRWIFLRLSPHFEDFV |
| Ga0193716_12006652 | 3300020061 | Soil | RDALLDGRLGFTGGDLVALLVALLLFAGGRWVFRRLSPHFEDFV |
| Ga0210382_100300294 | 3300021080 | Groundwater Sediment | ALQWGDAVAVIVALALFVAGRWVFLRLSPHFEDFV |
| Ga0210402_112214662 | 3300021478 | Soil | VDRLRDALLNGSLALHWGDAVALIVALALFVAGRWVFLRLSPHFEDFV |
| Ga0126371_106851601 | 3300021560 | Tropical Forest Soil | FGYLVDRLRDALLEGRLAVEWGDAVAVVVALSIFAAGRWMFLRLSPHFEDFV |
| Ga0247686_10100002 | 3300024177 | Soil | PLVPGDALAALGCVAVFAGGLWVFQRLSPHFEDFL |
| Ga0207656_102889742 | 3300025321 | Corn Rhizosphere | RLRDGLLEGRVALRWSDAVALVVAVLLFFGGRWVFRRLSPHFEDFV |
| Ga0207692_104682522 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | NPFNWVVARLREALLDGQLGVHPSDVVAVAVALLLFAGGRWVFRRLSPHFEDFV |
| Ga0207642_109887732 | 3300025899 | Miscanthus Rhizosphere | IALQWSDAVALCVALALFFGGRWVFARLSPHFEDFL |
| Ga0207699_111601012 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GRLGLVQGDAAAIVVALALFAAGRWVFLRLSPHFEDFV |
| Ga0207695_115954401 | 3300025913 | Corn Rhizosphere | LEGRIAFHASDAVALVVALLLLAGGHWVFRRLSPHFEDFV |
| Ga0207652_100198081 | 3300025921 | Corn Rhizosphere | DGRLALEPADAVALAGALVAFVGGRWMFRRLSPHFEDFL |
| Ga0207694_107541352 | 3300025924 | Corn Rhizosphere | ARLREALLDGRLAVHASDAIALVVALLLFTGGRWVFRRLSPHFEDFV |
| Ga0207694_117472402 | 3300025924 | Corn Rhizosphere | LVGRLRDALLDGRLGLAWSDALAVVVALAMFAAGRWVFLRLSPHFEDFV |
| Ga0207644_101086671 | 3300025931 | Switchgrass Rhizosphere | LGLAWSDALAVIVALSMFAAGRWVFLRLSPHFEDFV |
| Ga0207644_108490621 | 3300025931 | Switchgrass Rhizosphere | LREALLDGGLALHWGDAVALVAALLLFFAGRWVFRRLSPHFEDFL |
| Ga0207704_116628872 | 3300025938 | Miscanthus Rhizosphere | ALEWGDAIALVVAVAVYFGGRWVFRRLSPHFEDFV |
| Ga0207661_104404912 | 3300025944 | Corn Rhizosphere | GRLRDALLEGRLELRPSDALATAIAVLLFIAGRWVFRRLSPHFEDFV |
| Ga0207668_105215291 | 3300025972 | Switchgrass Rhizosphere | GRLALEWGDAVAVVVALAIFAGGQWVFRRLSPQFEDFV |
| Ga0207640_116511221 | 3300025981 | Corn Rhizosphere | DGKLALDWSDAAALAIALLVLVAGRAVFRRLSPHFEDFV |
| Ga0207677_105551371 | 3300026023 | Miscanthus Rhizosphere | LEGRLELRPSDALATAIAVLLFIAGRWVFRRLSPHFEDFV |
| Ga0207677_107927672 | 3300026023 | Miscanthus Rhizosphere | VGRLREALIDGRLALEWGDGVAAVVAIALYLGGRWVFRRLSPHFEDFV |
| Ga0207703_116080051 | 3300026035 | Switchgrass Rhizosphere | LVGRLREALIDGRLALEWGDGVAAVVAIALYLGGRWVFRRLSPHFEDFV |
| Ga0207641_107308371 | 3300026088 | Switchgrass Rhizosphere | RLGLEWGDAIAVAVAVALYFGGRWVFRRLSPHFEDFV |
| Ga0207648_115596591 | 3300026089 | Miscanthus Rhizosphere | FSWLVGRLREALIDGRLALEWGDGVAAVVAIALYLGGRWVFRRLSPHFEDFV |
| Ga0207676_100337991 | 3300026095 | Switchgrass Rhizosphere | EALLEGRLAVHLSDGIAVVVAVALLLAGLAIFRRLSPHFEDFV |
| Ga0207674_122200171 | 3300026116 | Corn Rhizosphere | GFEAGDLLALLVVAALFFGGRWVFRRLSPTFEDFL |
| Ga0207698_117730402 | 3300026142 | Corn Rhizosphere | LVGRLRDALLDGRLAVHLDDAIAVVVAALMLAGGRWMFRRLSPHFEDFL |
| Ga0209239_13115781 | 3300026310 | Grasslands Soil | SLAVHWGDAVAVVVALALFVAGRWVFLRLSPHFEDFV |
| Ga0209473_11036052 | 3300026330 | Soil | RLRDALLDGRLALAWGDAIAVLAAFALFTGGRWVFLRLSPHFEDFV |
| Ga0209161_102707741 | 3300026548 | Soil | GWLVDRLRSALLDGNLTLEWSDGVAVIVAVMLFVTGRAVFARLSPHFEDFV |
| Ga0209970_10249532 | 3300027614 | Arabidopsis Thaliana Rhizosphere | FLEGRIAPRWSDAVALVVAVLLFFGGRWVFRRLSPHFEDFV |
| Ga0209705_100472171 | 3300027979 | Freshwater Sediment | PFGWLVERMRDALIAGRPALEWGDAVAVLVAAALFAAGLAVFRRLSPHFEDFV |
| Ga0268264_118758381 | 3300028381 | Switchgrass Rhizosphere | ANPFGWLVSRMRDALLEGRLALQWGDALAALVALALFAAGRALFLRLSPHFEDFVG |
| Ga0302262_101244482 | 3300028743 | Fen | DGRLALQWGDAVALAVAAAMFLAGRWIFRRLSPNFEDFV |
| Ga0311350_113325711 | 3300030002 | Fen | GRLAPHWGDAVAVAAALALFFAGRWVFRRLSPHFEDFL |
| Ga0170824_1113852322 | 3300031231 | Forest Soil | VRMRDALLDGNLEPRWQDFAALVAALALWAAGRWIFLRLSPHFEDFI |
| Ga0318496_104175011 | 3300031713 | Soil | ALLEGRLELMPGDGIAVLVALALFFAGRVVFRRLSPHFEDFV |
| Ga0307413_113307941 | 3300031824 | Rhizosphere | GMLAFRWSDVVALLCAGVLFFAGRWVFRRLSPHFEDFV |
| Ga0315290_107877562 | 3300031834 | Sediment | APQWGDVVALAAVLALFFAGRWVFRRLSPHFEDFL |
| Ga0315290_108333411 | 3300031834 | Sediment | LLDGKLALQWGDAVALGVALALFLGGRWVFRRLSPHFEDFL |
| Ga0318522_101183672 | 3300031894 | Soil | FGWLVERLRDALLEGRLELMPGDGIAVLVALALFFAGRVVFRRLSPHFEDFV |
| Ga0306921_119292001 | 3300031912 | Soil | LVERMRDALLDGHLALSWGDGVAVLVAAALFAGGRWIFMRLSPHFEDFV |
| Ga0308175_1020605791 | 3300031938 | Soil | RLAVQLDDLVAVVVAALLLAGGRWMFRRLSPHFEDFL |
| Ga0308174_111919811 | 3300031939 | Soil | GRLRDALLDGRLSLQPSDAIALVVAVALFFIGRWVFRRLSPHFEDFV |
| Ga0307411_119154352 | 3300032005 | Rhizosphere | GLLEGRLALRVSDAVALGVALLLLVGGRWVFRRLSPYFEDFV |
| Ga0315292_102675201 | 3300032143 | Sediment | EGVLVPRWSDAVALVVALALYFAGRWVFRRLAPHFEDFL |
| Ga0315268_123240921 | 3300032173 | Sediment | VERMRDSLLDGSLALQWGDALALAVALALFAGGRWVFRRLSRHFEDFV |
| Ga0307471_1040538051 | 3300032180 | Hardwood Forest Soil | GRLAVGWEDAVAVLVAVALFAGGRWMFLRLSPHFEDFV |
| Ga0307472_1023631511 | 3300032205 | Hardwood Forest Soil | GRLRDALLDGKVGLHWDDGVAVIVAVALFIAGGAVFRRLSPHFEDFV |
| Ga0315271_106025622 | 3300032256 | Sediment | RMRDALLDGSVAPQWGDAAAVLVAAALFGAGLWVFRRLSPNFEDFV |
| Ga0315271_116393832 | 3300032256 | Sediment | DGKLAPQWGDAVALAAALALFFAGRWVFRRLSPQFEDFV |
| Ga0315275_121808801 | 3300032401 | Sediment | LAPRAGDALALAVALALFFAGRWVFRRLSPQFEDFV |
| Ga0310812_102587222 | 3300032421 | Soil | MRDALLDGHLALVPADALALVVALLVFLAGRWMFRRLSPHFEDFL |
| Ga0310810_112401232 | 3300033412 | Soil | WAVTRLRDALLEGRLAPHWTDVIAMAVALLLFAGGRFVFRRLSPHFEDFV |
| Ga0316625_1009579362 | 3300033418 | Soil | DRLRAGLLDGRLALGWGDALVCAVAAALFFGGRWVFRRLSPHFEDFL |
| Ga0316625_1022549721 | 3300033418 | Soil | ALLDGQVLPRWSDAVALGVAVVLFVAGRWVFRRLSPHFEDFV |
| Ga0316601_1006651052 | 3300033419 | Soil | DGKLALEWTDAVAVAVALALFMAGRWVFRRLSPHFEDFV |
| Ga0310811_114007761 | 3300033475 | Soil | VVGRLRDALLDGRLTLQPTDALALAVAIALFVGGRWVFRRLSPHFEDFV |
| Ga0316630_115543252 | 3300033487 | Soil | GRLGLHWDDAAAAAVAIAVFAAGRAVFRRLSPHFEDFV |
| Ga0316628_1029788261 | 3300033513 | Soil | RMREALIEGRLGLQWSDAAAVLVAVAMFAAGRAVFLRLSPHFEDFV |
| Ga0314862_0014822_1315_1452 | 3300033803 | Peatland | LRDALLDGKLAVGWGDALAVAAALALFAGGRWVFLRLSPHFEDFV |
| Ga0370493_0068267_1001_1114 | 3300034129 | Untreated Peat Soil | KLAVHAGDALAIVVALALYAGGRWVFLRLSPHFEDFV |
| Ga0364932_0333277_445_573 | 3300034177 | Sediment | ALLDGRLAVYWGDAIAVVVAIALFAGGRWIFLRLSPHFEDFV |
| ⦗Top⦘ |