| Basic Information | |
|---|---|
| Family ID | F045876 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 46 residues |
| Representative Sequence | DKVYTLDTSDQATLDTLNKLAWEQAKVTGTAEGATISVKSVTAAK |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 4.61 % |
| % of genes near scaffold ends (potentially truncated) | 88.82 % |
| % of genes from short scaffolds (< 2000 bps) | 90.13 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.316 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (11.842 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.658 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.395 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.33% β-sheet: 27.40% Coil/Unstructured: 60.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF01862 | PvlArgDC | 13.16 |
| PF00581 | Rhodanese | 7.89 |
| PF00690 | Cation_ATPase_N | 3.95 |
| PF00072 | Response_reg | 1.97 |
| PF00702 | Hydrolase | 1.97 |
| PF01988 | VIT1 | 1.32 |
| PF01902 | Diphthami_syn_2 | 1.32 |
| PF02452 | PemK_toxin | 1.32 |
| PF01165 | Ribosomal_S21 | 1.32 |
| PF01243 | Putative_PNPOx | 1.32 |
| PF07638 | Sigma70_ECF | 0.66 |
| PF00348 | polyprenyl_synt | 0.66 |
| PF01053 | Cys_Met_Meta_PP | 0.66 |
| PF13181 | TPR_8 | 0.66 |
| PF01695 | IstB_IS21 | 0.66 |
| PF00342 | PGI | 0.66 |
| PF05096 | Glu_cyclase_2 | 0.66 |
| PF00486 | Trans_reg_C | 0.66 |
| PF01402 | RHH_1 | 0.66 |
| PF13545 | HTH_Crp_2 | 0.66 |
| PF02163 | Peptidase_M50 | 0.66 |
| PF00578 | AhpC-TSA | 0.66 |
| PF01152 | Bac_globin | 0.66 |
| PF05532 | CsbD | 0.66 |
| PF03976 | PPK2 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG1945 | Pyruvoyl-dependent arginine decarboxylase | Amino acid transport and metabolism [E] | 13.16 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 3.95 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 1.32 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 1.32 |
| COG2102 | Diphthamide synthase (EF-2-diphthine--ammonia ligase) | Translation, ribosomal structure and biogenesis [J] | 1.32 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 1.32 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 1.32 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.66 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.66 |
| COG3823 | Glutamine cyclotransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.66 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.66 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.66 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.66 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.66 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.66 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.66 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.66 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.66 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.66 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.66 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.66 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.66 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.32 % |
| All Organisms | root | All Organisms | 48.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100559014 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100991000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 725 | Open in IMG/M |
| 3300004479|Ga0062595_100232424 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300004633|Ga0066395_11007498 | Not Available | 508 | Open in IMG/M |
| 3300005187|Ga0066675_10418491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 991 | Open in IMG/M |
| 3300005365|Ga0070688_100717873 | Not Available | 775 | Open in IMG/M |
| 3300005435|Ga0070714_100571247 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300005451|Ga0066681_10988559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300005467|Ga0070706_101830323 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005587|Ga0066654_10411547 | Not Available | 738 | Open in IMG/M |
| 3300005610|Ga0070763_10894339 | Not Available | 528 | Open in IMG/M |
| 3300005893|Ga0075278_1086767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
| 3300005921|Ga0070766_10529328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300005980|Ga0066798_10218726 | Not Available | 513 | Open in IMG/M |
| 3300006028|Ga0070717_11276020 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006176|Ga0070765_100407982 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300006176|Ga0070765_101378139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300006954|Ga0079219_11349726 | Not Available | 632 | Open in IMG/M |
| 3300009038|Ga0099829_10849612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300009088|Ga0099830_10205904 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300009518|Ga0116128_1079618 | Not Available | 989 | Open in IMG/M |
| 3300009519|Ga0116108_1179427 | Not Available | 625 | Open in IMG/M |
| 3300009616|Ga0116111_1137325 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300009618|Ga0116127_1178923 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300009628|Ga0116125_1011195 | Not Available | 2285 | Open in IMG/M |
| 3300009632|Ga0116102_1056408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1218 | Open in IMG/M |
| 3300009645|Ga0116106_1183055 | Not Available | 667 | Open in IMG/M |
| 3300009764|Ga0116134_1328189 | Not Available | 525 | Open in IMG/M |
| 3300009826|Ga0123355_11557861 | Not Available | 640 | Open in IMG/M |
| 3300010343|Ga0074044_10677586 | Not Available | 673 | Open in IMG/M |
| 3300010376|Ga0126381_103489000 | Not Available | 618 | Open in IMG/M |
| 3300010397|Ga0134124_10097294 | All Organisms → cellular organisms → Bacteria | 2555 | Open in IMG/M |
| 3300010398|Ga0126383_12968553 | Not Available | 554 | Open in IMG/M |
| 3300011120|Ga0150983_10647125 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300011120|Ga0150983_11251006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1594 | Open in IMG/M |
| 3300011120|Ga0150983_11413147 | Not Available | 504 | Open in IMG/M |
| 3300011120|Ga0150983_11577984 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300011120|Ga0150983_15395125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300011120|Ga0150983_15734104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300011270|Ga0137391_10532086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
| 3300011271|Ga0137393_11288010 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300012206|Ga0137380_11478388 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012209|Ga0137379_10010678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8733 | Open in IMG/M |
| 3300012209|Ga0137379_11527281 | Not Available | 568 | Open in IMG/M |
| 3300012211|Ga0137377_10617464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1021 | Open in IMG/M |
| 3300012211|Ga0137377_11252980 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300012349|Ga0137387_11019957 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300012351|Ga0137386_10855132 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300012359|Ga0137385_10917300 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012361|Ga0137360_10248824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1459 | Open in IMG/M |
| 3300012685|Ga0137397_10588546 | Not Available | 828 | Open in IMG/M |
| 3300012917|Ga0137395_10177067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1474 | Open in IMG/M |
| 3300012960|Ga0164301_10743765 | Not Available | 743 | Open in IMG/M |
| 3300012986|Ga0164304_11818088 | Not Available | 510 | Open in IMG/M |
| 3300014169|Ga0181531_10888702 | Not Available | 557 | Open in IMG/M |
| 3300014199|Ga0181535_10759820 | Not Available | 550 | Open in IMG/M |
| 3300014489|Ga0182018_10022383 | Not Available | 4140 | Open in IMG/M |
| 3300014501|Ga0182024_10068813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5382 | Open in IMG/M |
| 3300014501|Ga0182024_11481831 | Not Available | 776 | Open in IMG/M |
| 3300014501|Ga0182024_12040790 | Not Available | 633 | Open in IMG/M |
| 3300014655|Ga0181516_10542805 | Not Available | 598 | Open in IMG/M |
| 3300014838|Ga0182030_10179919 | All Organisms → cellular organisms → Bacteria | 2591 | Open in IMG/M |
| 3300014838|Ga0182030_10853890 | Not Available | 823 | Open in IMG/M |
| 3300014838|Ga0182030_11003461 | Not Available | 734 | Open in IMG/M |
| 3300015078|Ga0167660_1009855 | Not Available | 1037 | Open in IMG/M |
| 3300015264|Ga0137403_10652640 | Not Available | 915 | Open in IMG/M |
| 3300017924|Ga0187820_1009287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2344 | Open in IMG/M |
| 3300017925|Ga0187856_1077058 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300017936|Ga0187821_10313097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300017946|Ga0187879_10325410 | Not Available | 853 | Open in IMG/M |
| 3300017948|Ga0187847_10652772 | Not Available | 590 | Open in IMG/M |
| 3300017966|Ga0187776_11466490 | Not Available | 522 | Open in IMG/M |
| 3300017994|Ga0187822_10141160 | Not Available | 767 | Open in IMG/M |
| 3300018004|Ga0187865_1126029 | Not Available | 917 | Open in IMG/M |
| 3300018005|Ga0187878_1369541 | Not Available | 505 | Open in IMG/M |
| 3300018009|Ga0187884_10335906 | Not Available | 610 | Open in IMG/M |
| 3300018017|Ga0187872_10065712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1891 | Open in IMG/M |
| 3300018022|Ga0187864_10192910 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300018022|Ga0187864_10369692 | Not Available | 624 | Open in IMG/M |
| 3300018023|Ga0187889_10348833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300018024|Ga0187881_10111674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1225 | Open in IMG/M |
| 3300018025|Ga0187885_10303329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300018026|Ga0187857_10150107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
| 3300018026|Ga0187857_10494910 | Not Available | 548 | Open in IMG/M |
| 3300018035|Ga0187875_10313668 | Not Available | 847 | Open in IMG/M |
| 3300018042|Ga0187871_10249643 | Not Available | 985 | Open in IMG/M |
| 3300018057|Ga0187858_10418191 | Not Available | 830 | Open in IMG/M |
| 3300018057|Ga0187858_10704612 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300019186|Ga0184588_138693 | Not Available | 562 | Open in IMG/M |
| 3300019786|Ga0182025_1298229 | Not Available | 1569 | Open in IMG/M |
| 3300019786|Ga0182025_1383181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1280 | Open in IMG/M |
| 3300019885|Ga0193747_1003426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3907 | Open in IMG/M |
| 3300020012|Ga0193732_1000635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6599 | Open in IMG/M |
| 3300020579|Ga0210407_10159769 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300020579|Ga0210407_11119565 | Not Available | 596 | Open in IMG/M |
| 3300020583|Ga0210401_10466609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1125 | Open in IMG/M |
| 3300021088|Ga0210404_10107683 | Not Available | 1415 | Open in IMG/M |
| 3300021171|Ga0210405_10553668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
| 3300021420|Ga0210394_10810740 | Not Available | 817 | Open in IMG/M |
| 3300021432|Ga0210384_10358076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1314 | Open in IMG/M |
| 3300021559|Ga0210409_10265329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1552 | Open in IMG/M |
| 3300022557|Ga0212123_10890154 | Not Available | 525 | Open in IMG/M |
| 3300025434|Ga0208690_1010306 | Not Available | 1915 | Open in IMG/M |
| 3300025448|Ga0208037_1010072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2643 | Open in IMG/M |
| 3300025915|Ga0207693_10547683 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300025916|Ga0207663_10671945 | Not Available | 818 | Open in IMG/M |
| 3300026322|Ga0209687_1031942 | Not Available | 1715 | Open in IMG/M |
| 3300026331|Ga0209267_1198587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300026371|Ga0257179_1032732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300026502|Ga0255350_1134439 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026508|Ga0257161_1086339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300026552|Ga0209577_10162635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1745 | Open in IMG/M |
| 3300027545|Ga0209008_1130792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300027645|Ga0209117_1002564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6334 | Open in IMG/M |
| 3300027651|Ga0209217_1084230 | Not Available | 921 | Open in IMG/M |
| 3300027651|Ga0209217_1098667 | Not Available | 836 | Open in IMG/M |
| 3300027652|Ga0209007_1006293 | All Organisms → cellular organisms → Bacteria | 3206 | Open in IMG/M |
| 3300027874|Ga0209465_10353267 | Not Available | 736 | Open in IMG/M |
| 3300027905|Ga0209415_10840387 | Not Available | 633 | Open in IMG/M |
| 3300027908|Ga0209006_11067773 | Not Available | 638 | Open in IMG/M |
| 3300027908|Ga0209006_11338577 | Not Available | 551 | Open in IMG/M |
| 3300028047|Ga0209526_10097039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2075 | Open in IMG/M |
| 3300028747|Ga0302219_10273852 | Not Available | 655 | Open in IMG/M |
| 3300028776|Ga0302303_10074575 | Not Available | 1275 | Open in IMG/M |
| 3300028806|Ga0302221_10318075 | Not Available | 678 | Open in IMG/M |
| 3300028863|Ga0302218_10166875 | Not Available | 699 | Open in IMG/M |
| 3300029817|Ga0247275_1147287 | Not Available | 595 | Open in IMG/M |
| 3300029951|Ga0311371_11117702 | Not Available | 921 | Open in IMG/M |
| 3300029951|Ga0311371_11755284 | Not Available | 673 | Open in IMG/M |
| 3300029951|Ga0311371_12397864 | Not Available | 541 | Open in IMG/M |
| 3300029993|Ga0302304_10038568 | Not Available | 1944 | Open in IMG/M |
| 3300029993|Ga0302304_10361995 | Not Available | 527 | Open in IMG/M |
| 3300030053|Ga0302177_10512547 | Not Available | 619 | Open in IMG/M |
| 3300030617|Ga0311356_11677663 | Not Available | 569 | Open in IMG/M |
| 3300030730|Ga0307482_1138847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300031226|Ga0307497_10565114 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031234|Ga0302325_11750378 | Not Available | 782 | Open in IMG/M |
| 3300031234|Ga0302325_12237522 | Not Available | 663 | Open in IMG/M |
| 3300031247|Ga0265340_10322880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300031469|Ga0170819_16609588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1156 | Open in IMG/M |
| 3300031525|Ga0302326_10308675 | Not Available | 2521 | Open in IMG/M |
| 3300031708|Ga0310686_109956100 | Not Available | 659 | Open in IMG/M |
| 3300031708|Ga0310686_111956282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4279 | Open in IMG/M |
| 3300031711|Ga0265314_10708015 | Not Available | 509 | Open in IMG/M |
| 3300031718|Ga0307474_10470532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300031718|Ga0307474_10901970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300031754|Ga0307475_11564587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300032515|Ga0348332_11339873 | Not Available | 622 | Open in IMG/M |
| 3300032783|Ga0335079_10413013 | Not Available | 1453 | Open in IMG/M |
| 3300032783|Ga0335079_11112035 | Not Available | 799 | Open in IMG/M |
| 3300034125|Ga0370484_0232078 | Not Available | 509 | Open in IMG/M |
| 3300034282|Ga0370492_0348031 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 11.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.53% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.95% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 3.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.63% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.97% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.32% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.32% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.66% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.66% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.66% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.66% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.66% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.66% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.66% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.66% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.66% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.66% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015078 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300019186 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026502 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1 | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1005590142 | 3300002245 | Forest Soil | VVGDKVYTLETKDQASLDTLNKLAWAQVKITGTANGDAISVKSVTAAK* |
| JGIcombinedJ26739_1009910001 | 3300002245 | Forest Soil | VYTLNTSDKAALEELSKLAWEQAKVTGTANGDTISV |
| Ga0062595_1002324241 | 3300004479 | Soil | LVVGEKVYTLHSSDQSTKDQLDKLAGEQAKVTGTANGDTIEVSKVTAAK* |
| Ga0066395_110074981 | 3300004633 | Tropical Forest Soil | KYALVVGDKVYTLDTDNKAALGTLDKLAGSNAKVTGMLNGDTIAVASVAAGK* |
| Ga0066675_104184911 | 3300005187 | Soil | SKYALVVGEKVYTLDTSDKATLDKLDQLANKNAKVTGTASGDTIAVKSAVAGK* |
| Ga0070688_1007178732 | 3300005365 | Switchgrass Rhizosphere | ALVVGDKVYTLETKDKAALDQLDKLAGVQAKVTGTAEKDVIQVSSVAPAN* |
| Ga0070714_1005712473 | 3300005435 | Agricultural Soil | CVQKGAKYALVVGDKVCTIDTSDQAALDKLNGLAWEQAKVTGTVTGGTISVKSVTAAR* |
| Ga0066681_109885592 | 3300005451 | Soil | VGEKVYTLDTSDKATLDKLDQLANKNAKVTGTASGDTIAVKSAVAGK* |
| Ga0070706_1018303232 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VVGDKVYALDTSDQAALDNLSKLAWEEAKVTGTANGDTISVKAVTAAK* |
| Ga0066654_104115471 | 3300005587 | Soil | VVGDKVYTLNTTDKAALDQLNTLAGEQAKVTGTANGDAIDVSKVAAAK* |
| Ga0070763_108943391 | 3300005610 | Soil | KGAKFALVVGDKVYTLSTSDQAALDELNKLAWEQAKVTGTASGDTISVKSVTAAAK* |
| Ga0075278_10867671 | 3300005893 | Rice Paddy Soil | VVGDKVYTLDTSDKASLDKLDKLAGEKAQVMGTADGDTITVSSVASAK* |
| Ga0070766_105293281 | 3300005921 | Soil | IYTLSTSDQASLDELNKLAWDQATLTGTAKGDTISVKSVAAAK* |
| Ga0066798_102187262 | 3300005980 | Soil | LDTSDQAALDKLDKLAWEQAKVTGTATGDTISVKSVTAAK* |
| Ga0070717_112760201 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VQKGAKYALVVGDKVCTIDTSDQAALDKLNGLAWEQAKVTGTVTGGTISVKSVTAAR* |
| Ga0070765_1004079821 | 3300006176 | Soil | KGANYALVVGDKAYTLKTSDKAALDELNKLAWKQAKVTGTASGDTISVKSVTAAK* |
| Ga0070765_1013781391 | 3300006176 | Soil | SDQASLDELNKLAWEQAKVTGTANGDTISVKSVSAAK* |
| Ga0079219_113497261 | 3300006954 | Agricultural Soil | DQSTKDQLDKLAGEQAKVTGTANGDTIEVSKVTAAK* |
| Ga0099829_108496122 | 3300009038 | Vadose Zone Soil | VECFLHGDKVYALDTSDQAALDNLSKLAWEEAKVTGTANGDTISVKSVTAAK* |
| Ga0099830_102059044 | 3300009088 | Vadose Zone Soil | HTSDKAALDELNKLAWENAKVTGTANGDTISVKSVTAAK* |
| Ga0116128_10796181 | 3300009518 | Peatland | LDTKDQASLDELNKLAWEQAKVTGTANGDTISVKSVASAAK* |
| Ga0116108_11794271 | 3300009519 | Peatland | ALVVGDKVYTLDTKDQASLDELNKLAWEQAKVTGTANGDTISVKSVASAAK* |
| Ga0116111_11373252 | 3300009616 | Peatland | KYALVVGDKVYTLSTSDQAALDKLSKLAWEDAKVTGTANGDVITVKSVNAAK* |
| Ga0116127_11789231 | 3300009618 | Peatland | LVVGDKVYTLSTSDQAALDKLSKLAWEDAKVTGTANGDVITVKSVNAAK* |
| Ga0116125_10111951 | 3300009628 | Peatland | VYTLDTSDQSTLETLNKLAWEQAKVTGTADGATISVKTVTAAK* |
| Ga0116102_10564081 | 3300009632 | Peatland | AALDKLNKLAWEQAKVTGTATGDTISVKSVTAAK* |
| Ga0116106_11830551 | 3300009645 | Peatland | TLDTKDQASLDELNKLAWEQAKVTGTANGDTISVKSVASAAK* |
| Ga0116134_13281891 | 3300009764 | Peatland | KGANYALVVGDKVYTLDTKDQAVSAELNKLAWAQAKVTGTANDTISVKSVTSAAK* |
| Ga0123355_115578612 | 3300009826 | Termite Gut | VGDKVYTLHTTDHAALSQLGQLAGQQAKVTGSADGDKIEVSKVVASK* |
| Ga0074044_106775862 | 3300010343 | Bog Forest Soil | SDQATLDTLNKLAWDQAKVTGTADGATISVKSVTATR* |
| Ga0126381_1034890001 | 3300010376 | Tropical Forest Soil | ALVVGDKVYTLDTKDKATLDELDKLAGKQAQVKGTANGDTIAVSSVTP* |
| Ga0134124_100972945 | 3300010397 | Terrestrial Soil | YTLDTSDKSALDELNKLAGQKAKVSGTANGDTIAVSSVAPAK* |
| Ga0126383_129685531 | 3300010398 | Tropical Forest Soil | ALVVGDKVYKLDTQDQASLDKLDQLADKTAKVQGTPNGDTIQVTSVSPGK* |
| Ga0150983_106471253 | 3300011120 | Forest Soil | QAALDNLSKLAWEEAKVTGTANGDTISVKSVTAAK* |
| Ga0150983_112510063 | 3300011120 | Forest Soil | ALVVGPKVYTLKASDQTLLDELNKLSWEQAKVTGTASGDTISVKSVAAAK* |
| Ga0150983_114131471 | 3300011120 | Forest Soil | LVVGDKVYALDTSDQAALDNLSKLAWEEAKVTGTANGDTISVKSVTAAK* |
| Ga0150983_115779842 | 3300011120 | Forest Soil | VGPKVYTLKTSDQAALDELNKLSWEQAKVTGTASGDTISVKSVTAAAK* |
| Ga0150983_153951252 | 3300011120 | Forest Soil | DKVYALDTSDKAALDELNKLAWEQAKVTGTANGDTISVKSVTAAR* |
| Ga0150983_157341042 | 3300011120 | Forest Soil | VGDKIYTLSTSDQASLDELNKLAWEQATVTGTANGDTISVKSVAAAK* |
| Ga0137391_105320861 | 3300011270 | Vadose Zone Soil | KVYALDTSDKAALDELNKLAWEQAKVTGTVNGDTISVKSVTAAK* |
| Ga0137393_112880102 | 3300011271 | Vadose Zone Soil | DKVYALDTSDQAALDNLSKLAWEEAKVTGTANGDTISVKSVTVAK* |
| Ga0137380_114783881 | 3300012206 | Vadose Zone Soil | DKVYALKTSDKATLDELNKLAWEQAKVTGTASGDTISVKSVAAAK* |
| Ga0137379_100106789 | 3300012209 | Vadose Zone Soil | LHAQDQSAQEELNKLAGEQAKVTGTADGDTIKVSKVAAAK* |
| Ga0137379_115272812 | 3300012209 | Vadose Zone Soil | YALVVGDKVYTLSTSDQAALDTLNKLAWKQAKVTGTASGDTISVKSVTPAESVTAAK* |
| Ga0137377_106174642 | 3300012211 | Vadose Zone Soil | DTSDQAALDKLNKLAWEEAKVTGTANGDTISVKSVTVAK* |
| Ga0137377_112529801 | 3300012211 | Vadose Zone Soil | KTSDKAALDELSKLAWEQAEVTGTVSGDTISVKSVAAAK* |
| Ga0137387_110199571 | 3300012349 | Vadose Zone Soil | KVYSLKTSDKAALDELNKLAWEQAKVTGTATGDTISVKSVAAAK* |
| Ga0137386_108551322 | 3300012351 | Vadose Zone Soil | LVVGDKVYALKTSDKATLDELNKLAWEQAKVTGTASGDTISVKSVAAAK* |
| Ga0137385_109173001 | 3300012359 | Vadose Zone Soil | DKVYTLDTSDQAALDKLSKLAWEEAKVTGTANGDTISVKSVTAAK* |
| Ga0137360_102488244 | 3300012361 | Vadose Zone Soil | CVRACVQKGTKYALVVGEKVYALDTSDQAALDNLSKLAWEEAKVTGTANGDTISVKSVTAAK* |
| Ga0137397_105885462 | 3300012685 | Vadose Zone Soil | YALVVGDKVYTLDTSDKTTLDQLDKLADQQAKVTGEANGDSIAVLSVAAAK* |
| Ga0137395_101770675 | 3300012917 | Vadose Zone Soil | ALIVGDKVYALDTSDQAELDNLSKLAWEEAKVTGTANGDTISVKSVIAAK* |
| Ga0164301_107437652 | 3300012960 | Soil | VVGEKVYTLHSSDQSTKDQLDKLAGEQAKVTGTANGDTIEVSKVTAAK* |
| Ga0164304_118180881 | 3300012986 | Soil | SSDQSTKDQLDKLAGEQAKVTGTANGDTIEVSKVTAAK* |
| Ga0181531_108887021 | 3300014169 | Bog | VQKGAKYALVVGDNVYTLDTSNQATLDTLNKLAWEQGKVTGTADRTTIAVKTVTTAQ* |
| Ga0181535_107598201 | 3300014199 | Bog | GANYALVVGDKVYTLDTKDQASLDELNKLAWEQAKVTGTANRDTISVKSVASAAN* |
| Ga0182018_100223831 | 3300014489 | Palsa | KVYTLDTSDQATLDTLNKLAWEQAKVTGTADGATISVKTVTAAK* |
| Ga0182024_100688133 | 3300014501 | Permafrost | VQKGANYALVVGERVYTLKTSDQAALDELNKLAWEQAKVTGTASGDTIAVKAVTAAK* |
| Ga0182024_114818313 | 3300014501 | Permafrost | YTLDTSDQATLDNLNKLAWEQAKVTGTADGATISVKTVTAAK* |
| Ga0182024_120407902 | 3300014501 | Permafrost | VYTLNTSDEAALDELNKLAWEQAKVTGTASGDIISVKSVIAAPK* |
| Ga0181516_105428051 | 3300014655 | Bog | LVVGDNVYTLDTSNQATLDTLNKLAWEQGKVTGTADRTTIAVKTVTTAQ* |
| Ga0182030_101799191 | 3300014838 | Bog | QATLDTLNKLAWDQAKVTGTADGATISVKSVTAAK* |
| Ga0182030_108538901 | 3300014838 | Bog | SATKVYTLDTSDQATLGKLDKLAWEQAKVTGIANGDTISVKSVTAAK* |
| Ga0182030_110034613 | 3300014838 | Bog | DTSDQATLDTLNKLAWEQAKVTGTAEGATISVKSVTAAE* |
| Ga0167660_10098552 | 3300015078 | Glacier Forefield Soil | VGDKVYTLKTSDKATLDELNKLAWEQAKVTGTANGDVISVKSVTAAN* |
| Ga0137403_106526401 | 3300015264 | Vadose Zone Soil | AQDKSAQEELNKLAGEQAKVTGTAEGDTIEVNKVAAAK* |
| Ga0187820_10092871 | 3300017924 | Freshwater Sediment | DKVYTLDASNQGELDKLNQLAWEQAKVTGTANGDTIEVKSVSAAK |
| Ga0187856_10770584 | 3300017925 | Peatland | DKVYTLDTSDQATLDTLNKLAWEQAKVTGTAEGATISVKSVTAAK |
| Ga0187821_103130971 | 3300017936 | Freshwater Sediment | TSDQAALDELDKLAWEPAKVTGTANGDTIAVKSVTAVAK |
| Ga0187879_103254101 | 3300017946 | Peatland | DQASLDELNKLAWEQAKVTGTANGDTISVKSVTAAK |
| Ga0187847_106527721 | 3300017948 | Peatland | TKDQAVSAELNKLAWAQAKVTGTANGDTISVKSVTAAK |
| Ga0187776_114664902 | 3300017966 | Tropical Peatland | VYTLATSDKAALEALDKLANAQAKVTGTAKGDTIEVNSVAAAK |
| Ga0187822_101411602 | 3300017994 | Freshwater Sediment | DCVRACIRKGSRYALVTADKVYAPDTSDKAALDELDKLADQQAKVTGQANGDTITVSAVAKAK |
| Ga0187865_11260291 | 3300018004 | Peatland | QTGAYYALVVGDKVYTLDTKDQAVSAELNKLAWQQAEVTGTANGGTISVRAVTPAAK |
| Ga0187878_13695411 | 3300018005 | Peatland | DKVYTLDTKDQASLDELNKLAWEQAKVTGTANGDTISVKSVASAAK |
| Ga0187884_103359061 | 3300018009 | Peatland | GDKVYTLDTSDQSTLETLNKLAWEQAKVTGTADGTTISVKTVTAAK |
| Ga0187872_100657124 | 3300018017 | Peatland | AKYALVVGDKVYTLDTSDQAALDKLDKLAWEQAKVTGTANGDTISVKSVTAAK |
| Ga0187864_101929104 | 3300018022 | Peatland | LDTSDQATLDTLNKLAWEQAKVTGTAEGATISVKSVTAAK |
| Ga0187864_103696922 | 3300018022 | Peatland | KDQASLDELNKLAWEQAKVTGTANGDTISVKSVASAAK |
| Ga0187889_103488331 | 3300018023 | Peatland | KYALVVGDKVYTLDTSDQAALDKLNKLAWEQAKVTGTATGDTISVKSVTAAK |
| Ga0187881_101116741 | 3300018024 | Peatland | QASLDELNKLAWEQAKVTGTANGDTISVKSVTAAK |
| Ga0187885_103033292 | 3300018025 | Peatland | LVVGDKVYTLDTSDQTALDKLDKLAWEQAKVTGTANGDTISVKSVTAAK |
| Ga0187857_101501074 | 3300018026 | Peatland | ALVVGDKVYTLDTSDQAALDKLNKLAWEQAKVTGTATGDTISVKSVTAAK |
| Ga0187857_104949101 | 3300018026 | Peatland | LVVGDKVYTLDTSNQATLDTLNKLAWEQAKVTGTADGTTISVKTVTAAP |
| Ga0187875_103136681 | 3300018035 | Peatland | EKVYTLDTKDQAVSADLSKLAWQQAKVTGTANGDTISVKSVTADLK |
| Ga0187871_102496431 | 3300018042 | Peatland | DKVYTLDTSNQATLDTLNKLAWEQAKVTGTADGTTISVKTVTAAP |
| Ga0187858_104181914 | 3300018057 | Peatland | SDQAALDKLDKLAWEQAKVTGTATGDTISVKSVTAAK |
| Ga0187858_107046122 | 3300018057 | Peatland | VQKGAKYALVVGNKVYTLDASDQTALGKLNLLVWQKAKVTGTANGDTILVKSVTAAQ |
| Ga0184588_1386931 | 3300019186 | Soil | YALVVGEKVYTLDTSDQATLDNLNKLAWEQAKVTGTADGTTISVKTVTAAK |
| Ga0182025_12982292 | 3300019786 | Permafrost | VQKGAKYALVVGDKVYTLDTSDQATLDTLNKLAWEQAKVTGTAADATISVKTVTAAK |
| Ga0182025_13831814 | 3300019786 | Permafrost | VTSLYLDTSDQATLDTLNKLAWEQAKVTGTAADATIS |
| Ga0193747_10034267 | 3300019885 | Soil | DQAALDNLSKLAWEEAKVTGTANGDTISVKSVTAAK |
| Ga0193732_100063511 | 3300020012 | Soil | KVYALETSDQAVKDNLSKLAWEEAKVTGTANGDTISVKSVTAAK |
| Ga0210407_101597691 | 3300020579 | Soil | LVVGDKVYALDTSDQAALDNLSKLAWEEVKVTGTANGDTISVKSVTAAK |
| Ga0210407_111195651 | 3300020579 | Soil | DTSDQSGLDKLNKLAWEKARVTGTANGDAISVKSVTAAK |
| Ga0210401_104666092 | 3300020583 | Soil | DTSDKAALDELNKLAWEQAKVTGTANGDTISVKSVTAAK |
| Ga0210404_101076832 | 3300021088 | Soil | VYTVNTSDIAALDELNKLAWEQAKVTGTASGDTISVKSVTAAPK |
| Ga0210405_105536684 | 3300021171 | Soil | ALDTSDKAALDELNKLAWEQAKVTGTANGDTISVKSVTAAK |
| Ga0210394_108107402 | 3300021420 | Soil | SKYALVVGNRVYTLDASDKASLSELDQLAGEQAKVVGTVDGDTIAVKSVTAGK |
| Ga0210384_103580762 | 3300021432 | Soil | KAALDELNKLAWEQAKVTGTANGDTISVKSVTAAK |
| Ga0210409_102653293 | 3300021559 | Soil | KYALVVGDKVYTLDTSDKATLDQLDKLADQEAKVTGEATGDSIAVLSVAPAR |
| Ga0212123_108901541 | 3300022557 | Iron-Sulfur Acid Spring | TSDQAALDNLSKLAWEEAKVTGTANGDTISVKSVTAAK |
| Ga0208690_10103063 | 3300025434 | Peatland | VYTLDTSDQSTLETLNKLAWEQAKVTGTADGATISVKTVTAAK |
| Ga0208037_10100721 | 3300025448 | Peatland | VYTLDTKDQASLDELNKLAWEQAKVTGTANRDTISVKSVASAAN |
| Ga0207693_105476833 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VQKGAKYALVVGDKVCTIDTSDQAALDKLNGLAWEQAKVTGTVTGGTISVKSVT |
| Ga0207663_106719452 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | KGSSYALVVGEKVYTLHSSDQSTKDQLDKLAGEQAKVTGTASGDTIEVSKVTAAK |
| Ga0209687_10319421 | 3300026322 | Soil | KYALVVGDKVYTLETSDKAALDNLDKLAGENAKVTGALTGDTIQVSAVTAAQ |
| Ga0209267_11985872 | 3300026331 | Soil | LVVGDKVYALDTSDKAALDELNKLAWEQAKVTGTANGDTISVKSVTAAK |
| Ga0257179_10327322 | 3300026371 | Soil | ALDTSDQAALDNLSKLAWEEATVTGTANGDTISVKSVTAAK |
| Ga0255350_11344391 | 3300026502 | Soil | VYTLDTSDQATLDTLNKLAWDQAKVTGTADGATISVKSVTAAK |
| Ga0257161_10863391 | 3300026508 | Soil | AKYALVVGDKVYALDTSDKAALDQLNKLAWEQAKVTGTANGDTISVKSVTAAK |
| Ga0209577_101626351 | 3300026552 | Soil | TSDKATLDELNKLAWEQAKVTGTANGDTISVKSVTAAK |
| Ga0209008_11307921 | 3300027545 | Forest Soil | KVYALDTKDQAALDTLSKLAWEDAKVTGTANGDIISVKSVTAAK |
| Ga0209117_10025641 | 3300027645 | Forest Soil | MRGGFVRESKYALVVGDKVYTLDTSDKAALDELNKLAWEQAKVTGTANGDTISVKSVAAV |
| Ga0209217_10842303 | 3300027651 | Forest Soil | ACVRACVQKGAKYALVVGEKVYTLDTSDQAALDELSKLAWEEAKVTGTANGDTISVKSVTAAK |
| Ga0209217_10986671 | 3300027651 | Forest Soil | ACVRACVQKGAKYALVVGEKVYTLDTSDQAALDNLSKLAWEEAKVTGTANGDTISVKSVTAAK |
| Ga0209007_10062935 | 3300027652 | Forest Soil | VYTLNTSDKAALEELSKLAWEQAKVTGTANGDTISVKSADRRPK |
| Ga0209465_103532672 | 3300027874 | Tropical Forest Soil | AQYALVVGDKVYTLDTDNKAALGTLDKLAGSNAKVTGMLNGDTIAVASVAAGK |
| Ga0209415_108403871 | 3300027905 | Peatlands Soil | TLSTSDQAALDKLSKLAWEDAKVTGTANGDVITVKSVNAAK |
| Ga0209006_110677731 | 3300027908 | Forest Soil | VVGDKVYTLETKDQASLDTLNKLAWAQVKITGTANGDAISVKSVTAAK |
| Ga0209006_113385771 | 3300027908 | Forest Soil | LDTSDQATLDTLNKLAWEQAKVTGTADGATISVKTVTAAK |
| Ga0209526_100970391 | 3300028047 | Forest Soil | KYSVVVGDKVYTLDTSDQAALDKLSKLAWEEAKVTGTANGDTISVKSVTAAK |
| Ga0302219_102738522 | 3300028747 | Palsa | KYAVVVGDKVYTLDTSDQATLDTLNKLAWEQAKVTGTADGATISVKTVTAAK |
| Ga0302303_100745751 | 3300028776 | Palsa | LVVGDKVYTLDTSDQATLDTLNKLAWEQAKVTGTADGATISVKTVTAAK |
| Ga0302221_103180751 | 3300028806 | Palsa | TLDTSDQATLDTLNKLAWDQAKVTGTADGATISVKSVTAAT |
| Ga0302218_101668753 | 3300028863 | Palsa | KYALVVGDKVYTLDTSDQATLDTLNKLAWEQAKVTGTADGATISVKTVTAAK |
| Ga0247275_11472871 | 3300029817 | Soil | VYTLDTKDQAVSAELNKLAWAQAKVTGTANDTISVKSVTSAAK |
| Ga0311371_111177021 | 3300029951 | Palsa | DKVYTLDTSDQATLDTLNKLAWEQAKVTGTADGATISVKTVTAAK |
| Ga0311371_117552841 | 3300029951 | Palsa | VGDKVYTLDTSDQATLDTLNKLAWEQAKVTGTADGTTISVKSVTAAR |
| Ga0311371_123978641 | 3300029951 | Palsa | DKVYTLDTSDQATLDTLNKLAWEQAKVTGTVDGTTISVKTVTAAQ |
| Ga0302304_100385681 | 3300029993 | Palsa | LDTSDQATLDTLNKLAWEQAKVTGTADGTTISVKTVTAAN |
| Ga0302304_103619951 | 3300029993 | Palsa | YTLDTSDQATLDTLNKLAWEQAKVTGTADGATISVKTVTAAK |
| Ga0302177_105125471 | 3300030053 | Palsa | QATLENLNKLAWEQAKVTGTADGTTISVKTVTAAK |
| Ga0311356_116776631 | 3300030617 | Palsa | TLDTSDQATLDTLNKLAWEQAKVTGTADGATISVKTVTAAK |
| Ga0307482_11388471 | 3300030730 | Hardwood Forest Soil | DKVYTLETKDQAALDTLSKLAWEDAKVTGTANGDTISVKSVTATK |
| Ga0307497_105651142 | 3300031226 | Soil | TSDKAALDELNKLAWEQAKVTGTASGDTISVKSVAAAK |
| Ga0302325_117503781 | 3300031234 | Palsa | VYTLDTSDQATLETLNKLAWEQAKVTGTADGTTISVKTVTAAK |
| Ga0302325_122375221 | 3300031234 | Palsa | VVADKVYTLDTSDQATLDTLNKLAWEQAKVTGTVDGTTISVKKVTAAQ |
| Ga0265340_103228801 | 3300031247 | Rhizosphere | DQATLDELNKLSWEQAKVTGTASGDTISVKSVSAAK |
| Ga0170819_166095883 | 3300031469 | Forest Soil | GEKVYTLHSSDQSTKDQLDKLAGEQAKVTGTANGDTIEVSKVTAAK |
| Ga0302326_103086751 | 3300031525 | Palsa | VVADKVYTLDTSDQATLDTLNKLAWEQAKVTGTVDGTTISVKTVTAAQ |
| Ga0310686_1099561001 | 3300031708 | Soil | LFRESLVVGDKVYTLDAKDQASLDELNKLAWEKAKVKGTASGDTISVKSVAAAK |
| Ga0310686_1119562821 | 3300031708 | Soil | KAALDELSKLAWEQAKVTGTASGDTISVKSVAAAK |
| Ga0265314_107080152 | 3300031711 | Rhizosphere | PKVYTLKTSDQAILDELNKLSWEQAKVMGTASGGTISVKSVSAAK |
| Ga0307474_104705321 | 3300031718 | Hardwood Forest Soil | KVYTLETKDQAALDTLSKLAWEDAKVTGTANGDAISVKSVVATK |
| Ga0307474_109019701 | 3300031718 | Hardwood Forest Soil | GDKVYTLETKDQAALDTLSKLAWEDAKVTGTANGDTISVKSVTATK |
| Ga0307475_115645871 | 3300031754 | Hardwood Forest Soil | GDKVYALDTSDKAALDELNKLAWEQATVTGTANADTISVKAVTAAK |
| Ga0348332_113398731 | 3300032515 | Plant Litter | LVVGDKVYTLDTSDQATLDTLNTLAWEQAKVTGTADGATISVKTVTAAK |
| Ga0335079_104130131 | 3300032783 | Soil | TADQATLDKLNKLAWEEAKVTGMASGDTISVKSVTAAK |
| Ga0335079_111120352 | 3300032783 | Soil | EKVYTLDTKDQAQLDELNKLAWENAKVTGTASGDTISVKSVSAAK |
| Ga0370484_0232078_301_477 | 3300034125 | Untreated Peat Soil | VQKGAKYALVVGDKVYTLSTSDQAALDTLNKLAWEQAKVTGTATGDTIAVKSVTSVAK |
| Ga0370492_0348031_1_126 | 3300034282 | Untreated Peat Soil | TLDTSDQATLDTLNKLAWEQAKVTGTADGDTISVKSVTAAK |
| ⦗Top⦘ |