| Basic Information | |
|---|---|
| Family ID | F045875 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MTVTTWKLLRALVGLEAGRSCRRCGESILDSDPFGRSEGVCRPCRAAA |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.55 % |
| % of genes near scaffold ends (potentially truncated) | 30.26 % |
| % of genes from short scaffolds (< 2000 bps) | 78.95 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.974 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (11.184 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.658 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.89% β-sheet: 2.63% Coil/Unstructured: 64.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF00440 | TetR_N | 11.84 |
| PF16859 | TetR_C_11 | 9.87 |
| PF01061 | ABC2_membrane | 8.55 |
| PF00356 | LacI | 3.95 |
| PF02574 | S-methyl_trans | 3.95 |
| PF02142 | MGS | 2.63 |
| PF01544 | CorA | 2.63 |
| PF00005 | ABC_tran | 1.97 |
| PF00532 | Peripla_BP_1 | 1.97 |
| PF07690 | MFS_1 | 1.32 |
| PF00817 | IMS | 1.32 |
| PF08443 | RimK | 1.32 |
| PF10604 | Polyketide_cyc2 | 1.32 |
| PF00881 | Nitroreductase | 1.32 |
| PF13377 | Peripla_BP_3 | 1.32 |
| PF13229 | Beta_helix | 1.32 |
| PF00486 | Trans_reg_C | 1.32 |
| PF00310 | GATase_2 | 1.32 |
| PF03099 | BPL_LplA_LipB | 1.32 |
| PF10706 | Aminoglyc_resit | 1.32 |
| PF03737 | RraA-like | 0.66 |
| PF03476 | MOSC_N | 0.66 |
| PF00306 | ATP-synt_ab_C | 0.66 |
| PF00208 | ELFV_dehydrog | 0.66 |
| PF03372 | Exo_endo_phos | 0.66 |
| PF02272 | DHHA1 | 0.66 |
| PF11987 | IF-2 | 0.66 |
| PF02190 | LON_substr_bdg | 0.66 |
| PF04456 | DUF503 | 0.66 |
| PF00296 | Bac_luciferase | 0.66 |
| PF06745 | ATPase | 0.66 |
| PF02823 | ATP-synt_DE_N | 0.66 |
| PF00027 | cNMP_binding | 0.66 |
| PF12796 | Ank_2 | 0.66 |
| PF00156 | Pribosyltran | 0.66 |
| PF02347 | GDC-P | 0.66 |
| PF11762 | Arabinose_Iso_C | 0.66 |
| PF04075 | F420H2_quin_red | 0.66 |
| PF08281 | Sigma70_r4_2 | 0.66 |
| PF12802 | MarR_2 | 0.66 |
| PF01614 | IclR | 0.66 |
| PF13561 | adh_short_C2 | 0.66 |
| PF07729 | FCD | 0.66 |
| PF13191 | AAA_16 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 3.95 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 3.95 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 2.63 |
| COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 1.32 |
| COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 1.32 |
| COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 1.32 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 1.32 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.66 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.66 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.66 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.66 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.66 |
| COG1550 | Stress-induced protein YlxP, DUF503 family | Function unknown [S] | 0.66 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.66 |
| COG1156 | Archaeal/vacuolar-type H+-ATPase subunit B/Vma2 | Energy production and conversion [C] | 0.66 |
| COG1155 | Archaeal/vacuolar-type H+-ATPase catalytic subunit A/Vma1 | Energy production and conversion [C] | 0.66 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.66 |
| COG0055 | FoF1-type ATP synthase, beta subunit | Energy production and conversion [C] | 0.66 |
| COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 0.66 |
| COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 0.66 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.66 |
| COG0056 | FoF1-type ATP synthase, alpha subunit | Energy production and conversion [C] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.63 % |
| Unclassified | root | N/A | 22.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig25892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1126 | Open in IMG/M |
| 2170459002|F0B48LX02IDAIJ | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 2170459010|GIO7OMY01BPSS8 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 514 | Open in IMG/M |
| 3300003995|Ga0055438_10026431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1363 | Open in IMG/M |
| 3300004114|Ga0062593_100015321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3815 | Open in IMG/M |
| 3300004153|Ga0063455_100511717 | Not Available | 751 | Open in IMG/M |
| 3300004157|Ga0062590_100030821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2713 | Open in IMG/M |
| 3300004643|Ga0062591_101976403 | Not Available | 600 | Open in IMG/M |
| 3300005045|Ga0071328_151449 | All Organisms → cellular organisms → Bacteria | 3034 | Open in IMG/M |
| 3300005176|Ga0066679_10378053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
| 3300005177|Ga0066690_10929894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300005181|Ga0066678_10280797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1085 | Open in IMG/M |
| 3300005181|Ga0066678_10478004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300005332|Ga0066388_103095191 | Not Available | 850 | Open in IMG/M |
| 3300005337|Ga0070682_101688140 | Not Available | 550 | Open in IMG/M |
| 3300005340|Ga0070689_100252937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1454 | Open in IMG/M |
| 3300005356|Ga0070674_101171365 | Not Available | 681 | Open in IMG/M |
| 3300005438|Ga0070701_10190326 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300005445|Ga0070708_100184251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1952 | Open in IMG/M |
| 3300005445|Ga0070708_101807108 | Not Available | 567 | Open in IMG/M |
| 3300005447|Ga0066689_10422116 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300005456|Ga0070678_100901760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
| 3300005530|Ga0070679_102023454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300005533|Ga0070734_10097189 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300005533|Ga0070734_10759229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300005534|Ga0070735_10608064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 648 | Open in IMG/M |
| 3300005542|Ga0070732_10967044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300005554|Ga0066661_10708065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300005555|Ga0066692_10451853 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300005557|Ga0066704_10021808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3792 | Open in IMG/M |
| 3300005558|Ga0066698_10130795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1682 | Open in IMG/M |
| 3300005764|Ga0066903_107619512 | Not Available | 558 | Open in IMG/M |
| 3300005764|Ga0066903_109052160 | Not Available | 504 | Open in IMG/M |
| 3300005985|Ga0081539_10001335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 42960 | Open in IMG/M |
| 3300006046|Ga0066652_100836528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
| 3300006059|Ga0075017_101259549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300006176|Ga0070765_100576603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1060 | Open in IMG/M |
| 3300006426|Ga0075037_1884629 | Not Available | 508 | Open in IMG/M |
| 3300006638|Ga0075522_10061723 | All Organisms → cellular organisms → Bacteria | 2130 | Open in IMG/M |
| 3300006638|Ga0075522_10165465 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 1140 | Open in IMG/M |
| 3300009012|Ga0066710_100007958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10213 | Open in IMG/M |
| 3300009090|Ga0099827_11788451 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300009137|Ga0066709_103272277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 590 | Open in IMG/M |
| 3300009147|Ga0114129_10346516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1969 | Open in IMG/M |
| 3300009660|Ga0105854_1226908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 629 | Open in IMG/M |
| 3300009789|Ga0126307_10077990 | All Organisms → cellular organisms → Bacteria | 2613 | Open in IMG/M |
| 3300009818|Ga0105072_1009578 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300009837|Ga0105058_1062134 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300010039|Ga0126309_10269880 | Not Available | 972 | Open in IMG/M |
| 3300010040|Ga0126308_11013322 | Not Available | 582 | Open in IMG/M |
| 3300010044|Ga0126310_11324484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 583 | Open in IMG/M |
| 3300010099|Ga0127450_1068345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 530 | Open in IMG/M |
| 3300010114|Ga0127460_1039203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 701 | Open in IMG/M |
| 3300010122|Ga0127488_1024184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 567 | Open in IMG/M |
| 3300010133|Ga0127459_1192622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 643 | Open in IMG/M |
| 3300010136|Ga0127447_1150937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 564 | Open in IMG/M |
| 3300010301|Ga0134070_10418970 | Not Available | 531 | Open in IMG/M |
| 3300010379|Ga0136449_100662335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1761 | Open in IMG/M |
| 3300010857|Ga0126354_1202601 | Not Available | 508 | Open in IMG/M |
| 3300010862|Ga0126348_1101434 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300011000|Ga0138513_100000278 | Not Available | 3255 | Open in IMG/M |
| 3300012043|Ga0136631_10147071 | Not Available | 909 | Open in IMG/M |
| 3300012199|Ga0137383_10982995 | Not Available | 615 | Open in IMG/M |
| 3300012201|Ga0137365_10612957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
| 3300012208|Ga0137376_10742886 | Not Available | 846 | Open in IMG/M |
| 3300012212|Ga0150985_100831004 | Not Available | 502 | Open in IMG/M |
| 3300012350|Ga0137372_10459183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 954 | Open in IMG/M |
| 3300012356|Ga0137371_10187690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1620 | Open in IMG/M |
| 3300012358|Ga0137368_10350114 | Not Available | 983 | Open in IMG/M |
| 3300012387|Ga0134030_1088781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300012397|Ga0134056_1131432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 621 | Open in IMG/M |
| 3300012398|Ga0134051_1059368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300012399|Ga0134061_1295703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 614 | Open in IMG/M |
| 3300012400|Ga0134048_1172435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 668 | Open in IMG/M |
| 3300012400|Ga0134048_1379423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300012403|Ga0134049_1097522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 602 | Open in IMG/M |
| 3300012403|Ga0134049_1282462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1255 | Open in IMG/M |
| 3300012407|Ga0134050_1341983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 547 | Open in IMG/M |
| 3300012409|Ga0134045_1264434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 966 | Open in IMG/M |
| 3300012410|Ga0134060_1007776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1104 | Open in IMG/M |
| 3300013296|Ga0157374_11382201 | Not Available | 727 | Open in IMG/M |
| 3300014501|Ga0182024_10341529 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300015371|Ga0132258_11555560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1670 | Open in IMG/M |
| 3300015371|Ga0132258_12333533 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300017939|Ga0187775_10122683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 897 | Open in IMG/M |
| 3300017944|Ga0187786_10260302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300017944|Ga0187786_10333573 | Not Available | 635 | Open in IMG/M |
| 3300017959|Ga0187779_10188174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1287 | Open in IMG/M |
| 3300017961|Ga0187778_10715901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300017966|Ga0187776_11078528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 595 | Open in IMG/M |
| 3300017973|Ga0187780_10756291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
| 3300017974|Ga0187777_10539353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300017997|Ga0184610_1034722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1433 | Open in IMG/M |
| 3300018027|Ga0184605_10021479 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
| 3300018028|Ga0184608_10000004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 65641 | Open in IMG/M |
| 3300018061|Ga0184619_10010002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3703 | Open in IMG/M |
| 3300018064|Ga0187773_10046190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1986 | Open in IMG/M |
| 3300018064|Ga0187773_10529737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300018064|Ga0187773_10757742 | Not Available | 612 | Open in IMG/M |
| 3300018433|Ga0066667_11313163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300018433|Ga0066667_12283479 | Not Available | 506 | Open in IMG/M |
| 3300019786|Ga0182025_1382522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2038 | Open in IMG/M |
| 3300021073|Ga0210378_10100576 | Not Available | 1126 | Open in IMG/M |
| 3300021432|Ga0210384_10972641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 750 | Open in IMG/M |
| 3300025549|Ga0210094_1011157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1364 | Open in IMG/M |
| 3300025664|Ga0208849_1000695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 28770 | Open in IMG/M |
| 3300025908|Ga0207643_10151547 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300025923|Ga0207681_10339768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1199 | Open in IMG/M |
| 3300025926|Ga0207659_11176475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300025928|Ga0207700_11707396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300025929|Ga0207664_10457678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1139 | Open in IMG/M |
| 3300025951|Ga0210066_1027307 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300026142|Ga0207698_12318939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300027561|Ga0209887_1012470 | All Organisms → cellular organisms → Bacteria | 2179 | Open in IMG/M |
| 3300027826|Ga0209060_10119968 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300027986|Ga0209168_10530994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 566 | Open in IMG/M |
| 3300028800|Ga0265338_10006579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14744 | Open in IMG/M |
| 3300028800|Ga0265338_10064277 | All Organisms → cellular organisms → Bacteria | 3193 | Open in IMG/M |
| 3300028800|Ga0265338_10119856 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
| 3300028906|Ga0308309_10567319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 984 | Open in IMG/M |
| 3300030730|Ga0307482_1272177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300030997|Ga0073997_10018678 | Not Available | 514 | Open in IMG/M |
| 3300031023|Ga0073998_11690259 | Not Available | 514 | Open in IMG/M |
| 3300031251|Ga0265327_10087798 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300031670|Ga0307374_10091782 | All Organisms → cellular organisms → Bacteria | 2703 | Open in IMG/M |
| 3300031672|Ga0307373_10177192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1585 | Open in IMG/M |
| 3300032160|Ga0311301_10696903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1429 | Open in IMG/M |
| 3300032770|Ga0335085_10009373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14778 | Open in IMG/M |
| 3300032770|Ga0335085_11742380 | Not Available | 640 | Open in IMG/M |
| 3300032770|Ga0335085_12106129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300032782|Ga0335082_11639508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 516 | Open in IMG/M |
| 3300032783|Ga0335079_10099098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3305 | Open in IMG/M |
| 3300032783|Ga0335079_10930023 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300032828|Ga0335080_10187157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2281 | Open in IMG/M |
| 3300032829|Ga0335070_10102859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2986 | Open in IMG/M |
| 3300032892|Ga0335081_10270485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2276 | Open in IMG/M |
| 3300032893|Ga0335069_10001962 | All Organisms → cellular organisms → Bacteria | 32306 | Open in IMG/M |
| 3300032893|Ga0335069_10954456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 955 | Open in IMG/M |
| 3300032898|Ga0335072_10271725 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300032955|Ga0335076_10136443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2373 | Open in IMG/M |
| 3300033158|Ga0335077_10661015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
| 3300033158|Ga0335077_11950101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 547 | Open in IMG/M |
| 3300033158|Ga0335077_12026566 | Not Available | 534 | Open in IMG/M |
| 3300033805|Ga0314864_0045467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 991 | Open in IMG/M |
| 3300033808|Ga0314867_039826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1105 | Open in IMG/M |
| 3300034643|Ga0370545_124577 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.18% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.53% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.29% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.63% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.63% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.97% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.97% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.32% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.32% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.32% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.32% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.32% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.32% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.66% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.66% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.66% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.66% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.66% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.66% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005045 | Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010099 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025951 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0892.00002040 | 2166559005 | Simulated | MSLTISNSKNNTWRVFQALAGRESGRSCRCCGEAILSADPFGRSEGVCRPCRGVAS |
| E1_04016220 | 2170459002 | Grass Soil | MSLTISKNNTWRVFQALAARESGRACRCCGEAILSGDPFGRSEGVCRPCRGVA |
| F62_03134310 | 2170459010 | Grass Soil | MTTTVTTFNVLRALAGLEAGRRCRSCGEAILGNDPFGRSEGVCRSCRHPHTTAA |
| Ga0055438_100264312 | 3300003995 | Natural And Restored Wetlands | MTMTVWKVLRALTGVERGRSCRGCGEAILVKDSFGMSEGVCSPCRLAIV* |
| Ga0062593_1000153214 | 3300004114 | Soil | MIATVWNLVRAATGLETGRECRSCNESIRREDPFGMSEGVCRPCRSA* |
| Ga0063455_1005117171 | 3300004153 | Soil | MLNTTWNLVRALVGQENGRDCRRCGESIARQDDFGMSEGVCPPCRTA* |
| Ga0062590_1000308212 | 3300004157 | Soil | MIATVWNLVRAATGLENGRECRSCNESIRREDPFGMSEGVCRPCRSA* |
| Ga0062591_1019764032 | 3300004643 | Soil | MLYSLVRSIVGLEAGRSCRTCSESISPRDQFGLSEGVCHPCREH* |
| Ga0071328_1514493 | 3300005045 | Permafrost | MIYSLLRSIVGLEAGRSCRTCSESISKRDPFGQSEGVCHPCREH* |
| Ga0066679_103780532 | 3300005176 | Soil | MNTSLWKLVRALAGAENGCSCRKCSESILRNDPFGMSEGVCAPCRRAA* |
| Ga0066690_109298941 | 3300005177 | Soil | MSRTVWKLFRALAGVEAGRCCRCCGESILRDDPFGLSEGVCRPCRA* |
| Ga0066678_102807972 | 3300005181 | Soil | MGDTLWKVLRALAGLESGRWGRQCSESIPGGDQFGMSEGVCRPCREAA* |
| Ga0066678_104780041 | 3300005181 | Soil | MTLTVWKVLRSLAALESGCRCRRCYEPILAGDPFGRSEGVCRPCRV* |
| Ga0066388_1030951911 | 3300005332 | Tropical Forest Soil | MTMSVWKVLRAMAGLEGGRSCRNCGEQILAKDPFGRSEGVCVPCRA* |
| Ga0070682_1016881402 | 3300005337 | Corn Rhizosphere | MIATVWNVVRAATGLENGRECRRCNESIRREDPFGMSEGVCRPCRSA* |
| Ga0070689_1002529372 | 3300005340 | Switchgrass Rhizosphere | MIATVWNVVRAATGLENGRECRRCNESIRREDPFGMSEGVCRPCRSGA* |
| Ga0070674_1011713652 | 3300005356 | Miscanthus Rhizosphere | LRLGEPFMIATVWNLVRAATGLENGRECRSCNESIRREDPFGMSEGVCRPCRSA* |
| Ga0070659_1011672312 | 3300005366 | Corn Rhizosphere | VSVPRLRLGEPFMIATVWNLVRAATGLETGRECRSCNESIRREDPFGMSEGVCRPCRSA* |
| Ga0070701_101903263 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MIATVWNVVRAATGLENGRECRRCNESIRREDPFGMSEGVCR |
| Ga0070708_1001842513 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSITIWRLFRALAGLESGSWCRRCTESIHAADPFGISEGVCRGCRGGG* |
| Ga0070708_1018071081 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRTVWRVFRALAGMEAGRCCRRCGESILGDDPFGMSEQVCRPCRSAAAG* |
| Ga0066689_104221161 | 3300005447 | Soil | TLWKVLRALAGLESGRWCRQCSESIPGGDQFGMSEGVCRPCREAA* |
| Ga0070678_1009017601 | 3300005456 | Miscanthus Rhizosphere | MIATVWNLVRAATGLETGRACRSCNESIRREDPFGMSEGVCRPCRSGA* |
| Ga0070707_1009661261 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVTIWNVFRAMAGLEYGRRCRSCAESILAEDRFGMSEGVCRACRSAPRN* |
| Ga0070679_1020234541 | 3300005530 | Corn Rhizosphere | WGEPFMIATVWNVVRAATGLENGRECRRCNESIRREDPFGMSEGVCRPCRSA* |
| Ga0070734_100971892 | 3300005533 | Surface Soil | MTTTYRVLRALMGFERGRHCRRCDEAILADDHFGFSEGVCRACRREAF* |
| Ga0070734_107592292 | 3300005533 | Surface Soil | VIRATYKLFQALVGLEAGRSCRCCGQSIVVDDPFGMSEGVCRPCRAAA* |
| Ga0070735_106080642 | 3300005534 | Surface Soil | MSVTYWKLLRALVGLEAGRSCRCCGEPILNADPFGKSEGVCRPCRES* |
| Ga0070732_109670441 | 3300005542 | Surface Soil | CGNDNAEPTMGDPMTVTYWKLLRALVGLEAGRSCRCCGESILDTDPFGKSEGVCRACREA |
| Ga0066661_107080651 | 3300005554 | Soil | VFSKLLKALAGLEAGRECRVCGDAISRKDNFGLSEGVCAPCRD* |
| Ga0066692_104518531 | 3300005555 | Soil | VLRALAGLESGRWCRQCSESIPGGDQFGMSEGVCRPCREAADGRQTEF* |
| Ga0066704_100218083 | 3300005557 | Soil | MGDTLWMVLRALAGLESGRWCRQCSESIPGGDQFGMSEGVCRPCREAA* |
| Ga0066698_101307952 | 3300005558 | Soil | MATTVWKLLRGLAGLESGRCCRCCGEPILAADPFGLSEGVCRPCRLSPDC* |
| Ga0066903_1076195122 | 3300005764 | Tropical Forest Soil | MQPTGTRTFWNLFRALVGAEAGRSCRCCGESITAVDPFGLSEGVCVPCRG* |
| Ga0066903_1090521601 | 3300005764 | Tropical Forest Soil | MTLSVWKVLRAMAGLEGGRCCRHCGEQILAKDPFGRSEGVC |
| Ga0081539_1000133527 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MTVWNVLRALVGLETGRSCRSCHDAIPYVDEFGQSEGVCRPCRGVDA* |
| Ga0066652_1008365282 | 3300006046 | Soil | MSKTVFRLFRALAGIEAGRCCRTCGESILRDDPFGMSEGVCHPCSS* |
| Ga0075017_1012595492 | 3300006059 | Watersheds | MSLAISNTTWRLFRALAGSEAGRSCRCCGESILRADPFGYSEGVCRPCRHEGG* |
| Ga0070765_1005766032 | 3300006176 | Soil | MTVTTWKLLRALVGLEAGRSCRRCGESILDSDPFGRSEGVCRPCRAAA* |
| Ga0075037_18846291 | 3300006426 | Permafrost Soil | VRQIGGFMTVTYWKLMRSLVGLESGCSCRVCGESILENDPFGMSEGVCRPCRKS* |
| Ga0075522_100617232 | 3300006638 | Arctic Peat Soil | MTVTYWKLMRSLVGLESGCSCRVCGESILVNDPFGMSEGVCEPCRK* |
| Ga0075522_101654652 | 3300006638 | Arctic Peat Soil | MTVYWNLLRALVGLEAGCTCRCCGESILPNDPFGMSESVCRPCRQPTA* |
| Ga0066710_1000079588 | 3300009012 | Grasslands Soil | VFSKLLKALAGLEAGRECRVCGDAISRKDDFGLSEGVCAPCRD |
| Ga0099827_117884511 | 3300009090 | Vadose Zone Soil | AFRSDEGRSTMGDTLWKVLRALAGLESGRWCRQCSESIPGGDQFGMSEGVCRPCREAA* |
| Ga0066709_1032722772 | 3300009137 | Grasslands Soil | MGDTLWKVLRALAGLESGRWCRQCSESIPGGDQFGMSEGVCRPCREAA* |
| Ga0114129_103465163 | 3300009147 | Populus Rhizosphere | GEPFMIATVWNLVRAATGLENGRECRSCNESIRREDPFGMSEGVCRPCRSA* |
| Ga0105238_130171391 | 3300009551 | Corn Rhizosphere | IVSVPRLRLGEPFMIATVWNLVRAATGLETGRECRSCNESIRREDPFGMSEGVCRPCRSGA* |
| Ga0105249_105073311 | 3300009553 | Switchgrass Rhizosphere | PETGGRLIATLRIVSVPRLRLGEPFMIATVWNLVRAATGLETGRECRSCNESIRREDPFGMSEGVCRPCRSA* |
| Ga0105854_12269082 | 3300009660 | Permafrost Soil | MTVTYWKLMRSLVGLESGCSCRVCGESILVSDPFGMSEGVCEPCRKA* |
| Ga0126307_100779903 | 3300009789 | Serpentine Soil | MIYSLLRSIVGLEAGGSCRTCFESISSRDQFGLSEEVCHLCRDH* |
| Ga0105072_10095783 | 3300009818 | Groundwater Sand | MSTTWKWLRGLTGLESGRWCRSCEESISASDPFGMSEGVCRPCREEA* |
| Ga0105058_10621341 | 3300009837 | Groundwater Sand | EAVMSTTWKWLRGLTGLETGRWCRSCEESISASDPFGMSEGVCRPCREEA* |
| Ga0126309_102698801 | 3300010039 | Serpentine Soil | MIYSLLRSIVGLEAGRSCRTCSESISPRDPFGLSEGVCHPCREH* |
| Ga0126308_110133222 | 3300010040 | Serpentine Soil | MIYSLLRSIVGLEAGRSCRTCSESISSRDPFGLSEGVCHPCRGH* |
| Ga0126310_113244841 | 3300010044 | Serpentine Soil | MIATVWNLVRAATGLENGRECRSCNESIRREDPFGM |
| Ga0127450_10683451 | 3300010099 | Grasslands Soil | TVWKLLRGLAGLESGRCCRCCGEPILAVDPFGLSEGVCRPCRLSPDC* |
| Ga0127460_10392033 | 3300010114 | Grasslands Soil | EAIVTTTVWKLLRGLAGLESGRSCRCCSEAILAADPFGMSEGVCRPCRRATDY* |
| Ga0127488_10241842 | 3300010122 | Grasslands Soil | CPRLHREAIVPTTVWKLLRGLAGPESGRSCRVCSEPILAADPFGMSEGVCRPCRLSPELR |
| Ga0127459_11926221 | 3300010133 | Grasslands Soil | SSVWKLIRALTGEEAGRSCRLCGESIPVHDGFGLSEGVCRPCRLEPDT* |
| Ga0127447_11509372 | 3300010136 | Grasslands Soil | STHRWEAIVTTTVWKLLRGLAGLESGRCCRCCGEPILAADPFGMSEGVCRLSPELR* |
| Ga0134070_104189702 | 3300010301 | Grasslands Soil | MATTVWKLLRGLAGLESGRSCRCCSQPILAADPFGMSEGVCRPCRLSPELR* |
| Ga0136449_1006623354 | 3300010379 | Peatlands Soil | MSLALSNTTWRLFQALAGREAGRSCRSCGEAILPDDRFGFSEGVCRPCRLDHG* |
| Ga0126354_12026012 | 3300010857 | Boreal Forest Soil | MTVTLWKLFRALAGAENGRSCRGCGESILGEDQFGMSEGVCRPCRFVGG* |
| Ga0126348_11014342 | 3300010862 | Boreal Forest Soil | KSELEKVMTMTYWKFFRALAGVESGCTCRRCTESIQRNDPFGLSEGVCRPCRSRA* |
| Ga0138513_1000002782 | 3300011000 | Soil | MIYSLLRSIVGLEAGRSCRTCSESISSRDPFGLSEGVCHPCREH* |
| Ga0136631_101470712 | 3300012043 | Polar Desert Sand | MIYSLLRTIVGLESGRSCRACSESISSHDSFGQSEGVCYPCRGH* |
| Ga0137383_109829952 | 3300012199 | Vadose Zone Soil | MNTSLWKLVRALAGAENGCSCRKCSESILRNDPFGMSEGVCAPSRRAA* |
| Ga0137365_106129572 | 3300012201 | Vadose Zone Soil | MSKTVWKLFRALAGAEAGRSCRCCGESILRDDPFGFSEGVCRPCRS* |
| Ga0137376_107428861 | 3300012208 | Vadose Zone Soil | RTVWKLFRALAGAEAGRSCRCCGESILRDDPFGLSEGVCRPCRSD* |
| Ga0150985_1008310042 | 3300012212 | Avena Fatua Rhizosphere | MSVTLWKLFRALAGAEAGRSCRGCREAILPADPFGMSEGVCRACRVSHA* |
| Ga0137372_104591831 | 3300012350 | Vadose Zone Soil | MATTTWRVLRALSRLENGRDCRRCGESILSSDPFGTSEGVCGPCRLRSDT* |
| Ga0137371_101876901 | 3300012356 | Vadose Zone Soil | MGDTLWKVLRALAGLESGRWCRQCSESISGGDEFGMSEGVCLPCRQAA* |
| Ga0137368_103501142 | 3300012358 | Vadose Zone Soil | MTWTWLRGLAGLESGRWCRSCEESISGDPFGMSEGVCRPCRDEATR* |
| Ga0134030_10887811 | 3300012387 | Grasslands Soil | RNGDPMNTSLWKLVRALAGAENGCSCRKCSESILRNDPFGMSEGVCAPCRRAA* |
| Ga0134056_11314321 | 3300012397 | Grasslands Soil | VWELLRGLAALESGRACRCCGEAILAPDRFGMSEGVCRPCRVDAGG* |
| Ga0134051_10593682 | 3300012398 | Grasslands Soil | ERSDPTRNGDPMNTSLWKLVRALAGAENGCSCRKCSESILRNDPFGMSEGVCAPCRRAA* |
| Ga0134061_12957032 | 3300012399 | Grasslands Soil | STERKEAIVTTTVWKLLRGLAGLESGRSCRCCSEAILAADPFGMSEGVCRPCRRATDY* |
| Ga0134048_11724352 | 3300012400 | Grasslands Soil | MATTVWKLLRGLAGLESGRCCRCCGEPILAVDPFGLSEGVCRPCRLSPDC* |
| Ga0134048_13794232 | 3300012400 | Grasslands Soil | DERRSTQMGDTLWKVLRALAGLESGRWCRQCSESISGGDEFGLSEGVCRPCRQAA* |
| Ga0134049_10975221 | 3300012403 | Grasslands Soil | TAWKLLRGLAGLESGRCCRCCGEPILAADPFGLSEGVCRPCRLSPDC* |
| Ga0134049_12824621 | 3300012403 | Grasslands Soil | VMEDHGRRRIMATTVWKLLRGLAGLESGRSCRCCGEAILAADPFGMSESVCRPCRLATGS |
| Ga0134050_13419831 | 3300012407 | Grasslands Soil | TTVWKLLRGLAGLESGRCCRCCGEPILAADPFGLSEGVCRPCRLSPDC* |
| Ga0134045_12644343 | 3300012409 | Grasslands Soil | WELLRGLAALESGRACRCCGEAILAPDRFGMSEGVCRPCRVDAGG* |
| Ga0134060_10077763 | 3300012410 | Grasslands Soil | KLLRGFAGLESGRCCRCCGEPILAADPFGLSEGVCRPCRLSPDY* |
| Ga0157374_113822012 | 3300013296 | Miscanthus Rhizosphere | MIATVWNLVRAATGLETGRECRSCNESIRREDPFGMSEGVCRPCRSGA* |
| Ga0182024_103415292 | 3300014501 | Permafrost | MTVTYRVLKALAGLEQGRSCRCCGESILNGDPFGKSEGVCRPCRNA* |
| Ga0132258_115555601 | 3300015371 | Arabidopsis Rhizosphere | MTTTWRVLRALAGLENGRWCRSCGETIRRGDPFGRSESVCRPCRGDHTHA* |
| Ga0132258_123335332 | 3300015371 | Arabidopsis Rhizosphere | MSVTIWKQFRAIAGVEAGRSCRGCHESILAGDPFGLSEGVCRACRVPGA* |
| Ga0187775_101226831 | 3300017939 | Tropical Peatland | TWRLFRALAGGEAGRSCRCCGESILRVDPFGFSEGVCRPCRLEDG |
| Ga0187786_102603022 | 3300017944 | Tropical Peatland | MSRTITSNNTWLVFRALAGLETGRHCRSCGEAILRADLFGRSEGVCAACRHEAA |
| Ga0187786_103335731 | 3300017944 | Tropical Peatland | MSLTIPGTTWRLFRALAGAEAGRSCRCCGEAILRADPFGRSEGVCRPCRHEAG |
| Ga0187779_101881743 | 3300017959 | Tropical Peatland | MSLTIKGTTWRLFRALAGVEAGRSCRCCGEAILGSDPYGRSEGVCRPCRVEAG |
| Ga0187778_107159012 | 3300017961 | Tropical Peatland | MSLTMKGTTWRLFRALAGVEAGRSCRCCGEAILGSDPYGRSEGVCRPCRLEAG |
| Ga0187776_110785281 | 3300017966 | Tropical Peatland | MRLALSNTTWRLFRALAGGEAGRSCRCCGESILRVDPFGFSEGVCRPCRLEDG |
| Ga0187780_107562912 | 3300017973 | Tropical Peatland | MMHATFKLFQALVGLEAGRACRCCGQAIVDDDPFGMSEGVCRPCRAAA |
| Ga0187777_105393532 | 3300017974 | Tropical Peatland | MSLTITGTTWRLFRALAGVEAGRSCRCCGEAILGSDPYGRSEGVCRPCRVEAG |
| Ga0184610_10347221 | 3300017997 | Groundwater Sediment | MTTTVLNVLRALTGLESGRSCRRCSYSIPAADPFGISEGVCHPCREAAG |
| Ga0184605_100214793 | 3300018027 | Groundwater Sediment | MIYSLLRSIVGLEAGRSCRTCSESISSRDPFGLSEGVCHPCREH |
| Ga0184608_100000048 | 3300018028 | Groundwater Sediment | MIYSLLRSIVGLEAGRSCRACSESISSRDPFGLSEGVCHPCREH |
| Ga0184619_100100025 | 3300018061 | Groundwater Sediment | MGDTLWKVLRALAGLESGRWCRQCSESISGGDEFGMSEGVCLPCRQAA |
| Ga0187773_100461903 | 3300018064 | Tropical Peatland | MSLALSNTTWRLFRALAGGEAGRSCRCCGESILRVDPFGFSEGVCRPCRLEDG |
| Ga0187773_105297372 | 3300018064 | Tropical Peatland | MSLRNTGTTTWRVFRALAGVEAGRYCRRCGEAILRADPFGRSEGVCAACRHEAG |
| Ga0187773_107577421 | 3300018064 | Tropical Peatland | LTIPSTTWRLFRALAGAEAGRSCRCCGEAILRADPFGRSEGVCRPCRHEAG |
| Ga0066667_113131632 | 3300018433 | Grasslands Soil | MGDTLWKVLRALAGLESGRWCRQCSESIPGGDQFGMSEGVCRPCREAA |
| Ga0066667_122834792 | 3300018433 | Grasslands Soil | MNTSLWKLVRALAGAENGCSCRKCSESILRNDPFGMSEGVCAPCRRAA |
| Ga0182025_13825222 | 3300019786 | Permafrost | MTVTYRVLKALAGLEQGRSCRCCGESILNGDPFGKSEGVGRPCRNA |
| Ga0210378_101005762 | 3300021073 | Groundwater Sediment | MIYSLLRSIVGLEAGRSCRTCSESISPRDPFGLSEGVCNPCREH |
| Ga0210384_109726412 | 3300021432 | Soil | MTVTYRVLRALVGLEAGRACRCCGESILDNDPFGKSEGVCRPCRHA |
| Ga0210094_10111572 | 3300025549 | Natural And Restored Wetlands | MTMTVWKVLRALTGVERGRSCRGCGEAILVKDSFGMSEGVCSPCRLAIV |
| Ga0208849_100069520 | 3300025664 | Arctic Peat Soil | MTVYWNLLRALVGLEAGCTCRCCGESILPNDPFGMSESVCRPCRQPTA |
| Ga0207643_101515472 | 3300025908 | Miscanthus Rhizosphere | MIATVWNVVRAATGLENGRECRRCNESIRREDPFGMSEGVCRPCRSGA |
| Ga0207681_103397682 | 3300025923 | Switchgrass Rhizosphere | MIATVWNLVRAATGLENGRECRSCNESIRREDPFGMSEGVCRPCRSA |
| Ga0207659_111764751 | 3300025926 | Miscanthus Rhizosphere | MIATVWNLVRAATGLETGRECRSCNESIRREDPFGMSEGVCRPCRSA |
| Ga0207700_117073962 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKTVFKLFRALAGMEEGRCCRSCGESILRNDPFGLSEGVCRPCRD |
| Ga0207664_104576782 | 3300025929 | Agricultural Soil | MSKTVFKLFRALAGMEAGRCCRTCSEPILGDDPFGLSEGVCRPCRD |
| Ga0210066_10273072 | 3300025951 | Natural And Restored Wetlands | MTITVWKVLRALTGSERGRSCRGCGEAILSRDAFGMSEGVCTPCRAAV |
| Ga0207712_103295431 | 3300025961 | Switchgrass Rhizosphere | PETGGRLIATLRIVSVPRLRLGEPFMIATVWNLVRAATGLETGRECRSCNESIRREDPFGMSEGVCRPCRSA |
| Ga0207698_123189392 | 3300026142 | Corn Rhizosphere | VWGEPFMIATVWNVVRAATGLENGRECRRCNESIRREDPFGMSEGVCRPCRSGA |
| Ga0209887_10124703 | 3300027561 | Groundwater Sand | MSTTWKWLRGLTGLESGRWCRSCEESISASDPFGMSEGVCRPCREEA |
| Ga0209060_101199682 | 3300027826 | Surface Soil | MTTTYRVLRALMGFERGRHCRRCDEAILADDHFGFSEGVCRACRREAF |
| Ga0209168_105309941 | 3300027986 | Surface Soil | MSVTYWKLLRALVGLEAGRSCRCCGEPILNADPFGKSEGVCRPCRES |
| Ga0268264_122407672 | 3300028381 | Switchgrass Rhizosphere | IVSVPRLRLGEPFMIATVWNLVRAATGLETGRECRSCNESIRREDPFGMSEGVCRPCRSA |
| Ga0265338_1000657910 | 3300028800 | Rhizosphere | MSLAIHNTTWRLFRALAGTEAGRSCRCCGESITPADRFGYSEGVCRPCRHEDG |
| Ga0265338_100642774 | 3300028800 | Rhizosphere | MTITYWNLLRALVGLEAGRSCRRCGESILTTDPFGMSEGVCRPCRQA |
| Ga0265338_101198563 | 3300028800 | Rhizosphere | MIHVTYKLFQALVGLEAGRACRCCGQAIVHSDPFGMSEGVCRPCRAA |
| Ga0308309_105673192 | 3300028906 | Soil | MTVTTWKLLRALVGLEAGRSCRRCGESILDSDPFGRSEGVCRPCRAAA |
| Ga0307482_12721771 | 3300030730 | Hardwood Forest Soil | TVTYFKLLRALVGLEAGRCCRSCGESILDSDPFGKSEGVCRPCRAS |
| Ga0073997_100186781 | 3300030997 | Soil | RKSELETVMTMTFWKLFRAMAGVESGCTCRRCTESIGRDDLFGRSEGVCRPCRAGA |
| Ga0073998_116902592 | 3300031023 | Soil | SGIVEPEEDMTMTYRVLRALVGLEAGRSCRCCGESILESDPFGRSEGVCRPCRHA |
| Ga0265327_100877982 | 3300031251 | Rhizosphere | MTVTTYTLLRALVGLEAGRSCRRCGESILGTDPFGQSEGVCRSCRRRGL |
| Ga0307374_100917822 | 3300031670 | Soil | MTVTYWKLFRALVGLEAGRSCRCCGESILDTDPFGKSEGVCRPCRQT |
| Ga0307373_101771922 | 3300031672 | Soil | RLIGETMTVTYWKLFRALVGLEAGRSCRCCGESILDTDPFGKSEGVCRPCRQT |
| Ga0311301_106969032 | 3300032160 | Peatlands Soil | MSLALSNTTWRLFQALAGREAGRSCRSCGEAILPDDRFGFSEGVCRPCRLDHG |
| Ga0335085_100093737 | 3300032770 | Soil | MSLTIKSTTWRLFRALAGVEAGRSCRCCGEAILGSDPYGRSEGVCRPCRLEAG |
| Ga0335085_117423802 | 3300032770 | Soil | MTTTYRVLRALMGLERGRHCRTCDEAILADDHFGLSEGVCRSCRREAF |
| Ga0335085_121061291 | 3300032770 | Soil | MSLAIHNTTWRVFRALAGVESGRSCRCCGESISPGDQFGFSEGVCRPCRHEDG |
| Ga0335082_116395082 | 3300032782 | Soil | RAPRPKERPMSLAIHNTTWRVFRALAGVESGRSCRRCGESISPGDQFGFSEGVCRPCRHEDG |
| Ga0335079_100990985 | 3300032783 | Soil | MSLTITGTTWRLFRALAGVEAGRSCRCCGEAILGSDPYGRSEGVCRPCRLEAG |
| Ga0335079_109300232 | 3300032783 | Soil | MSLKPATSSTTVWRLFRALAGSEAGRSCRSCTESILRDDPFGFSEGVCRPCRAERS |
| Ga0335080_101871573 | 3300032828 | Soil | MSLAITNTTWRLFRALAGSEAGRSCRCCGESIMPVDRFGFSEGVCRPCRHEDG |
| Ga0335070_101028594 | 3300032829 | Soil | MRLAISNSTWRFFRALAGSEAGRSCRCCGESITPVDPFGFSEGVCRPCRHEDG |
| Ga0335081_102704851 | 3300032892 | Soil | ERERPMSLTIKSTTWRLFRALAGVEAGRSCRCCGEAILGSDPYGRSEGVCRPCRLEAG |
| Ga0335069_1000196219 | 3300032893 | Soil | MSLTIPGTTWRLFRALAGAEAGRSCRCCGEAILRVDPFGRSEGVCRPCRLEAG |
| Ga0335069_109544562 | 3300032893 | Soil | MIRVTYKLFQALVGLEAGRSCRCCGQAIVGDDPFGMSEGVCRPCRAAA |
| Ga0335072_102717251 | 3300032898 | Soil | MTTTYRVLRALMGFERGRHCRRCDEAILADDHFGFSEGVCRACRRDAF |
| Ga0335076_101364435 | 3300032955 | Soil | MSLTISGTTWRLFRALAGAESGRSCRCCGEAILGADPFGRSEGVCRPCRLEAG |
| Ga0335077_106610153 | 3300033158 | Soil | MSLTIKSTTWRLFRALAGVEAGRSCRCCGEAILGSDPYGRSEGVCRPCRLE |
| Ga0335077_119501012 | 3300033158 | Soil | KLVQALVGLEAGRACRCCGQAIVDDDPVGMSEGVCRPCRAAA |
| Ga0335077_120265661 | 3300033158 | Soil | WRLFRALAGAEAGRSCRCCGEAILRVDPFGRSEGVCRPCRLEAGS |
| Ga0314864_0045467_300_461 | 3300033805 | Peatland | MSLTIKGTTWRLFRALAGVEAGRSCRCCGEAILGSDPYGRSEGVCRPCRLEAG |
| Ga0314867_039826_3_113 | 3300033808 | Peatland | GVEAGRSCRCCGEAILGSDPYGRSEGVCRPCRLEAG |
| Ga0370545_124577_411_578 | 3300034643 | Soil | REFGGAMTLTTYKLLSALVGLEAGRSCRSCGEPILGTDPFGQSEGVCRPCRHRAS |
| ⦗Top⦘ |