NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045833

Metagenome / Metatranscriptome Family F045833

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045833
Family Type Metagenome / Metatranscriptome
Number of Sequences 152
Average Sequence Length 47 residues
Representative Sequence IAAALVAGVLVLALAGLPMKLNLIVAGVIGILAGTLADFARERWTPR
Number of Associated Samples 138
Number of Associated Scaffolds 152

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.66 %
% of genes near scaffold ends (potentially truncated) 98.03 %
% of genes from short scaffolds (< 2000 bps) 91.45 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.053 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(7.237 % of family members)
Environment Ontology (ENVO) Unclassified
(46.053 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(55.921 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.67%    β-sheet: 0.00%    Coil/Unstructured: 45.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 152 Family Scaffolds
PF05437AzlD 70.39
PF00004AAA 8.55
PF07728AAA_5 7.89
PF13302Acetyltransf_3 3.29
PF05762VWA_CoxE 1.97
PF02518HATPase_c 1.32
PF13245AAA_19 0.66
PF02635DrsE 0.66
PF04392ABC_sub_bind 0.66
PF13432TPR_16 0.66
PF085212CSK_N 0.66
PF08546ApbA_C 0.66
PF03952Enolase_N 0.66
PF13365Trypsin_2 0.66
PF00005ABC_tran 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 152 Family Scaffolds
COG0148EnolaseCarbohydrate transport and metabolism [G] 0.66
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.66
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.66
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.05 %
UnclassifiedrootN/A28.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_14428151Not Available540Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105748546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales617Open in IMG/M
3300001526|A105W1_1217608All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300002074|JGI24748J21848_1006231All Organisms → cellular organisms → Bacteria → Proteobacteria1388Open in IMG/M
3300004479|Ga0062595_101437419All Organisms → cellular organisms → Bacteria → Proteobacteria631Open in IMG/M
3300004643|Ga0062591_100326016All Organisms → cellular organisms → Bacteria → Proteobacteria1225Open in IMG/M
3300005219|Ga0069004_10163338All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300005293|Ga0065715_10449782All Organisms → cellular organisms → Bacteria → Proteobacteria823Open in IMG/M
3300005329|Ga0070683_100340344All Organisms → cellular organisms → Bacteria → Proteobacteria1428Open in IMG/M
3300005334|Ga0068869_101967973Not Available524Open in IMG/M
3300005336|Ga0070680_100382701All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300005344|Ga0070661_101894357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi507Open in IMG/M
3300005345|Ga0070692_11060001Not Available570Open in IMG/M
3300005347|Ga0070668_100040245All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3577Open in IMG/M
3300005347|Ga0070668_101474335All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005353|Ga0070669_101106116All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria682Open in IMG/M
3300005354|Ga0070675_101408223All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas643Open in IMG/M
3300005356|Ga0070674_100358122All Organisms → cellular organisms → Bacteria → Proteobacteria1180Open in IMG/M
3300005364|Ga0070673_100270735All Organisms → cellular organisms → Bacteria → Proteobacteria1486Open in IMG/M
3300005406|Ga0070703_10384641All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300005434|Ga0070709_10401923All Organisms → cellular organisms → Bacteria → Proteobacteria1023Open in IMG/M
3300005437|Ga0070710_10125127All Organisms → cellular organisms → Bacteria → Proteobacteria1561Open in IMG/M
3300005441|Ga0070700_100406770All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300005455|Ga0070663_101681374All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300005543|Ga0070672_100050028All Organisms → cellular organisms → Bacteria → Proteobacteria3254Open in IMG/M
3300005544|Ga0070686_100176218All Organisms → cellular organisms → Bacteria → Proteobacteria1516Open in IMG/M
3300005546|Ga0070696_100109300All Organisms → cellular organisms → Bacteria → Proteobacteria1990Open in IMG/M
3300005578|Ga0068854_101328726All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300005614|Ga0068856_101402359All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300005616|Ga0068852_100588184All Organisms → cellular organisms → Bacteria → Proteobacteria1116Open in IMG/M
3300005617|Ga0068859_101848571Not Available667Open in IMG/M
3300005718|Ga0068866_11264840Not Available535Open in IMG/M
3300005719|Ga0068861_102615524Not Available509Open in IMG/M
3300005842|Ga0068858_101276027All Organisms → cellular organisms → Bacteria → Proteobacteria723Open in IMG/M
3300005843|Ga0068860_100993702All Organisms → cellular organisms → Bacteria → Proteobacteria857Open in IMG/M
3300005844|Ga0068862_100025435All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4970Open in IMG/M
3300005844|Ga0068862_100061259All Organisms → cellular organisms → Bacteria → Proteobacteria3234Open in IMG/M
3300005844|Ga0068862_100409048All Organisms → cellular organisms → Bacteria → Proteobacteria1271Open in IMG/M
3300006050|Ga0075028_100489240All Organisms → cellular organisms → Bacteria → Proteobacteria717Open in IMG/M
3300006057|Ga0075026_100473336All Organisms → cellular organisms → Bacteria → Proteobacteria717Open in IMG/M
3300006224|Ga0079037_100775164All Organisms → cellular organisms → Bacteria → Proteobacteria940Open in IMG/M
3300006237|Ga0097621_101599856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae619Open in IMG/M
3300006237|Ga0097621_101958553All Organisms → cellular organisms → Bacteria → Proteobacteria559Open in IMG/M
3300006358|Ga0068871_100175288All Organisms → cellular organisms → Bacteria1840Open in IMG/M
3300006358|Ga0068871_102100831Not Available538Open in IMG/M
3300006417|Ga0069787_10476447All Organisms → cellular organisms → Bacteria → Proteobacteria581Open in IMG/M
3300006804|Ga0079221_10171318All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300006881|Ga0068865_100340867All Organisms → cellular organisms → Bacteria → Proteobacteria1211Open in IMG/M
3300006881|Ga0068865_102078292All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300009101|Ga0105247_10848693Not Available701Open in IMG/M
3300009131|Ga0115027_11625037Not Available535Open in IMG/M
3300009545|Ga0105237_10089462All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3068Open in IMG/M
3300009545|Ga0105237_12273237Not Available552Open in IMG/M
3300009664|Ga0116146_1027675All Organisms → cellular organisms → Bacteria → Proteobacteria2935Open in IMG/M
3300010373|Ga0134128_10334137All Organisms → cellular organisms → Bacteria → Proteobacteria1695Open in IMG/M
3300010396|Ga0134126_11140548All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300010401|Ga0134121_12262753Not Available582Open in IMG/M
3300012482|Ga0157318_1024773Not Available558Open in IMG/M
3300012943|Ga0164241_10581041All Organisms → cellular organisms → Bacteria → Proteobacteria810Open in IMG/M
3300012961|Ga0164302_10960410All Organisms → cellular organisms → Bacteria → Proteobacteria662Open in IMG/M
3300012985|Ga0164308_10667998All Organisms → cellular organisms → Bacteria → Proteobacteria892Open in IMG/M
3300013100|Ga0157373_10431727All Organisms → cellular organisms → Bacteria → Proteobacteria946Open in IMG/M
3300013102|Ga0157371_10349847All Organisms → cellular organisms → Bacteria → Proteobacteria1076Open in IMG/M
3300013105|Ga0157369_12424885Not Available531Open in IMG/M
3300013770|Ga0120123_1166794Not Available527Open in IMG/M
3300014306|Ga0075346_1147207Not Available545Open in IMG/M
3300014968|Ga0157379_11603069Not Available635Open in IMG/M
3300014969|Ga0157376_12301008Not Available578Open in IMG/M
3300015374|Ga0132255_101571035All Organisms → cellular organisms → Bacteria → Proteobacteria996Open in IMG/M
3300018052|Ga0184638_1102241All Organisms → cellular organisms → Bacteria → Proteobacteria1051Open in IMG/M
3300018078|Ga0184612_10379272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium713Open in IMG/M
3300018422|Ga0190265_13836505Not Available501Open in IMG/M
3300018476|Ga0190274_13492699All Organisms → cellular organisms → Bacteria → Proteobacteria530Open in IMG/M
3300018481|Ga0190271_12680725Not Available598Open in IMG/M
3300018482|Ga0066669_12387189Not Available506Open in IMG/M
3300020082|Ga0206353_10987742All Organisms → cellular organisms → Bacteria → Proteobacteria610Open in IMG/M
3300023071|Ga0247752_1029934All Organisms → cellular organisms → Bacteria → Proteobacteria803Open in IMG/M
3300025321|Ga0207656_10013915All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3087Open in IMG/M
3300025686|Ga0209506_1138171All Organisms → cellular organisms → Bacteria → Proteobacteria703Open in IMG/M
3300025898|Ga0207692_10079145All Organisms → cellular organisms → Bacteria → Proteobacteria1753Open in IMG/M
3300025898|Ga0207692_10101535All Organisms → cellular organisms → Bacteria → Proteobacteria1580Open in IMG/M
3300025906|Ga0207699_10327829All Organisms → cellular organisms → Bacteria → Proteobacteria1076Open in IMG/M
3300025912|Ga0207707_10095850All Organisms → cellular organisms → Bacteria → Proteobacteria2593Open in IMG/M
3300025914|Ga0207671_10014476All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales6231Open in IMG/M
3300025917|Ga0207660_10286919All Organisms → cellular organisms → Bacteria → Proteobacteria1308Open in IMG/M
3300025918|Ga0207662_11158567Not Available550Open in IMG/M
3300025920|Ga0207649_11088212All Organisms → cellular organisms → Bacteria → Proteobacteria630Open in IMG/M
3300025921|Ga0207652_11111748All Organisms → cellular organisms → Bacteria → Proteobacteria691Open in IMG/M
3300025923|Ga0207681_10244966All Organisms → cellular organisms → Bacteria → Proteobacteria1397Open in IMG/M
3300025926|Ga0207659_10426672All Organisms → cellular organisms → Bacteria → Proteobacteria1113Open in IMG/M
3300025932|Ga0207690_10078113Not Available2302Open in IMG/M
3300025935|Ga0207709_11277874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium606Open in IMG/M
3300025936|Ga0207670_10207341All Organisms → cellular organisms → Bacteria → Proteobacteria1493Open in IMG/M
3300025936|Ga0207670_10530401Not Available959Open in IMG/M
3300025940|Ga0207691_11263829All Organisms → cellular organisms → Bacteria → Proteobacteria610Open in IMG/M
3300025942|Ga0207689_11405088Not Available585Open in IMG/M
3300025944|Ga0207661_10053490All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3231Open in IMG/M
3300025944|Ga0207661_11791121Not Available559Open in IMG/M
3300025945|Ga0207679_10247637All Organisms → cellular organisms → Bacteria1513Open in IMG/M
3300025945|Ga0207679_11230884All Organisms → cellular organisms → Bacteria → Proteobacteria687Open in IMG/M
3300025981|Ga0207640_10626245All Organisms → cellular organisms → Bacteria → Proteobacteria914Open in IMG/M
3300025986|Ga0207658_10005838All Organisms → cellular organisms → Bacteria → Proteobacteria8419Open in IMG/M
3300026023|Ga0207677_10832993Not Available828Open in IMG/M
3300026023|Ga0207677_11290468Not Available670Open in IMG/M
3300026088|Ga0207641_12008606All Organisms → cellular organisms → Bacteria → Proteobacteria579Open in IMG/M
3300026118|Ga0207675_101781880All Organisms → cellular organisms → Bacteria → Proteobacteria635Open in IMG/M
3300026121|Ga0207683_12100179Not Available513Open in IMG/M
3300027462|Ga0210000_1046123Not Available696Open in IMG/M
3300027716|Ga0209682_10104050Not Available717Open in IMG/M
3300027871|Ga0209397_10381841Not Available687Open in IMG/M
3300027899|Ga0209668_10712552All Organisms → cellular organisms → Bacteria → Proteobacteria674Open in IMG/M
3300028379|Ga0268266_11639202All Organisms → cellular organisms → Bacteria → Proteobacteria619Open in IMG/M
3300028379|Ga0268266_11852848Not Available578Open in IMG/M
3300028380|Ga0268265_10246447Not Available1580Open in IMG/M
3300028665|Ga0302160_10027974Not Available1069Open in IMG/M
3300028736|Ga0302214_1086864All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria656Open in IMG/M
3300028809|Ga0247824_10280038All Organisms → cellular organisms → Bacteria → Proteobacteria933Open in IMG/M
3300028812|Ga0247825_10228109All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1291Open in IMG/M
3300028861|Ga0302259_1029216All Organisms → cellular organisms → Bacteria → Proteobacteria1272Open in IMG/M
3300028869|Ga0302263_10316901All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas618Open in IMG/M
3300029987|Ga0311334_10124636All Organisms → cellular organisms → Bacteria → Proteobacteria1922Open in IMG/M
3300029989|Ga0311365_11671794Not Available545Open in IMG/M
3300030002|Ga0311350_10297424All Organisms → cellular organisms → Bacteria → Proteobacteria1441Open in IMG/M
3300030003|Ga0302172_10027619All Organisms → cellular organisms → Bacteria → Proteobacteria1654Open in IMG/M
3300030052|Ga0302217_10123066All Organisms → cellular organisms → Bacteria → Proteobacteria601Open in IMG/M
3300031241|Ga0265325_10142810All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1137Open in IMG/M
3300031716|Ga0310813_12317899Not Available509Open in IMG/M
3300031726|Ga0302321_103621228All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria502Open in IMG/M
3300031852|Ga0307410_10814144Not Available795Open in IMG/M
3300031873|Ga0315297_11095103All Organisms → cellular organisms → Bacteria → Proteobacteria656Open in IMG/M
3300031913|Ga0310891_10254938Not Available607Open in IMG/M
3300031918|Ga0311367_10759911All Organisms → cellular organisms → Bacteria → Proteobacteria982Open in IMG/M
3300031938|Ga0308175_102955821All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria529Open in IMG/M
3300031939|Ga0308174_11025870All Organisms → cellular organisms → Bacteria → Proteobacteria700Open in IMG/M
3300032002|Ga0307416_100969091Not Available953Open in IMG/M
3300032004|Ga0307414_11625661Not Available602Open in IMG/M
3300032005|Ga0307411_12034827Not Available536Open in IMG/M
3300032013|Ga0310906_10136772All Organisms → cellular organisms → Bacteria → Proteobacteria1408Open in IMG/M
3300032017|Ga0310899_10107779Not Available1135Open in IMG/M
3300032053|Ga0315284_11277054All Organisms → cellular organisms → Bacteria → Proteobacteria799Open in IMG/M
3300032256|Ga0315271_11296605All Organisms → cellular organisms → Bacteria → Proteobacteria629Open in IMG/M
3300032275|Ga0315270_10362534All Organisms → cellular organisms → Bacteria → Proteobacteria919Open in IMG/M
3300032397|Ga0315287_10443480All Organisms → cellular organisms → Bacteria → Proteobacteria1540Open in IMG/M
3300032516|Ga0315273_11493881All Organisms → cellular organisms → Bacteria → Proteobacteria831Open in IMG/M
3300032516|Ga0315273_11848405All Organisms → cellular organisms → Bacteria → Proteobacteria724Open in IMG/M
3300032782|Ga0335082_10480810Not Available1104Open in IMG/M
3300033412|Ga0310810_10221625All Organisms → cellular organisms → Bacteria → Proteobacteria2112Open in IMG/M
3300033418|Ga0316625_101231423All Organisms → cellular organisms → Bacteria → Proteobacteria688Open in IMG/M
3300033480|Ga0316620_10277088All Organisms → cellular organisms → Bacteria → Proteobacteria1454Open in IMG/M
3300033521|Ga0316616_104272928Not Available538Open in IMG/M
3300033551|Ga0247830_10315647All Organisms → cellular organisms → Bacteria → Proteobacteria1201Open in IMG/M
3300034195|Ga0370501_0147162All Organisms → cellular organisms → Bacteria → Proteobacteria814Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen7.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.58%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.26%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.26%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.61%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.95%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.29%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.29%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.63%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.63%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere2.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.63%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.97%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.32%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.32%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.32%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.32%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge1.32%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.66%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.66%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.66%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.66%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.66%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.66%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.66%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.66%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.66%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.66%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.66%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.66%
Enhanced Biological Phosphorus Removal BioreactorEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001526Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002074Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1Host-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005219Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006417Combined Assembly of Gp0110018, Gp0110022, Gp0110020EngineeredOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009664Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaGEngineeredOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012482Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510Host-AssociatedOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014306Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025686Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027462Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027716Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027871Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028665Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3EnvironmentalOpen in IMG/M
3300028736Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028861Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4EnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030003Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3EnvironmentalOpen in IMG/M
3300030052Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3EnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1442815133300000363SoilVSGFAVVAFVGLPMNLNLIVAGLIGIVAGTLADFARERWMPR*
INPhiseqgaiiFebDRAFT_10574854633300000364SoilVLAATSAGIAVLALTHLPMRLNLIVAGVIGIVIGTLADLARERWKPR*
A105W1_121760823300001526PermafrostVVAGVAVMALAGLPMNLNLIAAGVIGIVAGTLADFARERWITR*
JGI24748J21848_100623133300002074Corn, Switchgrass And Miscanthus RhizosphereIAFAGLPMKLNLIVAGLTGIVAGTLADFARERWMPR*
Ga0062595_10143741933300004479SoilGIAVLALAHLPMKLNLVVAGLIGIAVGTIADLARERWKPR*
Ga0062591_10032601633300004643SoilAAGLVAAVAVIALDALPMKLSLVAAGLVGIVAGTLADVARERWTAR*
Ga0069004_1016333833300005219Natural And Restored WetlandsVLAAVTAGIAAIALAHLPMRLNLIVAGLLGILVGTLADLARERWTAR*
Ga0065715_1044978233300005293Miscanthus RhizosphereHFRSYPTITAALVSAFAVIAFAGLPMKLNLIVAGLTGIVAGTLADFARERWMPR*
Ga0070683_10034034433300005329Corn RhizosphereAPHFRSYPTITAALVSAFAVIAFAGLPMKLNLIVAGLTGIVAGTLADFARERWMPR*
Ga0068869_10196797323300005334Miscanthus RhizosphereHMRTAPTIGAALVAGCAVIALSALPMRLNLIVAGTLGIVAGTLADFARERWTRR*
Ga0070680_10038270133300005336Corn RhizospherePSLLAAVVAGAAELALKGLPMKLNLIAAGLIGIVAGTVAEIVRERWTRR*
Ga0070661_10189435723300005344Corn RhizospherePSLIAAVTAGVAVLALAALPMRLNLIVAALLGILAGTLVDLMQARWTQR*
Ga0070692_1106000113300005345Corn, Switchgrass And Miscanthus RhizosphereHFRSYPTITAALVAAFAVIAFAGLPMKLNLIVAGVIGIAAGTLADFARERWTPR*
Ga0070668_10004024513300005347Switchgrass RhizosphereNTPMVIAAVVGGVAVLALDSMPMKLNLIAAGVLGIMAGTVADIARERWTAR*
Ga0070668_10147433513300005347Switchgrass RhizosphereISAGVAVVALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR*
Ga0070669_10110611613300005353Switchgrass RhizosphereFAVIAFAGLPMKLNLIVAGLTGIVAGTLADFARERWMPR*
Ga0070675_10140822313300005354Miscanthus RhizospherePLFRDVPSVLAAITAGIAVLALSHLPMKLNLMAAGVLGIVIGTLADLLRERWKPR*
Ga0070674_10035812213300005356Miscanthus RhizosphereAGYAVVALGGLPMKLNLIAAGVIGIAAGTIADLARERWTRR*
Ga0070673_10027073543300005364Switchgrass RhizosphereLLRDAPTILSAIVAGYAVVALGGLPMNLNLIAAGVIGIAAGTIADLARERWTRR*
Ga0070703_1038464113300005406Corn, Switchgrass And Miscanthus RhizosphereSVLAAITAGIAVLALSHLPMKLNLMAAGVLGIVIGTLADLLRERWKPR*
Ga0070709_1040192333300005434Corn, Switchgrass And Miscanthus RhizosphereFRTSPTITAALAAGLAVIALRELPMNLNLIVAGVIGIVAGTLADFAHERWTAR*
Ga0070710_1012512743300005437Corn, Switchgrass And Miscanthus RhizospherePHFRTSPTIVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR*
Ga0070700_10040677033300005441Corn, Switchgrass And Miscanthus RhizosphereLFRDTPSVLAAITAGIAVLALAHLPMKLNLVVAGLIGIAVGTIADLARERWKPR*
Ga0070663_10168137413300005455Corn RhizosphereDVPAVLAATSAGIAVLALAHLPMKLNLIVAGLIGIAMGTVADLARERWRAR*
Ga0070672_10005002813300005543Miscanthus RhizosphereGYAVIALSALPMKLNLIVAGTLGIVAGTLADFARERWTRR*
Ga0070686_10017621843300005544Switchgrass RhizosphereAPLFRDVPSVLAAITAGIAVLALSHLPMKLNLMAAGVLGIVIGTLADLLRERWKPR*
Ga0070696_10010930043300005546Corn, Switchgrass And Miscanthus RhizospherePSVLAAITAGIAVLALSHLPMKLNLMAAGVLGIVIGTLADLLRERWKPR*
Ga0068854_10132872633300005578Corn RhizospherePLFRDTPSVLAAITAGIAVLALAHLPMKLNLVVAGLIGIAVGTIADLARERWKPR*
Ga0068856_10140235933300005614Corn RhizospherePNVVAALTAGVAVIALDALPMRLNLIAAALLGIAAGTLTDLARTRSTRP*
Ga0068852_10058818413300005616Corn RhizosphereIVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR*
Ga0068859_10184857133300005617Switchgrass RhizosphereVLALAHLPMRLNLIAAGLIGILVGTLADLARERWTPR*
Ga0068866_1126484033300005718Miscanthus RhizosphereLAHLPMRLNLIAAGLIGILVGTLADLARERWTPR*
Ga0068861_10261552423300005719Switchgrass RhizospherePSVLAALTAGIAVLALAHLPMKLNLIVAGIIGILVGTLADLAKERWKAR*
Ga0068858_10127602733300005842Switchgrass RhizosphereAGIAVLVLAHLPMKLNLIVAGIIGILVGTLADLARERWKAR*
Ga0068860_10099370233300005843Switchgrass RhizosphereLAHLPMKLNLIVAGIIGILVGTLADLARERWKAR*
Ga0068862_10002543513300005844Switchgrass RhizosphereAVLALAHLPMRLNLVVAGLIGIAVGTIADLARERWKPR*
Ga0068862_10006125913300005844Switchgrass RhizosphereLRNAPMVIAAVVGGVAVLALDSMPMKLNLIAAGVLGIMAGTVADIARERWTAR*
Ga0068862_10040904833300005844Switchgrass RhizosphereVLALESLPMHLNLIVAGLLGILAGTLADFAAERWTSR*
Ga0075028_10048924033300006050WatershedsRGLLPVIAAVTAGVAVIALAGFPMRLNLVVAGILGILAGTAAELLRERWKAR*
Ga0075026_10047333633300006057WatershedsPTILAAVVAGIAVFALDGLPMKLNLIAAGLIGIVAGTIADLMRDRWTRR*
Ga0079037_10077516413300006224Freshwater WetlandsPNVTAALVAAVAVLAFGALPMKLNLVVAGVLGIVAGTLAELAGERWKAR*
Ga0097621_10159985613300006237Miscanthus RhizosphereLVAPHFRTSPTIVAALVAGFGVLALAALPMKLSLIVAGVAGIVAGTLADFAKERWTAR*
Ga0097621_10195855313300006237Miscanthus RhizosphereAPTILSAIVAGYAVVALGGLPMKLNLIAAGVIGIAAGTIADLARERWTRR*
Ga0068871_10017528843300006358Miscanthus RhizosphereLAGVAVVALDGLPMRLNLIAAGVVGILAGTAIDLAQARWTRR*
Ga0068871_10210083113300006358Miscanthus RhizospherePHFRSFPTISAALVSAYAVSAFAGLPMKLNLIVAGMIGIAAGTLADFAQERWTPR*
Ga0069787_1047644733300006417Enhanced Biological Phosphorus Removal BioreactorATTAGIAVLALAHLPMRLNLIAAGLLGIAAGTLADFARERWKAR*
Ga0079221_1017131833300006804Agricultural SoilVLALAGLPMKLNLIVAGVIGILAGTLADFARERWTPR*
Ga0068865_10034086713300006881Miscanthus RhizosphereAVLALDALPMKLSLVAAGLIGIVAGTIVDLMRERWTAR*
Ga0068865_10207829213300006881Miscanthus RhizosphereAGVAVVALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR*
Ga0105247_1084869333300009101Switchgrass RhizospherePLFRDAPSVLAALTAGIAVLALAHLPMKLNLIVAGIIGILVGTLADLAKERWKAR*
Ga0115027_1162503723300009131WetlandTAALVAAVAVLAFGALPMKLNLVVAGVLGIVAGTLAELAGERWKAR*
Ga0105237_1008946253300009545Corn RhizosphereSPTIVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR*
Ga0105237_1227323713300009545Corn RhizosphereHFRTSPTIVAALVAGFGVLALAALPMKLSLIVAGVAGIVAGTLADFAKERWTAR*
Ga0116146_102767553300009664Anaerobic Digestor SludgePSVVAAVAAGVAVLALAGLPMRLSLIAAGLIGIVAGTVVDFSGERWKAR*
Ga0134128_1033413743300010373Terrestrial SoilTAALAAGLAVIALRGLPMNLNLIVAGVIGIVAGTLADFAHERWTAR*
Ga0134126_1114054833300010396Terrestrial SoilIAPHLNTVPTLVAATSAAVAVFALAGLPMKLNLIAAGVAGIVAGTLVDLARERWSAR*
Ga0134121_1226275313300010401Terrestrial SoilALVAPHFRSFPTISAALVSGYAVMAFAGLPMKLNLIVAGLIGIAAGTLADFAQERWTPR*
Ga0157318_102477323300012482Arabidopsis RhizosphereLVSGFAVIAFAGLPMKLNLIVAGLIGIVAGTLADFTRDRWMPR*
Ga0164241_1058104133300012943SoilAGYAVIALSTLPMKLNLIAAGTIGIVAGTLADFARERWTRR*
Ga0164302_1096041013300012961SoilLVAPHFRSAPTIVAAVAAGVAVMALAGLPMNLNLIAAGVIGIVAGTLADFARERWTTR*
Ga0164308_1066799833300012985SoilVSAFAGLPMKLNLIVAGMIGIAAGTLADFAQERWTPR*
Ga0157373_1043172733300013100Corn RhizosphereVAGYAVIALSALPMKLNLIVAGTIGIVAGTLADFARERWTRR*
Ga0157371_1034984733300013102Corn RhizosphereLAFASLPMKLSLIVAGVAGIVAGTLADFTKERWTAR*
Ga0157369_1242488523300013105Corn RhizosphereVAGVGVLALASLPMKLNLIVAGVAGIVAGTLADFAQERWTAR*
Ga0120123_116679413300013770PermafrostLVAPHSRPSPTIMAGLVAAYAVIGLSGLPMNLNLIVAGVLGIVAGTLADFARERRTPR*
Ga0075346_114720723300014306Natural And Restored WetlandsAATAGGLVLALAGLPMKLNLIVAGVIGIVAGTLTDLARERWKAD*
Ga0157379_1160306913300014968Switchgrass RhizosphereIAALVAGVAVLALESLPMHLNLIVAGLLGILAGTLADFAAERWTSR*
Ga0157376_1230100823300014969Miscanthus RhizosphereAPHFRSFPTISAALVSGYAVVAFAGLPMKLNLIVAGLIGIAAGTLADFAQERWTPR*
Ga0132255_10157103533300015374Arabidopsis RhizosphereIAAALVAGVLVLALAGLPMKLNLIVAGVIGILAGTLADFARERWTPR*
Ga0184638_110224133300018052Groundwater SedimentPLFRDAPSVLAATSAGVAVLALTHLPMRLNLIVAGVIGIVIGTLADLARERWKPR
Ga0184612_1037927223300018078Groundwater SedimentMILAALVAGVAVIALDGLPMKLNLIVAGVIGIVAGTLADLMRERWTRR
Ga0190265_1383650523300018422SoilIAPLFRSGPVILAGVVAGIAVMALDAMPMKLNLIVAGMLGIAAGTLADLAKEAWHSR
Ga0190274_1349269923300018476SoilFRNTPSVLAAISAGVAVIALAHLPMRLNLIAAGLIGIVVGTVADLAKERWTQR
Ga0190271_1268072513300018481SoilLALDALPMKLNLIVAGALGIVAGTLFDVATARKEPR
Ga0066669_1238718923300018482Grasslands SoilAFAAGLDAGVAVLALEALPMKLSLVAAGLIGIVAGTIVDLTRERWTAR
Ga0206353_1098774233300020082Corn, Switchgrass And Miscanthus RhizosphereLVAAFAVIAFAGLPMKLNLIVAGVIGIAAGTLADFAWERWTPR
Ga0247752_102993433300023071SoilTAALVSAFAVIAFAGLPMKLNLIVAGLTGIVAGTLADFARERWMPR
Ga0207656_1001391513300025321Corn RhizosphereAPSVLAAISAGVAVVALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR
Ga0209506_113817133300025686Anaerobic Digestor SludgeVLALAGLPMRLSLIAAGLIGIVAGTVVDFSGERWKAR
Ga0207692_1007914513300025898Corn, Switchgrass And Miscanthus RhizosphereAPGLRSTPSLLAAVVAGAAVLALKGLPMKLNLIAAGLIGIVAGTVAEIVRERWTRR
Ga0207692_1010153513300025898Corn, Switchgrass And Miscanthus RhizosphereLVAPHFRTSPTIVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR
Ga0207699_1032782913300025906Corn, Switchgrass And Miscanthus RhizosphereFRTSPTITAALAAGLAVIALRELPMNLNLIVAGVIGIVAGTLADFAHERWTAR
Ga0207707_1009585053300025912Corn RhizosphereGVLALAALPMKLNLIVAGVAGIVAGTVADFAKERWTAR
Ga0207671_1001447613300025914Corn RhizosphereSPTIVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR
Ga0207660_1028691933300025917Corn RhizospherePSLLAAVVAGAAVLALKGLPMKLNLIAAGLIGIVAGTVAEIVRERWTRR
Ga0207662_1115856723300025918Switchgrass RhizosphereHLRTVPTIAAALCAGVAVLALGGLPMRLNLIAAGVLGIVAGTFADFARERWTPR
Ga0207649_1108821233300025920Corn RhizospherePHFRTSPTIVAALVAGAGVLALAWLPMKLNLIVAGVAGIVAGTLADFAKERWTAR
Ga0207652_1111174833300025921Corn RhizosphereSPTIIAALVAGVGVLALASLPMKLNLIVAGVAGILAGTLADFAKEQWTPR
Ga0207681_1024496613300025923Switchgrass RhizosphereRNTPMVIAAVVGGVAVLALDSMPMKLNLIAAGVLGIMAGTVADIARERWTAR
Ga0207659_1042667233300025926Miscanthus RhizospherePLFRDTPSVLAAITAGIAVLALAHLPMRLNLVVAGLIGIAVGTIADFARERWKPR
Ga0207690_1007811313300025932Corn RhizosphereRSYPTITAALVSAFAVIAFAGLPMKLNLIVAGLTGIVAGTLADFARERWMPR
Ga0207709_1127787413300025935Miscanthus RhizosphereALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR
Ga0207670_1020734113300025936Switchgrass RhizosphereALVAPLFRDVPSVLAAITAGIAVLALSHLPMKLNLMAAGVLGIVIGTLADLLRERWKPR
Ga0207670_1053040113300025936Switchgrass RhizosphereTVIAALVAGVAVLALESLPMHLNLIVAGLLGILAGTLADFAAERWTSR
Ga0207691_1126382933300025940Miscanthus RhizosphereAAITAGIAVLALAHLPMRLNLIAAGLIGILVGTLADLARERWTPR
Ga0207689_1140508823300025942Miscanthus RhizosphereALVAPHMRTAPTIGAALVAGCAVIALSALPMRLNLIVAGTLGIVAGTLADFARERWTRR
Ga0207661_1005349063300025944Corn RhizosphereIAFAGLPMNLNLIVAGLIGIVAGTLVDFARDRWMPR
Ga0207661_1179112113300025944Corn RhizosphereALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR
Ga0207679_1024763743300025945Corn RhizosphereHFRTSPTIVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR
Ga0207679_1123088433300025945Corn RhizosphereTIGAALVAGYAVIALSALPMKLNLIVAGTIGIVSGTLADFARERWTRR
Ga0207640_1062624513300025981Corn RhizosphereVAGVGVLAFASLPMKLSLIVAGVAGIVAGTLADFTKERWTAR
Ga0207658_1000583813300025986Switchgrass RhizosphereAGVAVVALDGLPMRLNLIAAGVVGILAGTAIDLAQARWTRR
Ga0207677_1083299313300026023Miscanthus RhizosphereAGVAVVALDGLPMRLNLIAAGLVGILAGTAIDLAQARWTRR
Ga0207677_1129046833300026023Miscanthus RhizosphereRSPPTVIAALVAGVAVLALESLPMHLNLIVAGLLGILAGTLADFAAERWTSR
Ga0207641_1200860613300026088Switchgrass RhizosphereSVLAAISAGVAVVALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR
Ga0207675_10178188013300026118Switchgrass RhizospherePVFRNAPSVLAAISAGVAVVALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR
Ga0207683_1210017913300026121Miscanthus RhizosphereAVLVLAHLPMKLNLIVAGIIGILVGTLADLARERWKAR
Ga0210000_104612333300027462Arabidopsis Thaliana RhizosphereMLTAPTIGAALVAGYAVIALSALPMKLNLIVAGTIGIVAGTLADFARERWTRR
Ga0209682_1010405013300027716Wetland SedimentVAAATAGIFVLALAGLPMKLNLIVAGVIGIVAGTLADLARERWKAR
Ga0209397_1038184113300027871WetlandPNVTAALVAAVAVLAFGALPMKLNLVVAGVLGIVAGTLAELAGERWKAR
Ga0209668_1071255233300027899Freshwater Lake SedimentVLRELPVIVAAVTAGGFVLALAALPMKLNLIVAGVIGIVAGTLTDLARERWKAR
Ga0268266_1163920213300028379Switchgrass RhizospherePLFRDVPAVLAATSAGIAVLALAHLPMKLNLIVAGLIGIAMGTVADLARERWRAR
Ga0268266_1185284813300028379Switchgrass RhizosphereAPLFRDAPSVLAAVSAAIAVLALAHLPMKLNLIVAGIIGIAMGTLADLARERWKAR
Ga0268265_1024644713300028380Switchgrass RhizosphereAALVAGVAVLALASLPMHLNLIVAGLLGILAGTLADFAAERWTSR
Ga0302160_1002797413300028665FenAVVAGAAVVALGGLPMKLNLIAAGVIGIVVGTIADLARERWMRR
Ga0302214_108686433300028736FenMPNIAAAGVAGVAVVVLGGLPMKLNLIAAGVIGIIVGTLADLLRERWTRH
Ga0247824_1028003833300028809SoilGIAVLALAHLPMRLNLIAAGLIGILVGTLADLARERWTPR
Ga0247825_1022810913300028812SoilVIALSALPMRLNLIVAGTLGIVAGTLADFARERWTRR
Ga0302259_102921613300028861FenLLRDMPNIAAAVVAGVAVVALGWLPMKLNLIAAGVVGIVVGTLADLARERWTRR
Ga0302263_1031690133300028869FenPLMRDLPNIAAAVVAGVAVVVLGGLPMKLNLIAAGVIGIIVGTLADLARERWTRP
Ga0311334_1012463613300029987FenLLRDMPNIAAAVFAGVAVVALGWLPMKLNLIAAGVVGIVVGTLADLARERWTRR
Ga0311365_1167179413300029989FenAMSHLPMRLNLIVAGMLGIIVGMLADLAKARWMPR
Ga0311350_1029742413300030002FenPTILAAVVAGVAVVALGGLPMKLNLIAAGVIGIVAGTLADIARERWTRR
Ga0302172_1002761943300030003FenAGMAVVALGGLPMKLNLIAAGVIGIVVGTIADLARERWMRR
Ga0302217_1012306613300030052FenLRDMPNIAAAVTAGIAVVALAGLPMKLYLIAAGVIGIIVGTLADLARERWTRR
Ga0265325_1014281033300031241RhizosphereSAPHVLAAVVAGVAVMALDALPMRLNLVVAGVLGIVAGLAVEMAEARWKAR
Ga0310813_1231789913300031716SoilPHFRSYPTITAALVAAFAVIAFAGLPMKLNLIVAGVIGIAAGTLADFARERWTPR
Ga0302321_10362122823300031726FenMRDPPTILAAVVAGIAVVALDGLPMKLNLIAAGVIGIVAGTLADLARERWTRR
Ga0307410_1081414413300031852RhizosphereVAAACAGVAVAALEGLPMRLNLIAAGLIGIAAGTLADLANERWTPR
Ga0315297_1109510333300031873SedimentVVALGGLPMKLNLIAAGLIGIAAGTMADLARERWTRR
Ga0310891_1025493813300031913SoilMAGLMAAIAVVVLAALPMKLALIAAGLIGIVAGTLVDLARERWTAR
Ga0311367_1075991113300031918FenVAGVAVVVLGGLPMKLNLIAAGVIGIIVGTLADLTRERWTRR
Ga0308175_10295582113300031938SoilIAPALRSLPTVVAAVVAAVLVVATAGLPMRLNLVVAGVAGIVAGTLADALRTRRARA
Ga0308174_1102587033300031939SoilLVAAATAGVAVVALAALPMRLNLIVAALLGIAAGTLADLLGARWRR
Ga0307416_10096909133300032002RhizosphereSAGVAVMALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR
Ga0307414_1162566133300032004RhizosphereNAPSLVAAACAGVAVAALEGLPMRLNLIAAGLIGIAAGTLADLANERWTPR
Ga0307411_1203482713300032005RhizosphereVIALSVLPMKLNLIVAGTIGIVAGTLADFARERWTQR
Ga0310906_1013677213300032013SoilVIALDGLPMRLNLIAAGVAGIVAGTLIEIGRERWTRA
Ga0310899_1010777943300032017SoilPAVMAGLMAAIAVVVLAALPMKLALIAAGLIGIVAGTLVDLARERWTAR
Ga0315284_1127705433300032053SedimentFVLALAALPMKLNLIVAGVIGIVAGTLTDLARERWKAR
Ga0315271_1129660513300032256SedimentILAAVVAGASVVALGGLPMRLNLIAAGVIGIAAGTLADLVRERWTRH
Ga0315270_1036253433300032275SedimentVTAGGFVLALAALPMKLNLIVAGVIGILAGTLTDLARERWKAR
Ga0315287_1044348043300032397SedimentRDAPTIVAAIVAGIAVVALGGLPMKLNLIAAGVIGITAGTIADLARERWMRR
Ga0315273_1149388113300032516SedimentALAALPMKLNLIVAGVIGIVAGTLTDLARERWKAR
Ga0315273_1184840533300032516SedimentREVPVIVAAVTAGGFVLALAALPMKLNLIVAGVIGIVAGTLTDLARERWKAR
Ga0335082_1048081013300032782SoilGVAVLALAGLPMRLNLIVAGLIGIAVGTIADLAGERWKPR
Ga0310810_1022162513300033412SoilPTIVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR
Ga0316625_10123142313300033418SoilRDAPSVVAAVTAGIAVLAMSHLPMRLNLIVAGVLGIVAGTLADLARERWKAR
Ga0316620_1027708833300033480SoilMPSIVAAIVSGFAVLALSGLPMKLNLIVAGTLGIVAGTLADLTKERWTRR
Ga0316616_10427292813300033521SoilPVIVAAVTAGTFVLALAALPMKLNLIVAGVIGILAGTLTDLARERWKAR
Ga0247830_1031564733300033551SoilLALAHLPMRLNLIAAGLIGILVGTLADLARERWTPR
Ga0370501_0147162_676_8133300034195Untreated Peat SoilSAIVAGVAVVLLDALPMKLNLIAAGLVGIVAGTCADIARERWTRR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.