| Basic Information | |
|---|---|
| Family ID | F045833 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 47 residues |
| Representative Sequence | IAAALVAGVLVLALAGLPMKLNLIVAGVIGILAGTLADFARERWTPR |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.66 % |
| % of genes near scaffold ends (potentially truncated) | 98.03 % |
| % of genes from short scaffolds (< 2000 bps) | 91.45 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.053 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (7.237 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.053 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.921 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.67% β-sheet: 0.00% Coil/Unstructured: 45.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF05437 | AzlD | 70.39 |
| PF00004 | AAA | 8.55 |
| PF07728 | AAA_5 | 7.89 |
| PF13302 | Acetyltransf_3 | 3.29 |
| PF05762 | VWA_CoxE | 1.97 |
| PF02518 | HATPase_c | 1.32 |
| PF13245 | AAA_19 | 0.66 |
| PF02635 | DrsE | 0.66 |
| PF04392 | ABC_sub_bind | 0.66 |
| PF13432 | TPR_16 | 0.66 |
| PF08521 | 2CSK_N | 0.66 |
| PF08546 | ApbA_C | 0.66 |
| PF03952 | Enolase_N | 0.66 |
| PF13365 | Trypsin_2 | 0.66 |
| PF00005 | ABC_tran | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.66 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.66 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.66 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.05 % |
| Unclassified | root | N/A | 28.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_14428151 | Not Available | 540 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105748546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 617 | Open in IMG/M |
| 3300001526|A105W1_1217608 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300002074|JGI24748J21848_1006231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1388 | Open in IMG/M |
| 3300004479|Ga0062595_101437419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300004643|Ga0062591_100326016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1225 | Open in IMG/M |
| 3300005219|Ga0069004_10163338 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005293|Ga0065715_10449782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300005329|Ga0070683_100340344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1428 | Open in IMG/M |
| 3300005334|Ga0068869_101967973 | Not Available | 524 | Open in IMG/M |
| 3300005336|Ga0070680_100382701 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300005344|Ga0070661_101894357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 507 | Open in IMG/M |
| 3300005345|Ga0070692_11060001 | Not Available | 570 | Open in IMG/M |
| 3300005347|Ga0070668_100040245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3577 | Open in IMG/M |
| 3300005347|Ga0070668_101474335 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005353|Ga0070669_101106116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 682 | Open in IMG/M |
| 3300005354|Ga0070675_101408223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 643 | Open in IMG/M |
| 3300005356|Ga0070674_100358122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1180 | Open in IMG/M |
| 3300005364|Ga0070673_100270735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1486 | Open in IMG/M |
| 3300005406|Ga0070703_10384641 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005434|Ga0070709_10401923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1023 | Open in IMG/M |
| 3300005437|Ga0070710_10125127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1561 | Open in IMG/M |
| 3300005441|Ga0070700_100406770 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300005455|Ga0070663_101681374 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005543|Ga0070672_100050028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3254 | Open in IMG/M |
| 3300005544|Ga0070686_100176218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1516 | Open in IMG/M |
| 3300005546|Ga0070696_100109300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1990 | Open in IMG/M |
| 3300005578|Ga0068854_101328726 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005614|Ga0068856_101402359 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005616|Ga0068852_100588184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1116 | Open in IMG/M |
| 3300005617|Ga0068859_101848571 | Not Available | 667 | Open in IMG/M |
| 3300005718|Ga0068866_11264840 | Not Available | 535 | Open in IMG/M |
| 3300005719|Ga0068861_102615524 | Not Available | 509 | Open in IMG/M |
| 3300005842|Ga0068858_101276027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 723 | Open in IMG/M |
| 3300005843|Ga0068860_100993702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 857 | Open in IMG/M |
| 3300005844|Ga0068862_100025435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4970 | Open in IMG/M |
| 3300005844|Ga0068862_100061259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3234 | Open in IMG/M |
| 3300005844|Ga0068862_100409048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1271 | Open in IMG/M |
| 3300006050|Ga0075028_100489240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300006057|Ga0075026_100473336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300006224|Ga0079037_100775164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
| 3300006237|Ga0097621_101599856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 619 | Open in IMG/M |
| 3300006237|Ga0097621_101958553 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300006358|Ga0068871_100175288 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300006358|Ga0068871_102100831 | Not Available | 538 | Open in IMG/M |
| 3300006417|Ga0069787_10476447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300006804|Ga0079221_10171318 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300006881|Ga0068865_100340867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1211 | Open in IMG/M |
| 3300006881|Ga0068865_102078292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300009101|Ga0105247_10848693 | Not Available | 701 | Open in IMG/M |
| 3300009131|Ga0115027_11625037 | Not Available | 535 | Open in IMG/M |
| 3300009545|Ga0105237_10089462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3068 | Open in IMG/M |
| 3300009545|Ga0105237_12273237 | Not Available | 552 | Open in IMG/M |
| 3300009664|Ga0116146_1027675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2935 | Open in IMG/M |
| 3300010373|Ga0134128_10334137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1695 | Open in IMG/M |
| 3300010396|Ga0134126_11140548 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300010401|Ga0134121_12262753 | Not Available | 582 | Open in IMG/M |
| 3300012482|Ga0157318_1024773 | Not Available | 558 | Open in IMG/M |
| 3300012943|Ga0164241_10581041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
| 3300012961|Ga0164302_10960410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300012985|Ga0164308_10667998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
| 3300013100|Ga0157373_10431727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
| 3300013102|Ga0157371_10349847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1076 | Open in IMG/M |
| 3300013105|Ga0157369_12424885 | Not Available | 531 | Open in IMG/M |
| 3300013770|Ga0120123_1166794 | Not Available | 527 | Open in IMG/M |
| 3300014306|Ga0075346_1147207 | Not Available | 545 | Open in IMG/M |
| 3300014968|Ga0157379_11603069 | Not Available | 635 | Open in IMG/M |
| 3300014969|Ga0157376_12301008 | Not Available | 578 | Open in IMG/M |
| 3300015374|Ga0132255_101571035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 996 | Open in IMG/M |
| 3300018052|Ga0184638_1102241 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1051 | Open in IMG/M |
| 3300018078|Ga0184612_10379272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300018422|Ga0190265_13836505 | Not Available | 501 | Open in IMG/M |
| 3300018476|Ga0190274_13492699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300018481|Ga0190271_12680725 | Not Available | 598 | Open in IMG/M |
| 3300018482|Ga0066669_12387189 | Not Available | 506 | Open in IMG/M |
| 3300020082|Ga0206353_10987742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300023071|Ga0247752_1029934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
| 3300025321|Ga0207656_10013915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3087 | Open in IMG/M |
| 3300025686|Ga0209506_1138171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| 3300025898|Ga0207692_10079145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1753 | Open in IMG/M |
| 3300025898|Ga0207692_10101535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1580 | Open in IMG/M |
| 3300025906|Ga0207699_10327829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1076 | Open in IMG/M |
| 3300025912|Ga0207707_10095850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2593 | Open in IMG/M |
| 3300025914|Ga0207671_10014476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6231 | Open in IMG/M |
| 3300025917|Ga0207660_10286919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1308 | Open in IMG/M |
| 3300025918|Ga0207662_11158567 | Not Available | 550 | Open in IMG/M |
| 3300025920|Ga0207649_11088212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300025921|Ga0207652_11111748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300025923|Ga0207681_10244966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1397 | Open in IMG/M |
| 3300025926|Ga0207659_10426672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
| 3300025932|Ga0207690_10078113 | Not Available | 2302 | Open in IMG/M |
| 3300025935|Ga0207709_11277874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 606 | Open in IMG/M |
| 3300025936|Ga0207670_10207341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1493 | Open in IMG/M |
| 3300025936|Ga0207670_10530401 | Not Available | 959 | Open in IMG/M |
| 3300025940|Ga0207691_11263829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300025942|Ga0207689_11405088 | Not Available | 585 | Open in IMG/M |
| 3300025944|Ga0207661_10053490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3231 | Open in IMG/M |
| 3300025944|Ga0207661_11791121 | Not Available | 559 | Open in IMG/M |
| 3300025945|Ga0207679_10247637 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300025945|Ga0207679_11230884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300025981|Ga0207640_10626245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| 3300025986|Ga0207658_10005838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8419 | Open in IMG/M |
| 3300026023|Ga0207677_10832993 | Not Available | 828 | Open in IMG/M |
| 3300026023|Ga0207677_11290468 | Not Available | 670 | Open in IMG/M |
| 3300026088|Ga0207641_12008606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300026118|Ga0207675_101781880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300026121|Ga0207683_12100179 | Not Available | 513 | Open in IMG/M |
| 3300027462|Ga0210000_1046123 | Not Available | 696 | Open in IMG/M |
| 3300027716|Ga0209682_10104050 | Not Available | 717 | Open in IMG/M |
| 3300027871|Ga0209397_10381841 | Not Available | 687 | Open in IMG/M |
| 3300027899|Ga0209668_10712552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300028379|Ga0268266_11639202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300028379|Ga0268266_11852848 | Not Available | 578 | Open in IMG/M |
| 3300028380|Ga0268265_10246447 | Not Available | 1580 | Open in IMG/M |
| 3300028665|Ga0302160_10027974 | Not Available | 1069 | Open in IMG/M |
| 3300028736|Ga0302214_1086864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 656 | Open in IMG/M |
| 3300028809|Ga0247824_10280038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 933 | Open in IMG/M |
| 3300028812|Ga0247825_10228109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1291 | Open in IMG/M |
| 3300028861|Ga0302259_1029216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1272 | Open in IMG/M |
| 3300028869|Ga0302263_10316901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 618 | Open in IMG/M |
| 3300029987|Ga0311334_10124636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1922 | Open in IMG/M |
| 3300029989|Ga0311365_11671794 | Not Available | 545 | Open in IMG/M |
| 3300030002|Ga0311350_10297424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1441 | Open in IMG/M |
| 3300030003|Ga0302172_10027619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1654 | Open in IMG/M |
| 3300030052|Ga0302217_10123066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300031241|Ga0265325_10142810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1137 | Open in IMG/M |
| 3300031716|Ga0310813_12317899 | Not Available | 509 | Open in IMG/M |
| 3300031726|Ga0302321_103621228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 502 | Open in IMG/M |
| 3300031852|Ga0307410_10814144 | Not Available | 795 | Open in IMG/M |
| 3300031873|Ga0315297_11095103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300031913|Ga0310891_10254938 | Not Available | 607 | Open in IMG/M |
| 3300031918|Ga0311367_10759911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 982 | Open in IMG/M |
| 3300031938|Ga0308175_102955821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 529 | Open in IMG/M |
| 3300031939|Ga0308174_11025870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300032002|Ga0307416_100969091 | Not Available | 953 | Open in IMG/M |
| 3300032004|Ga0307414_11625661 | Not Available | 602 | Open in IMG/M |
| 3300032005|Ga0307411_12034827 | Not Available | 536 | Open in IMG/M |
| 3300032013|Ga0310906_10136772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1408 | Open in IMG/M |
| 3300032017|Ga0310899_10107779 | Not Available | 1135 | Open in IMG/M |
| 3300032053|Ga0315284_11277054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
| 3300032256|Ga0315271_11296605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300032275|Ga0315270_10362534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 919 | Open in IMG/M |
| 3300032397|Ga0315287_10443480 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1540 | Open in IMG/M |
| 3300032516|Ga0315273_11493881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 831 | Open in IMG/M |
| 3300032516|Ga0315273_11848405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300032782|Ga0335082_10480810 | Not Available | 1104 | Open in IMG/M |
| 3300033412|Ga0310810_10221625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2112 | Open in IMG/M |
| 3300033418|Ga0316625_101231423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
| 3300033480|Ga0316620_10277088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1454 | Open in IMG/M |
| 3300033521|Ga0316616_104272928 | Not Available | 538 | Open in IMG/M |
| 3300033551|Ga0247830_10315647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1201 | Open in IMG/M |
| 3300034195|Ga0370501_0147162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.26% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.63% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.97% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.32% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.32% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.32% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.32% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.66% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.66% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.66% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.66% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.66% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.66% |
| Enhanced Biological Phosphorus Removal Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001526 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005219 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006417 | Combined Assembly of Gp0110018, Gp0110022, Gp0110020 | Engineered | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009664 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG | Engineered | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Host-Associated | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014306 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025686 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028736 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300030052 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_144281513 | 3300000363 | Soil | VSGFAVVAFVGLPMNLNLIVAGLIGIVAGTLADFARERWMPR* |
| INPhiseqgaiiFebDRAFT_1057485463 | 3300000364 | Soil | VLAATSAGIAVLALTHLPMRLNLIVAGVIGIVIGTLADLARERWKPR* |
| A105W1_12176082 | 3300001526 | Permafrost | VVAGVAVMALAGLPMNLNLIAAGVIGIVAGTLADFARERWITR* |
| JGI24748J21848_10062313 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | IAFAGLPMKLNLIVAGLTGIVAGTLADFARERWMPR* |
| Ga0062595_1014374193 | 3300004479 | Soil | GIAVLALAHLPMKLNLVVAGLIGIAVGTIADLARERWKPR* |
| Ga0062591_1003260163 | 3300004643 | Soil | AAGLVAAVAVIALDALPMKLSLVAAGLVGIVAGTLADVARERWTAR* |
| Ga0069004_101633383 | 3300005219 | Natural And Restored Wetlands | VLAAVTAGIAAIALAHLPMRLNLIVAGLLGILVGTLADLARERWTAR* |
| Ga0065715_104497823 | 3300005293 | Miscanthus Rhizosphere | HFRSYPTITAALVSAFAVIAFAGLPMKLNLIVAGLTGIVAGTLADFARERWMPR* |
| Ga0070683_1003403443 | 3300005329 | Corn Rhizosphere | APHFRSYPTITAALVSAFAVIAFAGLPMKLNLIVAGLTGIVAGTLADFARERWMPR* |
| Ga0068869_1019679732 | 3300005334 | Miscanthus Rhizosphere | HMRTAPTIGAALVAGCAVIALSALPMRLNLIVAGTLGIVAGTLADFARERWTRR* |
| Ga0070680_1003827013 | 3300005336 | Corn Rhizosphere | PSLLAAVVAGAAELALKGLPMKLNLIAAGLIGIVAGTVAEIVRERWTRR* |
| Ga0070661_1018943572 | 3300005344 | Corn Rhizosphere | PSLIAAVTAGVAVLALAALPMRLNLIVAALLGILAGTLVDLMQARWTQR* |
| Ga0070692_110600011 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | HFRSYPTITAALVAAFAVIAFAGLPMKLNLIVAGVIGIAAGTLADFARERWTPR* |
| Ga0070668_1000402451 | 3300005347 | Switchgrass Rhizosphere | NTPMVIAAVVGGVAVLALDSMPMKLNLIAAGVLGIMAGTVADIARERWTAR* |
| Ga0070668_1014743351 | 3300005347 | Switchgrass Rhizosphere | ISAGVAVVALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR* |
| Ga0070669_1011061161 | 3300005353 | Switchgrass Rhizosphere | FAVIAFAGLPMKLNLIVAGLTGIVAGTLADFARERWMPR* |
| Ga0070675_1014082231 | 3300005354 | Miscanthus Rhizosphere | PLFRDVPSVLAAITAGIAVLALSHLPMKLNLMAAGVLGIVIGTLADLLRERWKPR* |
| Ga0070674_1003581221 | 3300005356 | Miscanthus Rhizosphere | AGYAVVALGGLPMKLNLIAAGVIGIAAGTIADLARERWTRR* |
| Ga0070673_1002707354 | 3300005364 | Switchgrass Rhizosphere | LLRDAPTILSAIVAGYAVVALGGLPMNLNLIAAGVIGIAAGTIADLARERWTRR* |
| Ga0070703_103846411 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | SVLAAITAGIAVLALSHLPMKLNLMAAGVLGIVIGTLADLLRERWKPR* |
| Ga0070709_104019233 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FRTSPTITAALAAGLAVIALRELPMNLNLIVAGVIGIVAGTLADFAHERWTAR* |
| Ga0070710_101251274 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PHFRTSPTIVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR* |
| Ga0070700_1004067703 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | LFRDTPSVLAAITAGIAVLALAHLPMKLNLVVAGLIGIAVGTIADLARERWKPR* |
| Ga0070663_1016813741 | 3300005455 | Corn Rhizosphere | DVPAVLAATSAGIAVLALAHLPMKLNLIVAGLIGIAMGTVADLARERWRAR* |
| Ga0070672_1000500281 | 3300005543 | Miscanthus Rhizosphere | GYAVIALSALPMKLNLIVAGTLGIVAGTLADFARERWTRR* |
| Ga0070686_1001762184 | 3300005544 | Switchgrass Rhizosphere | APLFRDVPSVLAAITAGIAVLALSHLPMKLNLMAAGVLGIVIGTLADLLRERWKPR* |
| Ga0070696_1001093004 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PSVLAAITAGIAVLALSHLPMKLNLMAAGVLGIVIGTLADLLRERWKPR* |
| Ga0068854_1013287263 | 3300005578 | Corn Rhizosphere | PLFRDTPSVLAAITAGIAVLALAHLPMKLNLVVAGLIGIAVGTIADLARERWKPR* |
| Ga0068856_1014023593 | 3300005614 | Corn Rhizosphere | PNVVAALTAGVAVIALDALPMRLNLIAAALLGIAAGTLTDLARTRSTRP* |
| Ga0068852_1005881841 | 3300005616 | Corn Rhizosphere | IVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR* |
| Ga0068859_1018485713 | 3300005617 | Switchgrass Rhizosphere | VLALAHLPMRLNLIAAGLIGILVGTLADLARERWTPR* |
| Ga0068866_112648403 | 3300005718 | Miscanthus Rhizosphere | LAHLPMRLNLIAAGLIGILVGTLADLARERWTPR* |
| Ga0068861_1026155242 | 3300005719 | Switchgrass Rhizosphere | PSVLAALTAGIAVLALAHLPMKLNLIVAGIIGILVGTLADLAKERWKAR* |
| Ga0068858_1012760273 | 3300005842 | Switchgrass Rhizosphere | AGIAVLVLAHLPMKLNLIVAGIIGILVGTLADLARERWKAR* |
| Ga0068860_1009937023 | 3300005843 | Switchgrass Rhizosphere | LAHLPMKLNLIVAGIIGILVGTLADLARERWKAR* |
| Ga0068862_1000254351 | 3300005844 | Switchgrass Rhizosphere | AVLALAHLPMRLNLVVAGLIGIAVGTIADLARERWKPR* |
| Ga0068862_1000612591 | 3300005844 | Switchgrass Rhizosphere | LRNAPMVIAAVVGGVAVLALDSMPMKLNLIAAGVLGIMAGTVADIARERWTAR* |
| Ga0068862_1004090483 | 3300005844 | Switchgrass Rhizosphere | VLALESLPMHLNLIVAGLLGILAGTLADFAAERWTSR* |
| Ga0075028_1004892403 | 3300006050 | Watersheds | RGLLPVIAAVTAGVAVIALAGFPMRLNLVVAGILGILAGTAAELLRERWKAR* |
| Ga0075026_1004733363 | 3300006057 | Watersheds | PTILAAVVAGIAVFALDGLPMKLNLIAAGLIGIVAGTIADLMRDRWTRR* |
| Ga0079037_1007751641 | 3300006224 | Freshwater Wetlands | PNVTAALVAAVAVLAFGALPMKLNLVVAGVLGIVAGTLAELAGERWKAR* |
| Ga0097621_1015998561 | 3300006237 | Miscanthus Rhizosphere | LVAPHFRTSPTIVAALVAGFGVLALAALPMKLSLIVAGVAGIVAGTLADFAKERWTAR* |
| Ga0097621_1019585531 | 3300006237 | Miscanthus Rhizosphere | APTILSAIVAGYAVVALGGLPMKLNLIAAGVIGIAAGTIADLARERWTRR* |
| Ga0068871_1001752884 | 3300006358 | Miscanthus Rhizosphere | LAGVAVVALDGLPMRLNLIAAGVVGILAGTAIDLAQARWTRR* |
| Ga0068871_1021008311 | 3300006358 | Miscanthus Rhizosphere | PHFRSFPTISAALVSAYAVSAFAGLPMKLNLIVAGMIGIAAGTLADFAQERWTPR* |
| Ga0069787_104764473 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | ATTAGIAVLALAHLPMRLNLIAAGLLGIAAGTLADFARERWKAR* |
| Ga0079221_101713183 | 3300006804 | Agricultural Soil | VLALAGLPMKLNLIVAGVIGILAGTLADFARERWTPR* |
| Ga0068865_1003408671 | 3300006881 | Miscanthus Rhizosphere | AVLALDALPMKLSLVAAGLIGIVAGTIVDLMRERWTAR* |
| Ga0068865_1020782921 | 3300006881 | Miscanthus Rhizosphere | AGVAVVALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR* |
| Ga0105247_108486933 | 3300009101 | Switchgrass Rhizosphere | PLFRDAPSVLAALTAGIAVLALAHLPMKLNLIVAGIIGILVGTLADLAKERWKAR* |
| Ga0115027_116250372 | 3300009131 | Wetland | TAALVAAVAVLAFGALPMKLNLVVAGVLGIVAGTLAELAGERWKAR* |
| Ga0105237_100894625 | 3300009545 | Corn Rhizosphere | SPTIVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR* |
| Ga0105237_122732371 | 3300009545 | Corn Rhizosphere | HFRTSPTIVAALVAGFGVLALAALPMKLSLIVAGVAGIVAGTLADFAKERWTAR* |
| Ga0116146_10276755 | 3300009664 | Anaerobic Digestor Sludge | PSVVAAVAAGVAVLALAGLPMRLSLIAAGLIGIVAGTVVDFSGERWKAR* |
| Ga0134128_103341374 | 3300010373 | Terrestrial Soil | TAALAAGLAVIALRGLPMNLNLIVAGVIGIVAGTLADFAHERWTAR* |
| Ga0134126_111405483 | 3300010396 | Terrestrial Soil | IAPHLNTVPTLVAATSAAVAVFALAGLPMKLNLIAAGVAGIVAGTLVDLARERWSAR* |
| Ga0134121_122627531 | 3300010401 | Terrestrial Soil | ALVAPHFRSFPTISAALVSGYAVMAFAGLPMKLNLIVAGLIGIAAGTLADFAQERWTPR* |
| Ga0157318_10247732 | 3300012482 | Arabidopsis Rhizosphere | LVSGFAVIAFAGLPMKLNLIVAGLIGIVAGTLADFTRDRWMPR* |
| Ga0164241_105810413 | 3300012943 | Soil | AGYAVIALSTLPMKLNLIAAGTIGIVAGTLADFARERWTRR* |
| Ga0164302_109604101 | 3300012961 | Soil | LVAPHFRSAPTIVAAVAAGVAVMALAGLPMNLNLIAAGVIGIVAGTLADFARERWTTR* |
| Ga0164308_106679983 | 3300012985 | Soil | VSAFAGLPMKLNLIVAGMIGIAAGTLADFAQERWTPR* |
| Ga0157373_104317273 | 3300013100 | Corn Rhizosphere | VAGYAVIALSALPMKLNLIVAGTIGIVAGTLADFARERWTRR* |
| Ga0157371_103498473 | 3300013102 | Corn Rhizosphere | LAFASLPMKLSLIVAGVAGIVAGTLADFTKERWTAR* |
| Ga0157369_124248852 | 3300013105 | Corn Rhizosphere | VAGVGVLALASLPMKLNLIVAGVAGIVAGTLADFAQERWTAR* |
| Ga0120123_11667941 | 3300013770 | Permafrost | LVAPHSRPSPTIMAGLVAAYAVIGLSGLPMNLNLIVAGVLGIVAGTLADFARERRTPR* |
| Ga0075346_11472072 | 3300014306 | Natural And Restored Wetlands | AATAGGLVLALAGLPMKLNLIVAGVIGIVAGTLTDLARERWKAD* |
| Ga0157379_116030691 | 3300014968 | Switchgrass Rhizosphere | IAALVAGVAVLALESLPMHLNLIVAGLLGILAGTLADFAAERWTSR* |
| Ga0157376_123010082 | 3300014969 | Miscanthus Rhizosphere | APHFRSFPTISAALVSGYAVVAFAGLPMKLNLIVAGLIGIAAGTLADFAQERWTPR* |
| Ga0132255_1015710353 | 3300015374 | Arabidopsis Rhizosphere | IAAALVAGVLVLALAGLPMKLNLIVAGVIGILAGTLADFARERWTPR* |
| Ga0184638_11022413 | 3300018052 | Groundwater Sediment | PLFRDAPSVLAATSAGVAVLALTHLPMRLNLIVAGVIGIVIGTLADLARERWKPR |
| Ga0184612_103792722 | 3300018078 | Groundwater Sediment | MILAALVAGVAVIALDGLPMKLNLIVAGVIGIVAGTLADLMRERWTRR |
| Ga0190265_138365052 | 3300018422 | Soil | IAPLFRSGPVILAGVVAGIAVMALDAMPMKLNLIVAGMLGIAAGTLADLAKEAWHSR |
| Ga0190274_134926992 | 3300018476 | Soil | FRNTPSVLAAISAGVAVIALAHLPMRLNLIAAGLIGIVVGTVADLAKERWTQR |
| Ga0190271_126807251 | 3300018481 | Soil | LALDALPMKLNLIVAGALGIVAGTLFDVATARKEPR |
| Ga0066669_123871892 | 3300018482 | Grasslands Soil | AFAAGLDAGVAVLALEALPMKLSLVAAGLIGIVAGTIVDLTRERWTAR |
| Ga0206353_109877423 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | LVAAFAVIAFAGLPMKLNLIVAGVIGIAAGTLADFAWERWTPR |
| Ga0247752_10299343 | 3300023071 | Soil | TAALVSAFAVIAFAGLPMKLNLIVAGLTGIVAGTLADFARERWMPR |
| Ga0207656_100139151 | 3300025321 | Corn Rhizosphere | APSVLAAISAGVAVVALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR |
| Ga0209506_11381713 | 3300025686 | Anaerobic Digestor Sludge | VLALAGLPMRLSLIAAGLIGIVAGTVVDFSGERWKAR |
| Ga0207692_100791451 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | APGLRSTPSLLAAVVAGAAVLALKGLPMKLNLIAAGLIGIVAGTVAEIVRERWTRR |
| Ga0207692_101015351 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LVAPHFRTSPTIVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR |
| Ga0207699_103278291 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | FRTSPTITAALAAGLAVIALRELPMNLNLIVAGVIGIVAGTLADFAHERWTAR |
| Ga0207707_100958505 | 3300025912 | Corn Rhizosphere | GVLALAALPMKLNLIVAGVAGIVAGTVADFAKERWTAR |
| Ga0207671_100144761 | 3300025914 | Corn Rhizosphere | SPTIVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR |
| Ga0207660_102869193 | 3300025917 | Corn Rhizosphere | PSLLAAVVAGAAVLALKGLPMKLNLIAAGLIGIVAGTVAEIVRERWTRR |
| Ga0207662_111585672 | 3300025918 | Switchgrass Rhizosphere | HLRTVPTIAAALCAGVAVLALGGLPMRLNLIAAGVLGIVAGTFADFARERWTPR |
| Ga0207649_110882123 | 3300025920 | Corn Rhizosphere | PHFRTSPTIVAALVAGAGVLALAWLPMKLNLIVAGVAGIVAGTLADFAKERWTAR |
| Ga0207652_111117483 | 3300025921 | Corn Rhizosphere | SPTIIAALVAGVGVLALASLPMKLNLIVAGVAGILAGTLADFAKEQWTPR |
| Ga0207681_102449661 | 3300025923 | Switchgrass Rhizosphere | RNTPMVIAAVVGGVAVLALDSMPMKLNLIAAGVLGIMAGTVADIARERWTAR |
| Ga0207659_104266723 | 3300025926 | Miscanthus Rhizosphere | PLFRDTPSVLAAITAGIAVLALAHLPMRLNLVVAGLIGIAVGTIADFARERWKPR |
| Ga0207690_100781131 | 3300025932 | Corn Rhizosphere | RSYPTITAALVSAFAVIAFAGLPMKLNLIVAGLTGIVAGTLADFARERWMPR |
| Ga0207709_112778741 | 3300025935 | Miscanthus Rhizosphere | ALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR |
| Ga0207670_102073411 | 3300025936 | Switchgrass Rhizosphere | ALVAPLFRDVPSVLAAITAGIAVLALSHLPMKLNLMAAGVLGIVIGTLADLLRERWKPR |
| Ga0207670_105304011 | 3300025936 | Switchgrass Rhizosphere | TVIAALVAGVAVLALESLPMHLNLIVAGLLGILAGTLADFAAERWTSR |
| Ga0207691_112638293 | 3300025940 | Miscanthus Rhizosphere | AAITAGIAVLALAHLPMRLNLIAAGLIGILVGTLADLARERWTPR |
| Ga0207689_114050882 | 3300025942 | Miscanthus Rhizosphere | ALVAPHMRTAPTIGAALVAGCAVIALSALPMRLNLIVAGTLGIVAGTLADFARERWTRR |
| Ga0207661_100534906 | 3300025944 | Corn Rhizosphere | IAFAGLPMNLNLIVAGLIGIVAGTLVDFARDRWMPR |
| Ga0207661_117911211 | 3300025944 | Corn Rhizosphere | ALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR |
| Ga0207679_102476374 | 3300025945 | Corn Rhizosphere | HFRTSPTIVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR |
| Ga0207679_112308843 | 3300025945 | Corn Rhizosphere | TIGAALVAGYAVIALSALPMKLNLIVAGTIGIVSGTLADFARERWTRR |
| Ga0207640_106262451 | 3300025981 | Corn Rhizosphere | VAGVGVLAFASLPMKLSLIVAGVAGIVAGTLADFTKERWTAR |
| Ga0207658_100058381 | 3300025986 | Switchgrass Rhizosphere | AGVAVVALDGLPMRLNLIAAGVVGILAGTAIDLAQARWTRR |
| Ga0207677_108329931 | 3300026023 | Miscanthus Rhizosphere | AGVAVVALDGLPMRLNLIAAGLVGILAGTAIDLAQARWTRR |
| Ga0207677_112904683 | 3300026023 | Miscanthus Rhizosphere | RSPPTVIAALVAGVAVLALESLPMHLNLIVAGLLGILAGTLADFAAERWTSR |
| Ga0207641_120086061 | 3300026088 | Switchgrass Rhizosphere | SVLAAISAGVAVVALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR |
| Ga0207675_1017818801 | 3300026118 | Switchgrass Rhizosphere | PVFRNAPSVLAAISAGVAVVALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR |
| Ga0207683_121001791 | 3300026121 | Miscanthus Rhizosphere | AVLVLAHLPMKLNLIVAGIIGILVGTLADLARERWKAR |
| Ga0210000_10461233 | 3300027462 | Arabidopsis Thaliana Rhizosphere | MLTAPTIGAALVAGYAVIALSALPMKLNLIVAGTIGIVAGTLADFARERWTRR |
| Ga0209682_101040501 | 3300027716 | Wetland Sediment | VAAATAGIFVLALAGLPMKLNLIVAGVIGIVAGTLADLARERWKAR |
| Ga0209397_103818411 | 3300027871 | Wetland | PNVTAALVAAVAVLAFGALPMKLNLVVAGVLGIVAGTLAELAGERWKAR |
| Ga0209668_107125523 | 3300027899 | Freshwater Lake Sediment | VLRELPVIVAAVTAGGFVLALAALPMKLNLIVAGVIGIVAGTLTDLARERWKAR |
| Ga0268266_116392021 | 3300028379 | Switchgrass Rhizosphere | PLFRDVPAVLAATSAGIAVLALAHLPMKLNLIVAGLIGIAMGTVADLARERWRAR |
| Ga0268266_118528481 | 3300028379 | Switchgrass Rhizosphere | APLFRDAPSVLAAVSAAIAVLALAHLPMKLNLIVAGIIGIAMGTLADLARERWKAR |
| Ga0268265_102464471 | 3300028380 | Switchgrass Rhizosphere | AALVAGVAVLALASLPMHLNLIVAGLLGILAGTLADFAAERWTSR |
| Ga0302160_100279741 | 3300028665 | Fen | AVVAGAAVVALGGLPMKLNLIAAGVIGIVVGTIADLARERWMRR |
| Ga0302214_10868643 | 3300028736 | Fen | MPNIAAAGVAGVAVVVLGGLPMKLNLIAAGVIGIIVGTLADLLRERWTRH |
| Ga0247824_102800383 | 3300028809 | Soil | GIAVLALAHLPMRLNLIAAGLIGILVGTLADLARERWTPR |
| Ga0247825_102281091 | 3300028812 | Soil | VIALSALPMRLNLIVAGTLGIVAGTLADFARERWTRR |
| Ga0302259_10292161 | 3300028861 | Fen | LLRDMPNIAAAVVAGVAVVALGWLPMKLNLIAAGVVGIVVGTLADLARERWTRR |
| Ga0302263_103169013 | 3300028869 | Fen | PLMRDLPNIAAAVVAGVAVVVLGGLPMKLNLIAAGVIGIIVGTLADLARERWTRP |
| Ga0311334_101246361 | 3300029987 | Fen | LLRDMPNIAAAVFAGVAVVALGWLPMKLNLIAAGVVGIVVGTLADLARERWTRR |
| Ga0311365_116717941 | 3300029989 | Fen | AMSHLPMRLNLIVAGMLGIIVGMLADLAKARWMPR |
| Ga0311350_102974241 | 3300030002 | Fen | PTILAAVVAGVAVVALGGLPMKLNLIAAGVIGIVAGTLADIARERWTRR |
| Ga0302172_100276194 | 3300030003 | Fen | AGMAVVALGGLPMKLNLIAAGVIGIVVGTIADLARERWMRR |
| Ga0302217_101230661 | 3300030052 | Fen | LRDMPNIAAAVTAGIAVVALAGLPMKLYLIAAGVIGIIVGTLADLARERWTRR |
| Ga0265325_101428103 | 3300031241 | Rhizosphere | SAPHVLAAVVAGVAVMALDALPMRLNLVVAGVLGIVAGLAVEMAEARWKAR |
| Ga0310813_123178991 | 3300031716 | Soil | PHFRSYPTITAALVAAFAVIAFAGLPMKLNLIVAGVIGIAAGTLADFARERWTPR |
| Ga0302321_1036212282 | 3300031726 | Fen | MRDPPTILAAVVAGIAVVALDGLPMKLNLIAAGVIGIVAGTLADLARERWTRR |
| Ga0307410_108141441 | 3300031852 | Rhizosphere | VAAACAGVAVAALEGLPMRLNLIAAGLIGIAAGTLADLANERWTPR |
| Ga0315297_110951033 | 3300031873 | Sediment | VVALGGLPMKLNLIAAGLIGIAAGTMADLARERWTRR |
| Ga0310891_102549381 | 3300031913 | Soil | MAGLMAAIAVVVLAALPMKLALIAAGLIGIVAGTLVDLARERWTAR |
| Ga0311367_107599111 | 3300031918 | Fen | VAGVAVVVLGGLPMKLNLIAAGVIGIIVGTLADLTRERWTRR |
| Ga0308175_1029558211 | 3300031938 | Soil | IAPALRSLPTVVAAVVAAVLVVATAGLPMRLNLVVAGVAGIVAGTLADALRTRRARA |
| Ga0308174_110258703 | 3300031939 | Soil | LVAAATAGVAVVALAALPMRLNLIVAALLGIAAGTLADLLGARWRR |
| Ga0307416_1009690913 | 3300032002 | Rhizosphere | SAGVAVMALAHLPMRLNLIAAGLIGIVVGTVADLARERWTQR |
| Ga0307414_116256613 | 3300032004 | Rhizosphere | NAPSLVAAACAGVAVAALEGLPMRLNLIAAGLIGIAAGTLADLANERWTPR |
| Ga0307411_120348271 | 3300032005 | Rhizosphere | VIALSVLPMKLNLIVAGTIGIVAGTLADFARERWTQR |
| Ga0310906_101367721 | 3300032013 | Soil | VIALDGLPMRLNLIAAGVAGIVAGTLIEIGRERWTRA |
| Ga0310899_101077794 | 3300032017 | Soil | PAVMAGLMAAIAVVVLAALPMKLALIAAGLIGIVAGTLVDLARERWTAR |
| Ga0315284_112770543 | 3300032053 | Sediment | FVLALAALPMKLNLIVAGVIGIVAGTLTDLARERWKAR |
| Ga0315271_112966051 | 3300032256 | Sediment | ILAAVVAGASVVALGGLPMRLNLIAAGVIGIAAGTLADLVRERWTRH |
| Ga0315270_103625343 | 3300032275 | Sediment | VTAGGFVLALAALPMKLNLIVAGVIGILAGTLTDLARERWKAR |
| Ga0315287_104434804 | 3300032397 | Sediment | RDAPTIVAAIVAGIAVVALGGLPMKLNLIAAGVIGITAGTIADLARERWMRR |
| Ga0315273_114938811 | 3300032516 | Sediment | ALAALPMKLNLIVAGVIGIVAGTLTDLARERWKAR |
| Ga0315273_118484053 | 3300032516 | Sediment | REVPVIVAAVTAGGFVLALAALPMKLNLIVAGVIGIVAGTLTDLARERWKAR |
| Ga0335082_104808101 | 3300032782 | Soil | GVAVLALAGLPMRLNLIVAGLIGIAVGTIADLAGERWKPR |
| Ga0310810_102216251 | 3300033412 | Soil | PTIVAALVAGVGVLALASLPMKLNLIVAGVAGIAAGTLADFAKERWTAR |
| Ga0316625_1012314231 | 3300033418 | Soil | RDAPSVVAAVTAGIAVLAMSHLPMRLNLIVAGVLGIVAGTLADLARERWKAR |
| Ga0316620_102770883 | 3300033480 | Soil | MPSIVAAIVSGFAVLALSGLPMKLNLIVAGTLGIVAGTLADLTKERWTRR |
| Ga0316616_1042729281 | 3300033521 | Soil | PVIVAAVTAGTFVLALAALPMKLNLIVAGVIGILAGTLTDLARERWKAR |
| Ga0247830_103156473 | 3300033551 | Soil | LALAHLPMRLNLIAAGLIGILVGTLADLARERWTPR |
| Ga0370501_0147162_676_813 | 3300034195 | Untreated Peat Soil | SAIVAGVAVVLLDALPMKLNLIAAGLVGIVAGTCADIARERWTRR |
| ⦗Top⦘ |