| Basic Information | |
|---|---|
| Family ID | F045776 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VRRLPATTVYYGLSFGLRLPTWVVMSVYLVSELHLSPLQLVLMG |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 55.92 % |
| % of genes near scaffold ends (potentially truncated) | 99.34 % |
| % of genes from short scaffolds (< 2000 bps) | 97.37 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.026 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.263 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.632 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.22% β-sheet: 0.00% Coil/Unstructured: 52.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 35.53 |
| PF01061 | ABC2_membrane | 22.37 |
| PF13649 | Methyltransf_25 | 9.21 |
| PF08241 | Methyltransf_11 | 4.61 |
| PF12847 | Methyltransf_18 | 2.63 |
| PF13673 | Acetyltransf_10 | 2.63 |
| PF13489 | Methyltransf_23 | 2.63 |
| PF00005 | ABC_tran | 1.97 |
| PF13672 | PP2C_2 | 0.66 |
| PF01833 | TIG | 0.66 |
| PF01557 | FAA_hydrolase | 0.66 |
| PF13508 | Acetyltransf_7 | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.50 % |
| Unclassified | root | N/A | 12.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig63040 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300000880|AL20A1W_1224590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1330 | Open in IMG/M |
| 3300000955|JGI1027J12803_109609232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 570 | Open in IMG/M |
| 3300000956|JGI10216J12902_104057056 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300000956|JGI10216J12902_108124427 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300000956|JGI10216J12902_112702838 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300004081|Ga0063454_100111129 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300004157|Ga0062590_101863510 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300004479|Ga0062595_100835909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 765 | Open in IMG/M |
| 3300005161|Ga0066807_1038156 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005166|Ga0066674_10529357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
| 3300005177|Ga0066690_10929373 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005332|Ga0066388_101898800 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300005333|Ga0070677_10578872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 619 | Open in IMG/M |
| 3300005337|Ga0070682_101798435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300005367|Ga0070667_101552523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
| 3300005438|Ga0070701_10090410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1676 | Open in IMG/M |
| 3300005441|Ga0070700_101849768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella catacumbae | 521 | Open in IMG/M |
| 3300005445|Ga0070708_100640359 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300005445|Ga0070708_100736138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 927 | Open in IMG/M |
| 3300005458|Ga0070681_11912790 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005553|Ga0066695_10626773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 641 | Open in IMG/M |
| 3300005555|Ga0066692_10150431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1429 | Open in IMG/M |
| 3300005558|Ga0066698_11027121 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005560|Ga0066670_10497747 | Not Available | 749 | Open in IMG/M |
| 3300005563|Ga0068855_100239632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2027 | Open in IMG/M |
| 3300005563|Ga0068855_102214108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 551 | Open in IMG/M |
| 3300005577|Ga0068857_102549674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300005614|Ga0068856_102156515 | Not Available | 566 | Open in IMG/M |
| 3300005614|Ga0068856_102303625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
| 3300005713|Ga0066905_102145947 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005764|Ga0066903_100902944 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300005764|Ga0066903_105703269 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005842|Ga0068858_102312953 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005874|Ga0075288_1057486 | Not Available | 610 | Open in IMG/M |
| 3300006028|Ga0070717_11327414 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006042|Ga0075368_10187300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 873 | Open in IMG/M |
| 3300006046|Ga0066652_101450413 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300006046|Ga0066652_101588338 | Not Available | 602 | Open in IMG/M |
| 3300006358|Ga0068871_102375174 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006578|Ga0074059_12123298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1268 | Open in IMG/M |
| 3300006605|Ga0074057_11290146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 865 | Open in IMG/M |
| 3300006755|Ga0079222_12395336 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006791|Ga0066653_10760939 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006845|Ga0075421_100006698 | All Organisms → cellular organisms → Bacteria | 14082 | Open in IMG/M |
| 3300006845|Ga0075421_101161796 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300006853|Ga0075420_100189451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1798 | Open in IMG/M |
| 3300009093|Ga0105240_12717295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
| 3300009098|Ga0105245_12507445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
| 3300009137|Ga0066709_100403048 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300009137|Ga0066709_103788540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
| 3300009148|Ga0105243_12672243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300009176|Ga0105242_10178091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1874 | Open in IMG/M |
| 3300009176|Ga0105242_12016286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 620 | Open in IMG/M |
| 3300009789|Ga0126307_11570118 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300009792|Ga0126374_11522076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300010037|Ga0126304_10271065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
| 3300010042|Ga0126314_10248718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1261 | Open in IMG/M |
| 3300010043|Ga0126380_10356488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1067 | Open in IMG/M |
| 3300010044|Ga0126310_11090042 | Not Available | 635 | Open in IMG/M |
| 3300010322|Ga0134084_10214797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 679 | Open in IMG/M |
| 3300010333|Ga0134080_10651025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300010361|Ga0126378_10438792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1420 | Open in IMG/M |
| 3300010364|Ga0134066_10065369 | Not Available | 975 | Open in IMG/M |
| 3300010366|Ga0126379_11403035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 804 | Open in IMG/M |
| 3300010399|Ga0134127_10667500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1076 | Open in IMG/M |
| 3300010403|Ga0134123_10851764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 912 | Open in IMG/M |
| 3300012003|Ga0120163_1080406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 735 | Open in IMG/M |
| 3300012011|Ga0120152_1184974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300012204|Ga0137374_10426456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1047 | Open in IMG/M |
| 3300012204|Ga0137374_10663053 | Not Available | 788 | Open in IMG/M |
| 3300012206|Ga0137380_10958424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 733 | Open in IMG/M |
| 3300012206|Ga0137380_11124153 | Not Available | 669 | Open in IMG/M |
| 3300012208|Ga0137376_11079896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 687 | Open in IMG/M |
| 3300012354|Ga0137366_10422723 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300012354|Ga0137366_10589603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 798 | Open in IMG/M |
| 3300012355|Ga0137369_10428030 | Not Available | 949 | Open in IMG/M |
| 3300012356|Ga0137371_10813151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 712 | Open in IMG/M |
| 3300012360|Ga0137375_10667522 | Not Available | 854 | Open in IMG/M |
| 3300012360|Ga0137375_11459916 | Not Available | 505 | Open in IMG/M |
| 3300012891|Ga0157305_10089525 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 740 | Open in IMG/M |
| 3300012907|Ga0157283_10061038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 899 | Open in IMG/M |
| 3300012908|Ga0157286_10413715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300012914|Ga0157297_10457633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
| 3300012915|Ga0157302_10062175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
| 3300012955|Ga0164298_10849142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300012985|Ga0164308_10854761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 798 | Open in IMG/M |
| 3300012986|Ga0164304_11246991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
| 3300012986|Ga0164304_11824268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 509 | Open in IMG/M |
| 3300012989|Ga0164305_11009803 | Not Available | 708 | Open in IMG/M |
| 3300013100|Ga0157373_10921060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 649 | Open in IMG/M |
| 3300013307|Ga0157372_13123154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
| 3300013766|Ga0120181_1075976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 739 | Open in IMG/M |
| 3300014150|Ga0134081_10089531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
| 3300014745|Ga0157377_11102145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300015372|Ga0132256_100566618 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300015372|Ga0132256_101237560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 860 | Open in IMG/M |
| 3300015373|Ga0132257_103731497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
| 3300015374|Ga0132255_100368190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2085 | Open in IMG/M |
| 3300018431|Ga0066655_10660561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 707 | Open in IMG/M |
| 3300018433|Ga0066667_11838804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
| 3300018469|Ga0190270_12608587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300019356|Ga0173481_10499010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella catacumbae | 619 | Open in IMG/M |
| 3300019361|Ga0173482_10255282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 749 | Open in IMG/M |
| 3300019875|Ga0193701_1026117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1198 | Open in IMG/M |
| 3300020062|Ga0193724_1092933 | Not Available | 618 | Open in IMG/M |
| 3300023077|Ga0247802_1009203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1274 | Open in IMG/M |
| 3300024254|Ga0247661_1090991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300024284|Ga0247671_1026659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 873 | Open in IMG/M |
| 3300025916|Ga0207663_10882859 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 714 | Open in IMG/M |
| 3300025922|Ga0207646_11546236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
| 3300025927|Ga0207687_11068142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 693 | Open in IMG/M |
| 3300025929|Ga0207664_11861507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 524 | Open in IMG/M |
| 3300025935|Ga0207709_10285372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1221 | Open in IMG/M |
| 3300025960|Ga0207651_11773668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
| 3300025981|Ga0207640_10962033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 749 | Open in IMG/M |
| 3300026075|Ga0207708_10676057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 881 | Open in IMG/M |
| 3300026121|Ga0207683_10488134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1137 | Open in IMG/M |
| 3300026121|Ga0207683_10896521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 823 | Open in IMG/M |
| 3300027821|Ga0209811_10211685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300027909|Ga0209382_10340523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1682 | Open in IMG/M |
| 3300028380|Ga0268265_11414665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
| 3300028556|Ga0265337_1165336 | Not Available | 600 | Open in IMG/M |
| 3300028705|Ga0307276_10123322 | Not Available | 643 | Open in IMG/M |
| 3300028707|Ga0307291_1005433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2722 | Open in IMG/M |
| 3300028711|Ga0307293_10222681 | Not Available | 600 | Open in IMG/M |
| 3300028713|Ga0307303_10017609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1339 | Open in IMG/M |
| 3300028713|Ga0307303_10153377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
| 3300028744|Ga0307318_10166899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
| 3300028755|Ga0307316_10136784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 869 | Open in IMG/M |
| 3300028771|Ga0307320_10178000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 828 | Open in IMG/M |
| 3300028787|Ga0307323_10062246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1322 | Open in IMG/M |
| 3300028787|Ga0307323_10345888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300028799|Ga0307284_10106710 | Not Available | 1052 | Open in IMG/M |
| 3300028799|Ga0307284_10118930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1001 | Open in IMG/M |
| 3300028824|Ga0307310_10169121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1018 | Open in IMG/M |
| 3300028824|Ga0307310_10225812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 892 | Open in IMG/M |
| 3300028872|Ga0307314_10136966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 698 | Open in IMG/M |
| 3300028878|Ga0307278_10263002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
| 3300028880|Ga0307300_10250636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300028884|Ga0307308_10191104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 981 | Open in IMG/M |
| 3300031199|Ga0307495_10173315 | Not Available | 575 | Open in IMG/M |
| 3300031421|Ga0308194_10077775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 911 | Open in IMG/M |
| 3300031564|Ga0318573_10725499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300031792|Ga0318529_10474370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 582 | Open in IMG/M |
| 3300031824|Ga0307413_11846340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
| 3300031854|Ga0310904_11191601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300031854|Ga0310904_11222641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300031939|Ga0308174_11580013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300032133|Ga0316583_10231459 | Not Available | 640 | Open in IMG/M |
| 3300032211|Ga0310896_10661650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 588 | Open in IMG/M |
| 3300034115|Ga0364945_0195248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.63% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.63% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.63% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.32% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.32% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.32% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.66% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.66% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.66% | |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Host-Associated | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_00395130 | 2124908016 | VRRLPATTIYYGLNVVLRMPTWVVMAVYLVRELHLSPLQLVLMGTAMEAAVFLF | |
| AL20A1W_12245903 | 3300000880 | Permafrost | VRRADATRLYYMLQFIQYLPTWVVMAVYLVRTLHLSPLQLVLM |
| JGI1027J12803_1096092321 | 3300000955 | Soil | VGLAEAVKRVGAEKLYYALELVLSTPTWIVMSLYLVSDLNLSPLQLVLMGTAMEA |
| JGI10216J12902_1040570561 | 3300000956 | Soil | MRRVDAEKLYYALEFLLSTPTWVVTSLYLVSVLDLSPLQLVLMGTAMEASVFLC |
| JGI10216J12902_1081244272 | 3300000956 | Soil | VRRADPERLYYVLQVLLAIPTWVAMAVYLVKVVDMSPLQLVLMGTAMEAT |
| JGI10216J12902_1127028381 | 3300000956 | Soil | MRRVDAEKLYYALEFFLSTPTWVVTSLYLVSVLHLSPLQLVLMGTAMEASVFLC |
| Ga0063454_1001111293 | 3300004081 | Soil | MRRVDAEKLYYALEFFLATPTWVVTSLYLVSVLDLSPLQLVLMGTAMEGAVFLFE |
| Ga0062590_1018635101 | 3300004157 | Soil | MKRLPATTVFYGLELLLSFPTFVVMAVYLVRELHFTPLELVLMGTAME |
| Ga0062595_1008359092 | 3300004479 | Soil | VKRPSAETLYYALSFALRMPTWVVMAVYLVRTLHLSPLQLVLM |
| Ga0066807_10381561 | 3300005161 | Soil | MRRLPATAVFYGLEFLLSMPTWVVVAVYLVQELDFSPLQLVLMGTAMEAAVSCARFRPE* |
| Ga0066674_105293572 | 3300005166 | Soil | VRRLPATTVYYGLSFGSRLPTWVVAAVYLVRELHLSPLQLVLMGT |
| Ga0066690_109293731 | 3300005177 | Soil | MKRLPATTVYYGLTFGLRLPTWVVMAVYLVRELHFSPLQLVLMGTAME |
| Ga0066388_1018988002 | 3300005332 | Tropical Forest Soil | MRRFRATTVYYGLSFGGYMPTWVVMAVYLVQELHLSPLQLVLMGTAMEA |
| Ga0070677_105788721 | 3300005333 | Miscanthus Rhizosphere | VRRLPATAVYFGLQLGAHLPTWVVMAVYLVRELHLSPLQLVLMGTAMEA |
| Ga0070682_1017984351 | 3300005337 | Corn Rhizosphere | VTRLPAKTVYYGLCFGLRLPTWVVMAVYLVRELHFSPLQLVLM |
| Ga0070667_1015525232 | 3300005367 | Switchgrass Rhizosphere | VRRLPATAVYFGLQLGAHLPTWVVMAVYLVRELHLSPLQLVL |
| Ga0070701_100904101 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRLPATTVYYGLELLLSMPTWVVMSVYLVSELDLSPLQLVLM |
| Ga0070700_1018497682 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGLRATTVYYGLSFGGYMPTWVVMAVYLVNELHLSPLQLVL |
| Ga0070708_1006403592 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRLPATAVYFGLQLGAHLPTWVVMAVYLVRELHFSPLQLVLMGTAMEAA |
| Ga0070708_1007361381 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VKRLPATTVYYGLSFGLHLPTWVVMAVYLVRELHFSPLQL |
| Ga0070681_119127902 | 3300005458 | Corn Rhizosphere | MRRFGATTVYYGLSFGGYMPTWVVMSVYLVSELHLSPLQLVLMGTAMEAAV |
| Ga0066695_106267731 | 3300005553 | Soil | MRRLPARPVYYGLNFVLRMPTWVVMAVYLVQELHFSPLQLVLMG |
| Ga0066692_101504311 | 3300005555 | Soil | MRRLPARPVYFGLSFVLRMPTWVVMAVYLVQELHFSPLQLVLMGTAMEA |
| Ga0066698_110271212 | 3300005558 | Soil | MKRLPATTVYYGLTFGLRLPTWVVMAVYLVRELHFSPLQLVLMGTAMEAAVFLFE |
| Ga0066670_104977472 | 3300005560 | Soil | VKRADPTRLYYSLEFLLSMPTWVAMAVFLVSVLHFSPLQLVLMGTAME |
| Ga0068855_1002396321 | 3300005563 | Corn Rhizosphere | MRPLPARGVYFALQFGAHLSTWVVMAVYLVRELHFSPLQLVLMGTAMEAAVFL |
| Ga0068855_1022141082 | 3300005563 | Corn Rhizosphere | VRRLPATAVYFGLQLGAHLPTWVVMAVYLVRELHFSPLQLVLMGTAMEAAVFL |
| Ga0068857_1025496741 | 3300005577 | Corn Rhizosphere | MRPLPPRAVYFGLQFGSHLPTWVVMSVYLVRELHFSPLQLVLMGTAME |
| Ga0068856_1021565152 | 3300005614 | Corn Rhizosphere | VKPLPATRVYYGICCFGLHLPTWVVMAVYLVRDLHLTPLQL |
| Ga0068856_1023036252 | 3300005614 | Corn Rhizosphere | VRRAEPTRLYYSLEFLLSMPTWVAMAVYLVSVLHFSPLQLVLMGTAME |
| Ga0066905_1021459472 | 3300005713 | Tropical Forest Soil | VRRADAEKLYYALELATSMPTWIVMSLYLVSVLELTPLQLVLMGTAMEAAVFL |
| Ga0066903_1009029443 | 3300005764 | Tropical Forest Soil | MKRLPARTVYYGLELLLRVPTWVVMSVYLVQELHLSPLQLVLMGTAME |
| Ga0066903_1057032691 | 3300005764 | Tropical Forest Soil | VKRPGAERLYYWLTFVLSMPTWVVVAVYLVRDLHLTPLQLVLMGTAMEA |
| Ga0068858_1023129532 | 3300005842 | Switchgrass Rhizosphere | LRPLPARAVYFGLQLGAHLPTWVVMSVYLVRELHFSPLQLVLMGTAMEAA |
| Ga0075288_10574861 | 3300005874 | Rice Paddy Soil | VRPLPARPVYYGLQFGAHLPTWVVMAVYLVRELHFSP |
| Ga0070717_113274142 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRVGAEKLYYSLEFFLSMPTWVVVSLYLVSVLHLTPFQLVLMGTAMEASIFLFE |
| Ga0075368_101873001 | 3300006042 | Populus Endosphere | MRGLRATTVYYGLSFGGYMPTWVVMAVYLVSELHL |
| Ga0066652_1014504131 | 3300006046 | Soil | MKRLSATTVYYGLSFGLRMPTWVVMAVYLVRELHLSPLQLVLMGTAMEAAVF |
| Ga0066652_1015883381 | 3300006046 | Soil | MRRLPATTVFYGLELLGRLPTWVVMSVYLVRELHLSPLQLVLMGTAM |
| Ga0068871_1023751742 | 3300006358 | Miscanthus Rhizosphere | MRPLPARAVYFGLQFGAHLPTWVVMSVYLVRELHLSPLQLVLMGTAMEAA |
| Ga0074059_121232981 | 3300006578 | Soil | LRRADATRLYYALQILLSMPTWVVMAVYLVQELHLSPLQLVLMG |
| Ga0074057_112901462 | 3300006605 | Soil | MRRLPATTVYYGLELLVSMPTWVVMSVYLVSELDLSPLQLVLMGT |
| Ga0079222_123953361 | 3300006755 | Agricultural Soil | VKRLPATTIYYGLSFGLQLPTWVVMSVYLVSELHLSPLQLVLMGTAMEGAVFLF |
| Ga0066653_107609391 | 3300006791 | Soil | MRRLPATTVFYGLELLGRLPTWVVMSVYLVRELHLSPLQLVLMGTAMEGAVF |
| Ga0075421_1000066981 | 3300006845 | Populus Rhizosphere | MRRLPATTVYYGLSFGLRTPTWVVMAVYLVRELHF |
| Ga0075421_1011617962 | 3300006845 | Populus Rhizosphere | MKRLPATTVFYGLEFFLSWPTWVVMAVYLVNELHLSPLQLVLMGTAMEAAV |
| Ga0075420_1001894511 | 3300006853 | Populus Rhizosphere | MKRLPATTVFYGLEFFLSWPTWVVMAVYLVNELHFSPLQLVLMGT |
| Ga0105240_127172951 | 3300009093 | Corn Rhizosphere | VRRADPTRLYYVLEFLLAMPTWVAMAVYLVSVLHFSPLQLVLMVTA |
| Ga0105245_125074451 | 3300009098 | Miscanthus Rhizosphere | MRRAEPTRLYYALQILLSMPTWVVMAVYLVKELHLLPLQLLLMGTAMEAAVFL |
| Ga0066709_1004030483 | 3300009137 | Grasslands Soil | VRRADATRLYFELQILLSMPTWVVMSVYLVQELHFPPLQLVLMGL |
| Ga0066709_1037885401 | 3300009137 | Grasslands Soil | VKRADPTRLYYSLEFLLSMPTWVAMAVFLVSVLHFSPLQLVLMGTA |
| Ga0105243_126722432 | 3300009148 | Miscanthus Rhizosphere | MRKADATRLYYALQILSGVPTWVVMSVYLVQELHLSPLQLVLMGT |
| Ga0105242_101780911 | 3300009176 | Miscanthus Rhizosphere | MRRADATRLYYALQILLSMPTWVVMAVYLVQELHLSPLQLVLMGTA |
| Ga0105242_120162861 | 3300009176 | Miscanthus Rhizosphere | VRRVDAEKLYYWLEFFLATPTWVVTSLYLVSVLDLSPLQLVLMGTAMEATVFLC |
| Ga0126307_115701181 | 3300009789 | Serpentine Soil | VKRLPATTVYYGLELLLSTPTWVVVSIYLVRELHLSPLELLLM |
| Ga0126374_115220762 | 3300009792 | Tropical Forest Soil | MRRLSATTVYYGLSFGTRMPTWVVMAVYLVRELHLSPLQLVLMGTAMEAAVFLF |
| Ga0126304_102710653 | 3300010037 | Serpentine Soil | VKRFPATPVYYGLELALRVPTWVVMAVYLVSELHLSPVGLVLMGTAMEAAV |
| Ga0126314_102487181 | 3300010042 | Serpentine Soil | MRRLSPTTVYYGLSFGGYMPTWVVMAVYLVQELHLSPLQLVLMGT |
| Ga0126380_103564881 | 3300010043 | Tropical Forest Soil | MKRLAATSVYYGLSFGTNMPTWVVMAVYLVRDLHLSPLQLVLIGTAMEAAVFLFE |
| Ga0126310_110900421 | 3300010044 | Serpentine Soil | VRRLPATSVYFGLELVLRVPTWVVMAVYLVSELHLSPLELVL |
| Ga0134084_102147971 | 3300010322 | Grasslands Soil | MRRLSATPVYYGLSFGTRMPTWVVMAVYLVRELHFSPLHLVLM |
| Ga0134080_106510251 | 3300010333 | Grasslands Soil | MIRIRRLPATTVFYGLELLDRVPTWVVMSVYLVRELHLSPLQLVLMGTAMEAS |
| Ga0126378_104387921 | 3300010361 | Tropical Forest Soil | VRRFPATAVYYGLSFGGHLPTWVVMSVYLVRELHLSPLQLV |
| Ga0134066_100653692 | 3300010364 | Grasslands Soil | VKRPSAETLYYGLSFALRMPTWVVMAVYLVRTLHLSPL |
| Ga0126379_114030351 | 3300010366 | Tropical Forest Soil | MRRLRATTVYYGLSFVGYMPTWVVIAVYLVSELHLSPLQLVLMGTAMEAAVFA |
| Ga0134127_106675002 | 3300010399 | Terrestrial Soil | MRRLPATTVYYGLELLLSAPTFVVVAVYLVSDLDLSPLQLVLMGTAMEATVF |
| Ga0134123_108517641 | 3300010403 | Terrestrial Soil | MRRFGATTVYYGLSFGGYMPTWVVMSVYLVSELHLSP |
| Ga0120163_10804062 | 3300012003 | Permafrost | VRRLPATSVFYALELLLRLPTWVAAAVYLVRELHFSPLQL |
| Ga0120152_11849741 | 3300012011 | Permafrost | VRRLPPLRVYYGLEFFLAMPTWIVISIYLVRELHLSPL |
| Ga0137374_104264561 | 3300012204 | Vadose Zone Soil | MRRPSATTVFYGLEFLLSAPAWVVIAIYLVRDLHLSPLQLVLMGTAMEASVFLFE |
| Ga0137374_106630531 | 3300012204 | Vadose Zone Soil | VKRLPAVPVYYGLELLLRVPTWIVMAVYLVRELHL |
| Ga0137380_109584241 | 3300012206 | Vadose Zone Soil | VTRLPALKVFYGLEFFLSMPTWIVISIYLVRDLHLSPLQLVLMGTSM |
| Ga0137380_111241531 | 3300012206 | Vadose Zone Soil | VRRPSAETLYYGFSFGLRMPTWVVLAVYLVRTLHLSPLQLVLMGTAMEGA |
| Ga0137376_110798961 | 3300012208 | Vadose Zone Soil | MKRLPATTVYYGLTFGLRLPTWVVMAVYLVRELHLTPLQLVLMGTAMEAAVFLF |
| Ga0137366_104227231 | 3300012354 | Vadose Zone Soil | VRRADATRLYYVLQVLLFVPTWVVMAVYLVRVVHLSPLQLILMGTAMEAAVFL |
| Ga0137366_105896032 | 3300012354 | Vadose Zone Soil | VRRLPATTVYYGIEFVDRLPTWVVMAVYLVRELHFSPLQLVLMGT |
| Ga0137369_104280301 | 3300012355 | Vadose Zone Soil | VRRLPATSVYYALECARATPTWVVMSLYLVQVLHLSP |
| Ga0137371_108131511 | 3300012356 | Vadose Zone Soil | VRRLPATTVFYGLELLDRVPTWVVMSVFLVRELHLSPLQLVLMGTAME |
| Ga0137375_106675221 | 3300012360 | Vadose Zone Soil | VRRLPATSVYYALEFALATPTWVVMSLYLVQVLHLS |
| Ga0137375_114599162 | 3300012360 | Vadose Zone Soil | MRRFPATTVFYGLEFFLRWPTWVVMAVYLVRELDLSPLQLVLIGTAMEGAVFLS |
| Ga0157305_100895251 | 3300012891 | Soil | VRGLRATTVYYGLSFGGYMPTWVVMAVYLVNELHLSPLQLVLMGT |
| Ga0157283_100610381 | 3300012907 | Soil | VRRADATRLYYVLQVLLFMPTWVVMAVYLVQTVHLSPL |
| Ga0157286_104137151 | 3300012908 | Soil | MRRLPATTVYYGLELLLSAPTFVVVAVYLVSDLELSPLQLVLMGTA |
| Ga0157297_104576332 | 3300012914 | Soil | MRNADATRLYYALQILSGVPTWVVMSVYLVQELHLSPLQLVLMGTAMEG |
| Ga0157302_100621751 | 3300012915 | Soil | VRRPNAETLYYSLSFLSGMPTWVVMAVYLVRELHLTPLQLVLMGTA |
| Ga0164298_108491421 | 3300012955 | Soil | VRRLPATAVYFGLQLGAHLPTWVVMAVYLVRELHFSPLQLVLM |
| Ga0164308_108547611 | 3300012985 | Soil | MRRFGATTVYYGLSFGGYMPTWVVMSVYLVSELHLSPLQ |
| Ga0164304_112469911 | 3300012986 | Soil | MRRADATRLYYALQILLSMPTWVVMAVYLVQELHLSPLQLVLMGTAM |
| Ga0164304_118242681 | 3300012986 | Soil | VRRVDAERLYYALQLLLSMPTWVVVSVYLVSDLHLSP |
| Ga0164305_110098031 | 3300012989 | Soil | MRHVAAEKLYYALEFFLSTPTWVVTSLYLVSVLDLTPLQLVLMGTAMEASVFLCE |
| Ga0157373_109210601 | 3300013100 | Corn Rhizosphere | MRPLPARAVYFGLQFGAHLPTWVVMSVYLVRELHL |
| Ga0157372_131231541 | 3300013307 | Corn Rhizosphere | MRPLPARGVYFALQFGAHLPTWVVMAVYLVRELHFSP |
| Ga0120181_10759761 | 3300013766 | Permafrost | MRRADPTRLYYTLQFLLFMPTWVVVAVYLVRVAHLSPLQLVLM |
| Ga0134081_100895313 | 3300014150 | Grasslands Soil | VRRADAEKLYYALEFFLATPTWVVTSLYLVSVLHLSPLQLVLMGTVMEASIFLCEFP |
| Ga0157377_111021452 | 3300014745 | Miscanthus Rhizosphere | MRGLRATTVYYGLSFGGYMPTWVVMAVYLVNELHLSPLQLVLMGTAMEA |
| Ga0132256_1005666181 | 3300015372 | Arabidopsis Rhizosphere | VTRLPAIRVFYALEFVLATPAWVVVSLYLVRDLHLSPLELVLMGTAMEAAV |
| Ga0132256_1012375602 | 3300015372 | Arabidopsis Rhizosphere | MRRLRATTFFYALELLLALPTWVVVSIYLVRELQLSPLQLVLMGTAMEA |
| Ga0132257_1037314971 | 3300015373 | Arabidopsis Rhizosphere | MRRLRATTVFYALELLLALPTWVVVSIYLVRELQLSPLQLVLMGTAMEA |
| Ga0132255_1003681904 | 3300015374 | Arabidopsis Rhizosphere | MRRFRATTVYYGLSFGGYMPTWVVMAVYLVQELHLSPLQLVLMGTAMEAAVFVF |
| Ga0066655_106605611 | 3300018431 | Grasslands Soil | MRRLPARPVYYGLSFVLRMPTWVVMAVYLVQELHFSPLQLVLMGTVMEGV |
| Ga0066667_118388042 | 3300018433 | Grasslands Soil | VRRADAEKLYYALEFFLATPTWVVTSLYLVSVLHLSPLQLVLMGTVME |
| Ga0190270_126085872 | 3300018469 | Soil | MRRPSATNVYYGLQFLLYMPTWVVMAVYLVRELDLS |
| Ga0173481_104990102 | 3300019356 | Soil | MKRLPATTVFYGLELLLSFPTFVVMAVYLVRELHFTPLELVLMGTAMEG |
| Ga0173482_102552821 | 3300019361 | Soil | MRRADATRLYYVLQVLLFMPTWVVMAVYLVQTVHLSPL |
| Ga0193701_10261171 | 3300019875 | Soil | VRLPATTVYYGLSFGSRLPTWVVMAVYLVRELHLSPLQLVLMGTAMEAAVFLF |
| Ga0193724_10929332 | 3300020062 | Soil | VRPFPARAVYFGLQFGAHLPTWVVMAVYLVRELHFSPL |
| Ga0247802_10092031 | 3300023077 | Soil | MRRADATRLYYVLQVLLFMPTWVVMAVYLVQTVHL |
| Ga0247661_10909911 | 3300024254 | Soil | MRRFGATTVYYGLSFGGYMPTWVVMSVYLVSELHLSPLQLVLM |
| Ga0247671_10266591 | 3300024284 | Soil | VKRPGAERLYYSLTFVLSMPTWVVMAVYLVRDLHLTPLQL |
| Ga0207663_108828591 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRVDAEKLYYALEFFLATPTWVVTSLYLVSVLDLSPLQLVLMGTAMEAS |
| Ga0207646_115462361 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRPSAESLYYALTFGLRMPTWVVMAVYLVRELHLSPLQLVLMGTAM |
| Ga0207687_110681422 | 3300025927 | Miscanthus Rhizosphere | MRPLPARAVYFGLQFGAHLPTWVVMSVYLVRELHLSPLQLVLMGTA |
| Ga0207664_118615072 | 3300025929 | Agricultural Soil | VRRLPALKLFYALEVLLSMPTWVVVSIYLVRDLHLSPLQLVLMGTAMEAAVF |
| Ga0207709_102853723 | 3300025935 | Miscanthus Rhizosphere | VRRLPATTVYYGLELLLSMPTWVVMSVYLVSELDLSPLQLVLMGTA |
| Ga0207651_117736682 | 3300025960 | Switchgrass Rhizosphere | MRRVDAEKLYYGLEFFLATPTWVVTSLYLVSVLHLSPLQLVLMGTAM |
| Ga0207640_109620332 | 3300025981 | Corn Rhizosphere | MRPLPARAVYFGLQFGAHLPTWVVMSVYLVRELHLSPLQL |
| Ga0207708_106760572 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPLPARAVYFGLQFGAHLPTWVVMSVYLVRELHFSPLQLVLMGTAMEAAIFLCE |
| Ga0207683_104881341 | 3300026121 | Miscanthus Rhizosphere | MRRLPATTVYYGLELLLSAPTFVVVAVYLVSDLDLSPLQLVLMGTAMEAT |
| Ga0207683_108965211 | 3300026121 | Miscanthus Rhizosphere | MRPLPARAVYFGLQFGAHLPTWVVMSVYLVRELHLSPLQLVLMGTAMEA |
| Ga0209811_102116851 | 3300027821 | Surface Soil | VRRLPPTAVYFGLQLGAHLPTWVVMAVYLVRELHFS |
| Ga0209382_103405234 | 3300027909 | Populus Rhizosphere | MRRLPATTVYYGLSFGLRTPTWVVMAVYLVRELHFSPL |
| Ga0268265_114146652 | 3300028380 | Switchgrass Rhizosphere | MRRLPATTVYYGLELLLSAPTFVVVAVYLVSDLELSPLQLVLMGTAMEATVFL |
| Ga0265337_11653362 | 3300028556 | Rhizosphere | VRRPGPEGLYYALTFVLRMPTWVVMAVYLVQKLHLTPLQLVLMGTAME |
| Ga0307276_101233222 | 3300028705 | Soil | MKRLPATDVYYGLCFGLHLPTWVVMAVYLVREVHFSPLQLVL |
| Ga0307291_10054331 | 3300028707 | Soil | VRRADATRLYYALKILVSMPTWVVMAVYLVQELHLSPLQL |
| Ga0307293_102226811 | 3300028711 | Soil | VRRADAERLYYALELLLSAPTWVVASLYLVTELHLSPLQLVLMGTAMEGTVFL |
| Ga0307303_100176093 | 3300028713 | Soil | VRPLPPRAVYFGLQFGAHLPTWVVMSVYLVRELHFSPL |
| Ga0307303_101533771 | 3300028713 | Soil | VRRADATRLYYALQILVSMPTWVVMAVYLVQELHLSPLQ |
| Ga0307318_101668992 | 3300028744 | Soil | MRRPAATNVYYGLQFLLYMPTWVVMAVYLVRELDLSPLELILMGT |
| Ga0307316_101367842 | 3300028755 | Soil | VRRADATRLYYVLQVLLLMPTWVVMAVYLVRELNLSPLELSLIG |
| Ga0307320_101780002 | 3300028771 | Soil | MTRLRATTVFYGLEFFLSWTTFVVMAVYLVNELHL |
| Ga0307323_100622463 | 3300028787 | Soil | MRRLPARPVYYGLNFVLRLPTWVVMAVYLVQELHFSPLQLVLMG |
| Ga0307323_103458881 | 3300028787 | Soil | MQRLPARTVYYGLEFFLRFPTWVVMAVYLVRELHFSPLQLVLMGTAMEAAVFLFEI |
| Ga0307284_101067102 | 3300028799 | Soil | MRRLPATTVYYGLQVLLFVPTWVVMAVYLVRVAHLSPLQLVLMGT |
| Ga0307284_101189303 | 3300028799 | Soil | VKRLPATTVYYGICNFGLHLPTWVVMAVYLVRELHFSPLQLVLMG |
| Ga0307310_101691211 | 3300028824 | Soil | VRRADATRLYYALQFLLFMPTWVVVAVYLVRVLHLS |
| Ga0307310_102258123 | 3300028824 | Soil | MRRLPATTVYYGLTFGLRLPTWVVMAVYLVRDLHF |
| Ga0307314_101369662 | 3300028872 | Soil | MRRADPTRLYYILQLLLFVPTWVVMAVYLVRVVHL |
| Ga0307278_102630021 | 3300028878 | Soil | VRRLPATTVYYGLEFALAMPTWVVISVYLVRDLHLSPLELVLMGTAMEA |
| Ga0307300_102506361 | 3300028880 | Soil | VRRLPATTVYYGLSFGLRLPTWVVMSVYLVSELHLSPLQLVLMG |
| Ga0307308_101911042 | 3300028884 | Soil | VKRADATRLYYALQVLLFMPTWVVMAVYLVRVLHLSPLQLILMGT |
| Ga0307495_101733151 | 3300031199 | Soil | VRPLPARAVYFGIQFGAHLPTWVVMAVYLVRELHFSPLQLVLMGTAME |
| Ga0308194_100777751 | 3300031421 | Soil | MRRLPARPVYYGLNFVLRLPTWVVMAVYLVQELHFSPLQLVLMGTAMEAAVFLFE |
| Ga0318573_107254992 | 3300031564 | Soil | VRRADPERLYYAIEFFASTPTWVVMSLYLVSVLDLSPLQLVLMGTAMEASVF |
| Ga0318529_104743702 | 3300031792 | Soil | VRRADPERLYYAIEFFASTPTWVVMSLYLVSVLDLSPLQLVLMGTAME |
| Ga0307413_118463402 | 3300031824 | Rhizosphere | MRRADATRLYYALQILLSMPTWVVMSVYLVQELHLSPLQLVL |
| Ga0310904_111916012 | 3300031854 | Soil | MRGLRATTVYYGLSFGGYMPTWVVMAVYLVNELHLS |
| Ga0310904_112226411 | 3300031854 | Soil | MRRLPATTVYYGLELLLSAPTFVVVAVYLVSDLDLSPLQLVLMGTAMEATV |
| Ga0308174_115800131 | 3300031939 | Soil | MRRLPATTVYYGLSVGSRLPTWVVMAVYLVRELHLSPLQLVLMGTAMEAA |
| Ga0316583_102314592 | 3300032133 | Rhizosphere | VRRPSAETLYYGLSFGLRMPTWVVLAVYFVRELHFSPLQLI |
| Ga0310896_106616502 | 3300032211 | Soil | MRRFSATAVYYGLSFGAYMPTWVVMSVYLVSELHLSPLQLVL |
| Ga0364945_0195248_1_111 | 3300034115 | Sediment | MRRPSATNVYYGLQFLLYMPTWVVIAVYLVRELDLSP |
| ⦗Top⦘ |