NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045776

Metagenome / Metatranscriptome Family F045776

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045776
Family Type Metagenome / Metatranscriptome
Number of Sequences 152
Average Sequence Length 46 residues
Representative Sequence VRRLPATTVYYGLSFGLRLPTWVVMSVYLVSELHLSPLQLVLMG
Number of Associated Samples 130
Number of Associated Scaffolds 152

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 55.92 %
% of genes near scaffold ends (potentially truncated) 99.34 %
% of genes from short scaffolds (< 2000 bps) 97.37 %
Associated GOLD sequencing projects 126
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.026 % of family members)
Environment Ontology (ENVO) Unclassified
(30.263 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.632 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 47.22%    β-sheet: 0.00%    Coil/Unstructured: 52.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 152 Family Scaffolds
PF00583Acetyltransf_1 35.53
PF01061ABC2_membrane 22.37
PF13649Methyltransf_25 9.21
PF08241Methyltransf_11 4.61
PF12847Methyltransf_18 2.63
PF13673Acetyltransf_10 2.63
PF13489Methyltransf_23 2.63
PF00005ABC_tran 1.97
PF13672PP2C_2 0.66
PF01833TIG 0.66
PF01557FAA_hydrolase 0.66
PF13508Acetyltransf_7 0.66



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.50 %
UnclassifiedrootN/A12.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig63040All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300000880|AL20A1W_1224590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1330Open in IMG/M
3300000955|JGI1027J12803_109609232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium570Open in IMG/M
3300000956|JGI10216J12902_104057056All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300000956|JGI10216J12902_108124427All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300000956|JGI10216J12902_112702838All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300004081|Ga0063454_100111129All Organisms → cellular organisms → Bacteria1340Open in IMG/M
3300004157|Ga0062590_101863510All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300004479|Ga0062595_100835909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium765Open in IMG/M
3300005161|Ga0066807_1038156All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005166|Ga0066674_10529357All Organisms → cellular organisms → Bacteria → Terrabacteria group527Open in IMG/M
3300005177|Ga0066690_10929373All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005332|Ga0066388_101898800All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300005333|Ga0070677_10578872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci619Open in IMG/M
3300005337|Ga0070682_101798435All Organisms → cellular organisms → Bacteria → Terrabacteria group534Open in IMG/M
3300005367|Ga0070667_101552523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300005438|Ga0070701_10090410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1676Open in IMG/M
3300005441|Ga0070700_101849768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella catacumbae521Open in IMG/M
3300005445|Ga0070708_100640359All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300005445|Ga0070708_100736138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium927Open in IMG/M
3300005458|Ga0070681_11912790All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005553|Ga0066695_10626773All Organisms → cellular organisms → Bacteria → Terrabacteria group641Open in IMG/M
3300005555|Ga0066692_10150431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1429Open in IMG/M
3300005558|Ga0066698_11027121All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005560|Ga0066670_10497747Not Available749Open in IMG/M
3300005563|Ga0068855_100239632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2027Open in IMG/M
3300005563|Ga0068855_102214108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci551Open in IMG/M
3300005577|Ga0068857_102549674All Organisms → cellular organisms → Bacteria → Terrabacteria group502Open in IMG/M
3300005614|Ga0068856_102156515Not Available566Open in IMG/M
3300005614|Ga0068856_102303625All Organisms → cellular organisms → Bacteria → Terrabacteria group547Open in IMG/M
3300005713|Ga0066905_102145947All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300005764|Ga0066903_100902944All Organisms → cellular organisms → Bacteria1599Open in IMG/M
3300005764|Ga0066903_105703269All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300005842|Ga0068858_102312953All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005874|Ga0075288_1057486Not Available610Open in IMG/M
3300006028|Ga0070717_11327414All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300006042|Ga0075368_10187300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia873Open in IMG/M
3300006046|Ga0066652_101450413All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300006046|Ga0066652_101588338Not Available602Open in IMG/M
3300006358|Ga0068871_102375174All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300006578|Ga0074059_12123298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1268Open in IMG/M
3300006605|Ga0074057_11290146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium865Open in IMG/M
3300006755|Ga0079222_12395336All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300006791|Ga0066653_10760939All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300006845|Ga0075421_100006698All Organisms → cellular organisms → Bacteria14082Open in IMG/M
3300006845|Ga0075421_101161796All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300006853|Ga0075420_100189451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1798Open in IMG/M
3300009093|Ga0105240_12717295All Organisms → cellular organisms → Bacteria → Terrabacteria group510Open in IMG/M
3300009098|Ga0105245_12507445All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300009137|Ga0066709_100403048All Organisms → cellular organisms → Bacteria1898Open in IMG/M
3300009137|Ga0066709_103788540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium549Open in IMG/M
3300009148|Ga0105243_12672243All Organisms → cellular organisms → Bacteria → Terrabacteria group539Open in IMG/M
3300009176|Ga0105242_10178091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1874Open in IMG/M
3300009176|Ga0105242_12016286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia620Open in IMG/M
3300009789|Ga0126307_11570118All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300009792|Ga0126374_11522076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300010037|Ga0126304_10271065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1120Open in IMG/M
3300010042|Ga0126314_10248718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1261Open in IMG/M
3300010043|Ga0126380_10356488All Organisms → cellular organisms → Bacteria → Terrabacteria group1067Open in IMG/M
3300010044|Ga0126310_11090042Not Available635Open in IMG/M
3300010322|Ga0134084_10214797All Organisms → cellular organisms → Bacteria → Terrabacteria group679Open in IMG/M
3300010333|Ga0134080_10651025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300010361|Ga0126378_10438792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1420Open in IMG/M
3300010364|Ga0134066_10065369Not Available975Open in IMG/M
3300010366|Ga0126379_11403035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia804Open in IMG/M
3300010399|Ga0134127_10667500All Organisms → cellular organisms → Bacteria → Terrabacteria group1076Open in IMG/M
3300010403|Ga0134123_10851764All Organisms → cellular organisms → Bacteria → Terrabacteria group912Open in IMG/M
3300012003|Ga0120163_1080406All Organisms → cellular organisms → Bacteria → Terrabacteria group735Open in IMG/M
3300012011|Ga0120152_1184974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300012204|Ga0137374_10426456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1047Open in IMG/M
3300012204|Ga0137374_10663053Not Available788Open in IMG/M
3300012206|Ga0137380_10958424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia733Open in IMG/M
3300012206|Ga0137380_11124153Not Available669Open in IMG/M
3300012208|Ga0137376_11079896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium687Open in IMG/M
3300012354|Ga0137366_10422723All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300012354|Ga0137366_10589603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium798Open in IMG/M
3300012355|Ga0137369_10428030Not Available949Open in IMG/M
3300012356|Ga0137371_10813151All Organisms → cellular organisms → Bacteria → Terrabacteria group712Open in IMG/M
3300012360|Ga0137375_10667522Not Available854Open in IMG/M
3300012360|Ga0137375_11459916Not Available505Open in IMG/M
3300012891|Ga0157305_10089525All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium740Open in IMG/M
3300012907|Ga0157283_10061038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium899Open in IMG/M
3300012908|Ga0157286_10413715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300012914|Ga0157297_10457633All Organisms → cellular organisms → Bacteria → Terrabacteria group526Open in IMG/M
3300012915|Ga0157302_10062175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1086Open in IMG/M
3300012955|Ga0164298_10849142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium659Open in IMG/M
3300012985|Ga0164308_10854761All Organisms → cellular organisms → Bacteria → Terrabacteria group798Open in IMG/M
3300012986|Ga0164304_11246991All Organisms → cellular organisms → Bacteria → Terrabacteria group603Open in IMG/M
3300012986|Ga0164304_11824268All Organisms → cellular organisms → Bacteria → Terrabacteria group509Open in IMG/M
3300012989|Ga0164305_11009803Not Available708Open in IMG/M
3300013100|Ga0157373_10921060All Organisms → cellular organisms → Bacteria → Terrabacteria group649Open in IMG/M
3300013307|Ga0157372_13123154All Organisms → cellular organisms → Bacteria → Terrabacteria group529Open in IMG/M
3300013766|Ga0120181_1075976All Organisms → cellular organisms → Bacteria → Terrabacteria group739Open in IMG/M
3300014150|Ga0134081_10089531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria958Open in IMG/M
3300014745|Ga0157377_11102145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300015372|Ga0132256_100566618All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300015372|Ga0132256_101237560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium860Open in IMG/M
3300015373|Ga0132257_103731497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300015374|Ga0132255_100368190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2085Open in IMG/M
3300018431|Ga0066655_10660561All Organisms → cellular organisms → Bacteria → Terrabacteria group707Open in IMG/M
3300018433|Ga0066667_11838804All Organisms → cellular organisms → Bacteria → Terrabacteria group550Open in IMG/M
3300018469|Ga0190270_12608587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300019356|Ga0173481_10499010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella catacumbae619Open in IMG/M
3300019361|Ga0173482_10255282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium749Open in IMG/M
3300019875|Ga0193701_1026117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1198Open in IMG/M
3300020062|Ga0193724_1092933Not Available618Open in IMG/M
3300023077|Ga0247802_1009203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1274Open in IMG/M
3300024254|Ga0247661_1090991All Organisms → cellular organisms → Bacteria → Terrabacteria group575Open in IMG/M
3300024284|Ga0247671_1026659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium873Open in IMG/M
3300025916|Ga0207663_10882859All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium714Open in IMG/M
3300025922|Ga0207646_11546236All Organisms → cellular organisms → Bacteria → Terrabacteria group574Open in IMG/M
3300025927|Ga0207687_11068142All Organisms → cellular organisms → Bacteria → Terrabacteria group693Open in IMG/M
3300025929|Ga0207664_11861507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium524Open in IMG/M
3300025935|Ga0207709_10285372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1221Open in IMG/M
3300025960|Ga0207651_11773668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300025981|Ga0207640_10962033All Organisms → cellular organisms → Bacteria → Terrabacteria group749Open in IMG/M
3300026075|Ga0207708_10676057All Organisms → cellular organisms → Bacteria → Terrabacteria group881Open in IMG/M
3300026121|Ga0207683_10488134All Organisms → cellular organisms → Bacteria → Terrabacteria group1137Open in IMG/M
3300026121|Ga0207683_10896521All Organisms → cellular organisms → Bacteria → Terrabacteria group823Open in IMG/M
3300027821|Ga0209811_10211685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium734Open in IMG/M
3300027909|Ga0209382_10340523All Organisms → cellular organisms → Bacteria → Terrabacteria group1682Open in IMG/M
3300028380|Ga0268265_11414665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium698Open in IMG/M
3300028556|Ga0265337_1165336Not Available600Open in IMG/M
3300028705|Ga0307276_10123322Not Available643Open in IMG/M
3300028707|Ga0307291_1005433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2722Open in IMG/M
3300028711|Ga0307293_10222681Not Available600Open in IMG/M
3300028713|Ga0307303_10017609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1339Open in IMG/M
3300028713|Ga0307303_10153377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300028744|Ga0307318_10166899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium757Open in IMG/M
3300028755|Ga0307316_10136784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium869Open in IMG/M
3300028771|Ga0307320_10178000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia828Open in IMG/M
3300028787|Ga0307323_10062246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1322Open in IMG/M
3300028787|Ga0307323_10345888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300028799|Ga0307284_10106710Not Available1052Open in IMG/M
3300028799|Ga0307284_10118930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1001Open in IMG/M
3300028824|Ga0307310_10169121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1018Open in IMG/M
3300028824|Ga0307310_10225812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium892Open in IMG/M
3300028872|Ga0307314_10136966All Organisms → cellular organisms → Bacteria → Terrabacteria group698Open in IMG/M
3300028878|Ga0307278_10263002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium765Open in IMG/M
3300028880|Ga0307300_10250636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300028884|Ga0307308_10191104All Organisms → cellular organisms → Bacteria → Terrabacteria group981Open in IMG/M
3300031199|Ga0307495_10173315Not Available575Open in IMG/M
3300031421|Ga0308194_10077775All Organisms → cellular organisms → Bacteria → Terrabacteria group911Open in IMG/M
3300031564|Ga0318573_10725499All Organisms → cellular organisms → Bacteria → Terrabacteria group534Open in IMG/M
3300031792|Ga0318529_10474370All Organisms → cellular organisms → Bacteria → Terrabacteria group582Open in IMG/M
3300031824|Ga0307413_11846340All Organisms → cellular organisms → Bacteria → Terrabacteria group542Open in IMG/M
3300031854|Ga0310904_11191601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia549Open in IMG/M
3300031854|Ga0310904_11222641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300031939|Ga0308174_11580013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300032133|Ga0316583_10231459Not Available640Open in IMG/M
3300032211|Ga0310896_10661650All Organisms → cellular organisms → Bacteria → Terrabacteria group588Open in IMG/M
3300034115|Ga0364945_0195248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.24%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.26%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.63%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.63%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.63%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.32%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.32%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.32%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.32%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.32%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.66%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.66%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.66%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.66%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.66%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
3300000880Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005161Soil and rhizosphere microbial communities from Laval, Canada - mgLPAEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012003Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25MEnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024284Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032133Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrAHost-AssociatedOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_003951302124908016VRRLPATTIYYGLNVVLRMPTWVVMAVYLVRELHLSPLQLVLMGTAMEAAVFLF
AL20A1W_122459033300000880PermafrostVRRADATRLYYMLQFIQYLPTWVVMAVYLVRTLHLSPLQLVLM
JGI1027J12803_10960923213300000955SoilVGLAEAVKRVGAEKLYYALELVLSTPTWIVMSLYLVSDLNLSPLQLVLMGTAMEA
JGI10216J12902_10405705613300000956SoilMRRVDAEKLYYALEFLLSTPTWVVTSLYLVSVLDLSPLQLVLMGTAMEASVFLC
JGI10216J12902_10812442723300000956SoilVRRADPERLYYVLQVLLAIPTWVAMAVYLVKVVDMSPLQLVLMGTAMEAT
JGI10216J12902_11270283813300000956SoilMRRVDAEKLYYALEFFLSTPTWVVTSLYLVSVLHLSPLQLVLMGTAMEASVFLC
Ga0063454_10011112933300004081SoilMRRVDAEKLYYALEFFLATPTWVVTSLYLVSVLDLSPLQLVLMGTAMEGAVFLFE
Ga0062590_10186351013300004157SoilMKRLPATTVFYGLELLLSFPTFVVMAVYLVRELHFTPLELVLMGTAME
Ga0062595_10083590923300004479SoilVKRPSAETLYYALSFALRMPTWVVMAVYLVRTLHLSPLQLVLM
Ga0066807_103815613300005161SoilMRRLPATAVFYGLEFLLSMPTWVVVAVYLVQELDFSPLQLVLMGTAMEAAVSCARFRPE*
Ga0066674_1052935723300005166SoilVRRLPATTVYYGLSFGSRLPTWVVAAVYLVRELHLSPLQLVLMGT
Ga0066690_1092937313300005177SoilMKRLPATTVYYGLTFGLRLPTWVVMAVYLVRELHFSPLQLVLMGTAME
Ga0066388_10189880023300005332Tropical Forest SoilMRRFRATTVYYGLSFGGYMPTWVVMAVYLVQELHLSPLQLVLMGTAMEA
Ga0070677_1057887213300005333Miscanthus RhizosphereVRRLPATAVYFGLQLGAHLPTWVVMAVYLVRELHLSPLQLVLMGTAMEA
Ga0070682_10179843513300005337Corn RhizosphereVTRLPAKTVYYGLCFGLRLPTWVVMAVYLVRELHFSPLQLVLM
Ga0070667_10155252323300005367Switchgrass RhizosphereVRRLPATAVYFGLQLGAHLPTWVVMAVYLVRELHLSPLQLVL
Ga0070701_1009041013300005438Corn, Switchgrass And Miscanthus RhizosphereVRRLPATTVYYGLELLLSMPTWVVMSVYLVSELDLSPLQLVLM
Ga0070700_10184976823300005441Corn, Switchgrass And Miscanthus RhizosphereMRGLRATTVYYGLSFGGYMPTWVVMAVYLVNELHLSPLQLVL
Ga0070708_10064035923300005445Corn, Switchgrass And Miscanthus RhizosphereVRRLPATAVYFGLQLGAHLPTWVVMAVYLVRELHFSPLQLVLMGTAMEAA
Ga0070708_10073613813300005445Corn, Switchgrass And Miscanthus RhizosphereVKRLPATTVYYGLSFGLHLPTWVVMAVYLVRELHFSPLQL
Ga0070681_1191279023300005458Corn RhizosphereMRRFGATTVYYGLSFGGYMPTWVVMSVYLVSELHLSPLQLVLMGTAMEAAV
Ga0066695_1062677313300005553SoilMRRLPARPVYYGLNFVLRMPTWVVMAVYLVQELHFSPLQLVLMG
Ga0066692_1015043113300005555SoilMRRLPARPVYFGLSFVLRMPTWVVMAVYLVQELHFSPLQLVLMGTAMEA
Ga0066698_1102712123300005558SoilMKRLPATTVYYGLTFGLRLPTWVVMAVYLVRELHFSPLQLVLMGTAMEAAVFLFE
Ga0066670_1049774723300005560SoilVKRADPTRLYYSLEFLLSMPTWVAMAVFLVSVLHFSPLQLVLMGTAME
Ga0068855_10023963213300005563Corn RhizosphereMRPLPARGVYFALQFGAHLSTWVVMAVYLVRELHFSPLQLVLMGTAMEAAVFL
Ga0068855_10221410823300005563Corn RhizosphereVRRLPATAVYFGLQLGAHLPTWVVMAVYLVRELHFSPLQLVLMGTAMEAAVFL
Ga0068857_10254967413300005577Corn RhizosphereMRPLPPRAVYFGLQFGSHLPTWVVMSVYLVRELHFSPLQLVLMGTAME
Ga0068856_10215651523300005614Corn RhizosphereVKPLPATRVYYGICCFGLHLPTWVVMAVYLVRDLHLTPLQL
Ga0068856_10230362523300005614Corn RhizosphereVRRAEPTRLYYSLEFLLSMPTWVAMAVYLVSVLHFSPLQLVLMGTAME
Ga0066905_10214594723300005713Tropical Forest SoilVRRADAEKLYYALELATSMPTWIVMSLYLVSVLELTPLQLVLMGTAMEAAVFL
Ga0066903_10090294433300005764Tropical Forest SoilMKRLPARTVYYGLELLLRVPTWVVMSVYLVQELHLSPLQLVLMGTAME
Ga0066903_10570326913300005764Tropical Forest SoilVKRPGAERLYYWLTFVLSMPTWVVVAVYLVRDLHLTPLQLVLMGTAMEA
Ga0068858_10231295323300005842Switchgrass RhizosphereLRPLPARAVYFGLQLGAHLPTWVVMSVYLVRELHFSPLQLVLMGTAMEAA
Ga0075288_105748613300005874Rice Paddy SoilVRPLPARPVYYGLQFGAHLPTWVVMAVYLVRELHFSP
Ga0070717_1132741423300006028Corn, Switchgrass And Miscanthus RhizosphereVRRVGAEKLYYSLEFFLSMPTWVVVSLYLVSVLHLTPFQLVLMGTAMEASIFLFE
Ga0075368_1018730013300006042Populus EndosphereMRGLRATTVYYGLSFGGYMPTWVVMAVYLVSELHL
Ga0066652_10145041313300006046SoilMKRLSATTVYYGLSFGLRMPTWVVMAVYLVRELHLSPLQLVLMGTAMEAAVF
Ga0066652_10158833813300006046SoilMRRLPATTVFYGLELLGRLPTWVVMSVYLVRELHLSPLQLVLMGTAM
Ga0068871_10237517423300006358Miscanthus RhizosphereMRPLPARAVYFGLQFGAHLPTWVVMSVYLVRELHLSPLQLVLMGTAMEAA
Ga0074059_1212329813300006578SoilLRRADATRLYYALQILLSMPTWVVMAVYLVQELHLSPLQLVLMG
Ga0074057_1129014623300006605SoilMRRLPATTVYYGLELLVSMPTWVVMSVYLVSELDLSPLQLVLMGT
Ga0079222_1239533613300006755Agricultural SoilVKRLPATTIYYGLSFGLQLPTWVVMSVYLVSELHLSPLQLVLMGTAMEGAVFLF
Ga0066653_1076093913300006791SoilMRRLPATTVFYGLELLGRLPTWVVMSVYLVRELHLSPLQLVLMGTAMEGAVF
Ga0075421_10000669813300006845Populus RhizosphereMRRLPATTVYYGLSFGLRTPTWVVMAVYLVRELHF
Ga0075421_10116179623300006845Populus RhizosphereMKRLPATTVFYGLEFFLSWPTWVVMAVYLVNELHLSPLQLVLMGTAMEAAV
Ga0075420_10018945113300006853Populus RhizosphereMKRLPATTVFYGLEFFLSWPTWVVMAVYLVNELHFSPLQLVLMGT
Ga0105240_1271729513300009093Corn RhizosphereVRRADPTRLYYVLEFLLAMPTWVAMAVYLVSVLHFSPLQLVLMVTA
Ga0105245_1250744513300009098Miscanthus RhizosphereMRRAEPTRLYYALQILLSMPTWVVMAVYLVKELHLLPLQLLLMGTAMEAAVFL
Ga0066709_10040304833300009137Grasslands SoilVRRADATRLYFELQILLSMPTWVVMSVYLVQELHFPPLQLVLMGL
Ga0066709_10378854013300009137Grasslands SoilVKRADPTRLYYSLEFLLSMPTWVAMAVFLVSVLHFSPLQLVLMGTA
Ga0105243_1267224323300009148Miscanthus RhizosphereMRKADATRLYYALQILSGVPTWVVMSVYLVQELHLSPLQLVLMGT
Ga0105242_1017809113300009176Miscanthus RhizosphereMRRADATRLYYALQILLSMPTWVVMAVYLVQELHLSPLQLVLMGTA
Ga0105242_1201628613300009176Miscanthus RhizosphereVRRVDAEKLYYWLEFFLATPTWVVTSLYLVSVLDLSPLQLVLMGTAMEATVFLC
Ga0126307_1157011813300009789Serpentine SoilVKRLPATTVYYGLELLLSTPTWVVVSIYLVRELHLSPLELLLM
Ga0126374_1152207623300009792Tropical Forest SoilMRRLSATTVYYGLSFGTRMPTWVVMAVYLVRELHLSPLQLVLMGTAMEAAVFLF
Ga0126304_1027106533300010037Serpentine SoilVKRFPATPVYYGLELALRVPTWVVMAVYLVSELHLSPVGLVLMGTAMEAAV
Ga0126314_1024871813300010042Serpentine SoilMRRLSPTTVYYGLSFGGYMPTWVVMAVYLVQELHLSPLQLVLMGT
Ga0126380_1035648813300010043Tropical Forest SoilMKRLAATSVYYGLSFGTNMPTWVVMAVYLVRDLHLSPLQLVLIGTAMEAAVFLFE
Ga0126310_1109004213300010044Serpentine SoilVRRLPATSVYFGLELVLRVPTWVVMAVYLVSELHLSPLELVL
Ga0134084_1021479713300010322Grasslands SoilMRRLSATPVYYGLSFGTRMPTWVVMAVYLVRELHFSPLHLVLM
Ga0134080_1065102513300010333Grasslands SoilMIRIRRLPATTVFYGLELLDRVPTWVVMSVYLVRELHLSPLQLVLMGTAMEAS
Ga0126378_1043879213300010361Tropical Forest SoilVRRFPATAVYYGLSFGGHLPTWVVMSVYLVRELHLSPLQLV
Ga0134066_1006536923300010364Grasslands SoilVKRPSAETLYYGLSFALRMPTWVVMAVYLVRTLHLSPL
Ga0126379_1140303513300010366Tropical Forest SoilMRRLRATTVYYGLSFVGYMPTWVVIAVYLVSELHLSPLQLVLMGTAMEAAVFA
Ga0134127_1066750023300010399Terrestrial SoilMRRLPATTVYYGLELLLSAPTFVVVAVYLVSDLDLSPLQLVLMGTAMEATVF
Ga0134123_1085176413300010403Terrestrial SoilMRRFGATTVYYGLSFGGYMPTWVVMSVYLVSELHLSP
Ga0120163_108040623300012003PermafrostVRRLPATSVFYALELLLRLPTWVAAAVYLVRELHFSPLQL
Ga0120152_118497413300012011PermafrostVRRLPPLRVYYGLEFFLAMPTWIVISIYLVRELHLSPL
Ga0137374_1042645613300012204Vadose Zone SoilMRRPSATTVFYGLEFLLSAPAWVVIAIYLVRDLHLSPLQLVLMGTAMEASVFLFE
Ga0137374_1066305313300012204Vadose Zone SoilVKRLPAVPVYYGLELLLRVPTWIVMAVYLVRELHL
Ga0137380_1095842413300012206Vadose Zone SoilVTRLPALKVFYGLEFFLSMPTWIVISIYLVRDLHLSPLQLVLMGTSM
Ga0137380_1112415313300012206Vadose Zone SoilVRRPSAETLYYGFSFGLRMPTWVVLAVYLVRTLHLSPLQLVLMGTAMEGA
Ga0137376_1107989613300012208Vadose Zone SoilMKRLPATTVYYGLTFGLRLPTWVVMAVYLVRELHLTPLQLVLMGTAMEAAVFLF
Ga0137366_1042272313300012354Vadose Zone SoilVRRADATRLYYVLQVLLFVPTWVVMAVYLVRVVHLSPLQLILMGTAMEAAVFL
Ga0137366_1058960323300012354Vadose Zone SoilVRRLPATTVYYGIEFVDRLPTWVVMAVYLVRELHFSPLQLVLMGT
Ga0137369_1042803013300012355Vadose Zone SoilVRRLPATSVYYALECARATPTWVVMSLYLVQVLHLSP
Ga0137371_1081315113300012356Vadose Zone SoilVRRLPATTVFYGLELLDRVPTWVVMSVFLVRELHLSPLQLVLMGTAME
Ga0137375_1066752213300012360Vadose Zone SoilVRRLPATSVYYALEFALATPTWVVMSLYLVQVLHLS
Ga0137375_1145991623300012360Vadose Zone SoilMRRFPATTVFYGLEFFLRWPTWVVMAVYLVRELDLSPLQLVLIGTAMEGAVFLS
Ga0157305_1008952513300012891SoilVRGLRATTVYYGLSFGGYMPTWVVMAVYLVNELHLSPLQLVLMGT
Ga0157283_1006103813300012907SoilVRRADATRLYYVLQVLLFMPTWVVMAVYLVQTVHLSPL
Ga0157286_1041371513300012908SoilMRRLPATTVYYGLELLLSAPTFVVVAVYLVSDLELSPLQLVLMGTA
Ga0157297_1045763323300012914SoilMRNADATRLYYALQILSGVPTWVVMSVYLVQELHLSPLQLVLMGTAMEG
Ga0157302_1006217513300012915SoilVRRPNAETLYYSLSFLSGMPTWVVMAVYLVRELHLTPLQLVLMGTA
Ga0164298_1084914213300012955SoilVRRLPATAVYFGLQLGAHLPTWVVMAVYLVRELHFSPLQLVLM
Ga0164308_1085476113300012985SoilMRRFGATTVYYGLSFGGYMPTWVVMSVYLVSELHLSPLQ
Ga0164304_1124699113300012986SoilMRRADATRLYYALQILLSMPTWVVMAVYLVQELHLSPLQLVLMGTAM
Ga0164304_1182426813300012986SoilVRRVDAERLYYALQLLLSMPTWVVVSVYLVSDLHLSP
Ga0164305_1100980313300012989SoilMRHVAAEKLYYALEFFLSTPTWVVTSLYLVSVLDLTPLQLVLMGTAMEASVFLCE
Ga0157373_1092106013300013100Corn RhizosphereMRPLPARAVYFGLQFGAHLPTWVVMSVYLVRELHL
Ga0157372_1312315413300013307Corn RhizosphereMRPLPARGVYFALQFGAHLPTWVVMAVYLVRELHFSP
Ga0120181_107597613300013766PermafrostMRRADPTRLYYTLQFLLFMPTWVVVAVYLVRVAHLSPLQLVLM
Ga0134081_1008953133300014150Grasslands SoilVRRADAEKLYYALEFFLATPTWVVTSLYLVSVLHLSPLQLVLMGTVMEASIFLCEFP
Ga0157377_1110214523300014745Miscanthus RhizosphereMRGLRATTVYYGLSFGGYMPTWVVMAVYLVNELHLSPLQLVLMGTAMEA
Ga0132256_10056661813300015372Arabidopsis RhizosphereVTRLPAIRVFYALEFVLATPAWVVVSLYLVRDLHLSPLELVLMGTAMEAAV
Ga0132256_10123756023300015372Arabidopsis RhizosphereMRRLRATTFFYALELLLALPTWVVVSIYLVRELQLSPLQLVLMGTAMEA
Ga0132257_10373149713300015373Arabidopsis RhizosphereMRRLRATTVFYALELLLALPTWVVVSIYLVRELQLSPLQLVLMGTAMEA
Ga0132255_10036819043300015374Arabidopsis RhizosphereMRRFRATTVYYGLSFGGYMPTWVVMAVYLVQELHLSPLQLVLMGTAMEAAVFVF
Ga0066655_1066056113300018431Grasslands SoilMRRLPARPVYYGLSFVLRMPTWVVMAVYLVQELHFSPLQLVLMGTVMEGV
Ga0066667_1183880423300018433Grasslands SoilVRRADAEKLYYALEFFLATPTWVVTSLYLVSVLHLSPLQLVLMGTVME
Ga0190270_1260858723300018469SoilMRRPSATNVYYGLQFLLYMPTWVVMAVYLVRELDLS
Ga0173481_1049901023300019356SoilMKRLPATTVFYGLELLLSFPTFVVMAVYLVRELHFTPLELVLMGTAMEG
Ga0173482_1025528213300019361SoilMRRADATRLYYVLQVLLFMPTWVVMAVYLVQTVHLSPL
Ga0193701_102611713300019875SoilVRLPATTVYYGLSFGSRLPTWVVMAVYLVRELHLSPLQLVLMGTAMEAAVFLF
Ga0193724_109293323300020062SoilVRPFPARAVYFGLQFGAHLPTWVVMAVYLVRELHFSPL
Ga0247802_100920313300023077SoilMRRADATRLYYVLQVLLFMPTWVVMAVYLVQTVHL
Ga0247661_109099113300024254SoilMRRFGATTVYYGLSFGGYMPTWVVMSVYLVSELHLSPLQLVLM
Ga0247671_102665913300024284SoilVKRPGAERLYYSLTFVLSMPTWVVMAVYLVRDLHLTPLQL
Ga0207663_1088285913300025916Corn, Switchgrass And Miscanthus RhizosphereMRRVDAEKLYYALEFFLATPTWVVTSLYLVSVLDLSPLQLVLMGTAMEAS
Ga0207646_1154623613300025922Corn, Switchgrass And Miscanthus RhizosphereVRRPSAESLYYALTFGLRMPTWVVMAVYLVRELHLSPLQLVLMGTAM
Ga0207687_1106814223300025927Miscanthus RhizosphereMRPLPARAVYFGLQFGAHLPTWVVMSVYLVRELHLSPLQLVLMGTA
Ga0207664_1186150723300025929Agricultural SoilVRRLPALKLFYALEVLLSMPTWVVVSIYLVRDLHLSPLQLVLMGTAMEAAVF
Ga0207709_1028537233300025935Miscanthus RhizosphereVRRLPATTVYYGLELLLSMPTWVVMSVYLVSELDLSPLQLVLMGTA
Ga0207651_1177366823300025960Switchgrass RhizosphereMRRVDAEKLYYGLEFFLATPTWVVTSLYLVSVLHLSPLQLVLMGTAM
Ga0207640_1096203323300025981Corn RhizosphereMRPLPARAVYFGLQFGAHLPTWVVMSVYLVRELHLSPLQL
Ga0207708_1067605723300026075Corn, Switchgrass And Miscanthus RhizosphereMRPLPARAVYFGLQFGAHLPTWVVMSVYLVRELHFSPLQLVLMGTAMEAAIFLCE
Ga0207683_1048813413300026121Miscanthus RhizosphereMRRLPATTVYYGLELLLSAPTFVVVAVYLVSDLDLSPLQLVLMGTAMEAT
Ga0207683_1089652113300026121Miscanthus RhizosphereMRPLPARAVYFGLQFGAHLPTWVVMSVYLVRELHLSPLQLVLMGTAMEA
Ga0209811_1021168513300027821Surface SoilVRRLPPTAVYFGLQLGAHLPTWVVMAVYLVRELHFS
Ga0209382_1034052343300027909Populus RhizosphereMRRLPATTVYYGLSFGLRTPTWVVMAVYLVRELHFSPL
Ga0268265_1141466523300028380Switchgrass RhizosphereMRRLPATTVYYGLELLLSAPTFVVVAVYLVSDLELSPLQLVLMGTAMEATVFL
Ga0265337_116533623300028556RhizosphereVRRPGPEGLYYALTFVLRMPTWVVMAVYLVQKLHLTPLQLVLMGTAME
Ga0307276_1012332223300028705SoilMKRLPATDVYYGLCFGLHLPTWVVMAVYLVREVHFSPLQLVL
Ga0307291_100543313300028707SoilVRRADATRLYYALKILVSMPTWVVMAVYLVQELHLSPLQL
Ga0307293_1022268113300028711SoilVRRADAERLYYALELLLSAPTWVVASLYLVTELHLSPLQLVLMGTAMEGTVFL
Ga0307303_1001760933300028713SoilVRPLPPRAVYFGLQFGAHLPTWVVMSVYLVRELHFSPL
Ga0307303_1015337713300028713SoilVRRADATRLYYALQILVSMPTWVVMAVYLVQELHLSPLQ
Ga0307318_1016689923300028744SoilMRRPAATNVYYGLQFLLYMPTWVVMAVYLVRELDLSPLELILMGT
Ga0307316_1013678423300028755SoilVRRADATRLYYVLQVLLLMPTWVVMAVYLVRELNLSPLELSLIG
Ga0307320_1017800023300028771SoilMTRLRATTVFYGLEFFLSWTTFVVMAVYLVNELHL
Ga0307323_1006224633300028787SoilMRRLPARPVYYGLNFVLRLPTWVVMAVYLVQELHFSPLQLVLMG
Ga0307323_1034588813300028787SoilMQRLPARTVYYGLEFFLRFPTWVVMAVYLVRELHFSPLQLVLMGTAMEAAVFLFEI
Ga0307284_1010671023300028799SoilMRRLPATTVYYGLQVLLFVPTWVVMAVYLVRVAHLSPLQLVLMGT
Ga0307284_1011893033300028799SoilVKRLPATTVYYGICNFGLHLPTWVVMAVYLVRELHFSPLQLVLMG
Ga0307310_1016912113300028824SoilVRRADATRLYYALQFLLFMPTWVVVAVYLVRVLHLS
Ga0307310_1022581233300028824SoilMRRLPATTVYYGLTFGLRLPTWVVMAVYLVRDLHF
Ga0307314_1013696623300028872SoilMRRADPTRLYYILQLLLFVPTWVVMAVYLVRVVHL
Ga0307278_1026300213300028878SoilVRRLPATTVYYGLEFALAMPTWVVISVYLVRDLHLSPLELVLMGTAMEA
Ga0307300_1025063613300028880SoilVRRLPATTVYYGLSFGLRLPTWVVMSVYLVSELHLSPLQLVLMG
Ga0307308_1019110423300028884SoilVKRADATRLYYALQVLLFMPTWVVMAVYLVRVLHLSPLQLILMGT
Ga0307495_1017331513300031199SoilVRPLPARAVYFGIQFGAHLPTWVVMAVYLVRELHFSPLQLVLMGTAME
Ga0308194_1007777513300031421SoilMRRLPARPVYYGLNFVLRLPTWVVMAVYLVQELHFSPLQLVLMGTAMEAAVFLFE
Ga0318573_1072549923300031564SoilVRRADPERLYYAIEFFASTPTWVVMSLYLVSVLDLSPLQLVLMGTAMEASVF
Ga0318529_1047437023300031792SoilVRRADPERLYYAIEFFASTPTWVVMSLYLVSVLDLSPLQLVLMGTAME
Ga0307413_1184634023300031824RhizosphereMRRADATRLYYALQILLSMPTWVVMSVYLVQELHLSPLQLVL
Ga0310904_1119160123300031854SoilMRGLRATTVYYGLSFGGYMPTWVVMAVYLVNELHLS
Ga0310904_1122264113300031854SoilMRRLPATTVYYGLELLLSAPTFVVVAVYLVSDLDLSPLQLVLMGTAMEATV
Ga0308174_1158001313300031939SoilMRRLPATTVYYGLSVGSRLPTWVVMAVYLVRELHLSPLQLVLMGTAMEAA
Ga0316583_1023145923300032133RhizosphereVRRPSAETLYYGLSFGLRMPTWVVLAVYFVRELHFSPLQLI
Ga0310896_1066165023300032211SoilMRRFSATAVYYGLSFGAYMPTWVVMSVYLVSELHLSPLQLVL
Ga0364945_0195248_1_1113300034115SedimentMRRPSATNVYYGLQFLLYMPTWVVIAVYLVRELDLSP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.