| Basic Information | |
|---|---|
| Family ID | F045710 |
| Family Type | Metagenome |
| Number of Sequences | 152 |
| Average Sequence Length | 45 residues |
| Representative Sequence | KYTTVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 77.63 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.421 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (21.710 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.447 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 39.44% Coil/Unstructured: 60.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF05050 | Methyltransf_21 | 17.76 |
| PF03796 | DnaB_C | 5.92 |
| PF07733 | DNA_pol3_alpha | 3.29 |
| PF13640 | 2OG-FeII_Oxy_3 | 3.29 |
| PF13489 | Methyltransf_23 | 2.63 |
| PF13578 | Methyltransf_24 | 2.63 |
| PF03480 | DctP | 2.63 |
| PF05711 | TylF | 2.63 |
| PF03567 | Sulfotransfer_2 | 1.97 |
| PF13186 | SPASM | 1.97 |
| PF02502 | LacAB_rpiB | 1.32 |
| PF05159 | Capsule_synth | 1.32 |
| PF04055 | Radical_SAM | 0.66 |
| PF01048 | PNP_UDP_1 | 0.66 |
| PF05175 | MTS | 0.66 |
| PF00777 | Glyco_transf_29 | 0.66 |
| PF07883 | Cupin_2 | 0.66 |
| PF01370 | Epimerase | 0.66 |
| PF13353 | Fer4_12 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 5.92 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 5.92 |
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 3.29 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 3.29 |
| COG0698 | Ribose 5-phosphate isomerase RpiB | Carbohydrate transport and metabolism [G] | 1.32 |
| COG3562 | Capsule polysaccharide modification protein KpsS | Cell wall/membrane/envelope biogenesis [M] | 1.32 |
| COG3563 | Capsule polysaccharide export protein KpsC/LpsZ | Cell wall/membrane/envelope biogenesis [M] | 1.32 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.66 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.66 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.63 % |
| Unclassified | root | N/A | 22.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10085717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium → Roseibium aggregatum | 1208 | Open in IMG/M |
| 3300001355|JGI20158J14315_10169922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 647 | Open in IMG/M |
| 3300001460|JGI24003J15210_10036197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1758 | Open in IMG/M |
| 3300001460|JGI24003J15210_10050377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1393 | Open in IMG/M |
| 3300005433|Ga0066830_10109249 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005523|Ga0066865_10431272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 501 | Open in IMG/M |
| 3300006027|Ga0075462_10013146 | All Organisms → cellular organisms → Bacteria | 2669 | Open in IMG/M |
| 3300006637|Ga0075461_10251138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Dolichospermum → Dolichospermum planctonicum | 519 | Open in IMG/M |
| 3300006802|Ga0070749_10602541 | Not Available | 592 | Open in IMG/M |
| 3300006810|Ga0070754_10358243 | Not Available | 644 | Open in IMG/M |
| 3300006867|Ga0075476_10008179 | All Organisms → cellular organisms → Bacteria | 4762 | Open in IMG/M |
| 3300006867|Ga0075476_10008635 | All Organisms → cellular organisms → Bacteria | 4633 | Open in IMG/M |
| 3300006867|Ga0075476_10055916 | All Organisms → Viruses | 1584 | Open in IMG/M |
| 3300006867|Ga0075476_10183463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 768 | Open in IMG/M |
| 3300006867|Ga0075476_10298602 | Not Available | 565 | Open in IMG/M |
| 3300006868|Ga0075481_10005040 | All Organisms → cellular organisms → Bacteria | 5329 | Open in IMG/M |
| 3300006868|Ga0075481_10024639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 2359 | Open in IMG/M |
| 3300006870|Ga0075479_10180391 | Not Available | 853 | Open in IMG/M |
| 3300006916|Ga0070750_10128820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1157 | Open in IMG/M |
| 3300006919|Ga0070746_10086318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1581 | Open in IMG/M |
| 3300007276|Ga0070747_1149783 | All Organisms → Viruses | 839 | Open in IMG/M |
| 3300007540|Ga0099847_1047786 | All Organisms → Viruses → Predicted Viral | 1352 | Open in IMG/M |
| 3300007542|Ga0099846_1262085 | Not Available | 598 | Open in IMG/M |
| 3300007609|Ga0102945_1068648 | Not Available | 665 | Open in IMG/M |
| 3300007623|Ga0102948_1112091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 838 | Open in IMG/M |
| 3300007960|Ga0099850_1016282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3320 | Open in IMG/M |
| 3300007960|Ga0099850_1118686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1081 | Open in IMG/M |
| 3300007960|Ga0099850_1373320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300008012|Ga0075480_10017827 | All Organisms → cellular organisms → Bacteria | 4377 | Open in IMG/M |
| 3300008012|Ga0075480_10295186 | Not Available | 824 | Open in IMG/M |
| 3300009001|Ga0102963_1107012 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium | 1139 | Open in IMG/M |
| 3300009001|Ga0102963_1218400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 758 | Open in IMG/M |
| 3300009001|Ga0102963_1402719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 537 | Open in IMG/M |
| 3300009071|Ga0115566_10039215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 3301 | Open in IMG/M |
| 3300009071|Ga0115566_10075910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 2206 | Open in IMG/M |
| 3300009071|Ga0115566_10151651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1445 | Open in IMG/M |
| 3300009077|Ga0115552_1048728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1942 | Open in IMG/M |
| 3300009077|Ga0115552_1262227 | All Organisms → cellular organisms → Archaea | 695 | Open in IMG/M |
| 3300009077|Ga0115552_1282501 | Not Available | 665 | Open in IMG/M |
| 3300009124|Ga0118687_10216598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 701 | Open in IMG/M |
| 3300009423|Ga0115548_1066509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1236 | Open in IMG/M |
| 3300009423|Ga0115548_1232200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 568 | Open in IMG/M |
| 3300009435|Ga0115546_1085876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1157 | Open in IMG/M |
| 3300009435|Ga0115546_1235004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 630 | Open in IMG/M |
| 3300009438|Ga0115559_1035822 | All Organisms → Viruses → Predicted Viral | 2255 | Open in IMG/M |
| 3300009438|Ga0115559_1263207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 610 | Open in IMG/M |
| 3300009449|Ga0115558_1180487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 878 | Open in IMG/M |
| 3300009495|Ga0115571_1027647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 2806 | Open in IMG/M |
| 3300009495|Ga0115571_1108214 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300009508|Ga0115567_10138760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1629 | Open in IMG/M |
| 3300009508|Ga0115567_10172551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1419 | Open in IMG/M |
| 3300009790|Ga0115012_11863650 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300010296|Ga0129348_1159013 | Not Available | 779 | Open in IMG/M |
| 3300010297|Ga0129345_1007826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4168 | Open in IMG/M |
| 3300010299|Ga0129342_1118648 | All Organisms → Viruses | 982 | Open in IMG/M |
| 3300010316|Ga0136655_1009343 | Not Available | 3561 | Open in IMG/M |
| 3300010368|Ga0129324_10311409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 618 | Open in IMG/M |
| 3300017713|Ga0181391_1021093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1622 | Open in IMG/M |
| 3300017719|Ga0181390_1006823 | All Organisms → Viruses → Predicted Viral | 4188 | Open in IMG/M |
| 3300017721|Ga0181373_1090705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 542 | Open in IMG/M |
| 3300017733|Ga0181426_1008533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 2013 | Open in IMG/M |
| 3300017737|Ga0187218_1009005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 2722 | Open in IMG/M |
| 3300017739|Ga0181433_1073169 | Not Available | 851 | Open in IMG/M |
| 3300017744|Ga0181397_1084451 | Not Available | 845 | Open in IMG/M |
| 3300017746|Ga0181389_1086055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 878 | Open in IMG/M |
| 3300017748|Ga0181393_1003563 | All Organisms → cellular organisms → Bacteria | 5207 | Open in IMG/M |
| 3300017749|Ga0181392_1066323 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300017752|Ga0181400_1128470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 729 | Open in IMG/M |
| 3300017762|Ga0181422_1036191 | Not Available | 1605 | Open in IMG/M |
| 3300017767|Ga0181406_1032447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1635 | Open in IMG/M |
| 3300017768|Ga0187220_1202130 | Not Available | 598 | Open in IMG/M |
| 3300017779|Ga0181395_1004778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 5098 | Open in IMG/M |
| 3300017949|Ga0181584_10011491 | All Organisms → cellular organisms → Bacteria | 6556 | Open in IMG/M |
| 3300017949|Ga0181584_10047371 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 3051 | Open in IMG/M |
| 3300017950|Ga0181607_10365098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 795 | Open in IMG/M |
| 3300017950|Ga0181607_10503889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 646 | Open in IMG/M |
| 3300017952|Ga0181583_10039296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3387 | Open in IMG/M |
| 3300017956|Ga0181580_10011768 | All Organisms → cellular organisms → Bacteria | 6980 | Open in IMG/M |
| 3300017958|Ga0181582_10671296 | Not Available | 627 | Open in IMG/M |
| 3300017958|Ga0181582_10886284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 526 | Open in IMG/M |
| 3300017962|Ga0181581_10495001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 756 | Open in IMG/M |
| 3300017968|Ga0181587_10055061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 2934 | Open in IMG/M |
| 3300017968|Ga0181587_10172803 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300017969|Ga0181585_10050253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 3261 | Open in IMG/M |
| 3300017969|Ga0181585_10365370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 991 | Open in IMG/M |
| 3300018039|Ga0181579_10255185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 1001 | Open in IMG/M |
| 3300018417|Ga0181558_10116469 | All Organisms → Viruses → Predicted Viral | 1636 | Open in IMG/M |
| 3300018417|Ga0181558_10526085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 613 | Open in IMG/M |
| 3300018418|Ga0181567_10295441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium → Roseibium aggregatum | 1091 | Open in IMG/M |
| 3300018418|Ga0181567_10643233 | Not Available | 682 | Open in IMG/M |
| 3300018421|Ga0181592_10246876 | All Organisms → Viruses → Predicted Viral | 1312 | Open in IMG/M |
| 3300018423|Ga0181593_10961882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 588 | Open in IMG/M |
| 3300018426|Ga0181566_10650258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 729 | Open in IMG/M |
| 3300018428|Ga0181568_10157029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium → Roseibium aggregatum | 1896 | Open in IMG/M |
| 3300018876|Ga0181564_10023668 | All Organisms → cellular organisms → Bacteria | 4558 | Open in IMG/M |
| 3300021347|Ga0213862_10364463 | Not Available | 516 | Open in IMG/M |
| 3300021364|Ga0213859_10223185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium → Roseibium aggregatum | 868 | Open in IMG/M |
| 3300021957|Ga0222717_10033077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 3413 | Open in IMG/M |
| 3300021958|Ga0222718_10071388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 2121 | Open in IMG/M |
| 3300021958|Ga0222718_10164952 | Not Available | 1238 | Open in IMG/M |
| 3300021958|Ga0222718_10267116 | All Organisms → Viruses | 901 | Open in IMG/M |
| 3300021959|Ga0222716_10192362 | Not Available | 1298 | Open in IMG/M |
| 3300021960|Ga0222715_10042786 | All Organisms → cellular organisms → Bacteria | 3176 | Open in IMG/M |
| 3300021960|Ga0222715_10137881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1528 | Open in IMG/M |
| 3300021960|Ga0222715_10173821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1313 | Open in IMG/M |
| 3300021960|Ga0222715_10281419 | Not Available | 953 | Open in IMG/M |
| 3300021964|Ga0222719_10558017 | Not Available | 675 | Open in IMG/M |
| 3300022905|Ga0255756_1244791 | Not Available | 609 | Open in IMG/M |
| 3300022914|Ga0255767_1290822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 606 | Open in IMG/M |
| 3300022926|Ga0255753_1135472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium | 1136 | Open in IMG/M |
| 3300022927|Ga0255769_10032699 | All Organisms → Viruses → Predicted Viral | 3402 | Open in IMG/M |
| 3300022928|Ga0255758_10080236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1793 | Open in IMG/M |
| (restricted) 3300022931|Ga0233433_10289028 | Not Available | 678 | Open in IMG/M |
| (restricted) 3300022933|Ga0233427_10156617 | All Organisms → Viruses | 1037 | Open in IMG/M |
| 3300022934|Ga0255781_10246143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium → Roseibium aggregatum | 844 | Open in IMG/M |
| 3300023172|Ga0255766_10005479 | All Organisms → cellular organisms → Bacteria | 10521 | Open in IMG/M |
| 3300023172|Ga0255766_10378248 | Not Available | 691 | Open in IMG/M |
| 3300023172|Ga0255766_10405586 | Not Available | 656 | Open in IMG/M |
| 3300023176|Ga0255772_10005209 | Not Available | 12055 | Open in IMG/M |
| 3300025120|Ga0209535_1066121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1446 | Open in IMG/M |
| 3300025623|Ga0209041_1053258 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300025626|Ga0209716_1022529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 2492 | Open in IMG/M |
| 3300025630|Ga0208004_1126454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Dolichospermum → Dolichospermum planctonicum | 578 | Open in IMG/M |
| 3300025632|Ga0209194_1160308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 523 | Open in IMG/M |
| 3300025641|Ga0209833_1048349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1455 | Open in IMG/M |
| 3300025641|Ga0209833_1132637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 675 | Open in IMG/M |
| 3300025653|Ga0208428_1029899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1744 | Open in IMG/M |
| 3300025674|Ga0208162_1016752 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 2914 | Open in IMG/M |
| 3300025687|Ga0208019_1138781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300025694|Ga0209406_1036232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1970 | Open in IMG/M |
| 3300025696|Ga0209532_1223130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 521 | Open in IMG/M |
| 3300025699|Ga0209715_1153766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 772 | Open in IMG/M |
| 3300025707|Ga0209667_1139606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 728 | Open in IMG/M |
| 3300025712|Ga0209305_1246911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 508 | Open in IMG/M |
| 3300025722|Ga0209660_1278946 | Not Available | 503 | Open in IMG/M |
| 3300025759|Ga0208899_1116057 | All Organisms → Viruses | 971 | Open in IMG/M |
| 3300025769|Ga0208767_1083438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1336 | Open in IMG/M |
| 3300025769|Ga0208767_1231778 | Not Available | 593 | Open in IMG/M |
| 3300025810|Ga0208543_1003100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 4418 | Open in IMG/M |
| 3300025815|Ga0208785_1089657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300025828|Ga0208547_1210813 | Not Available | 518 | Open in IMG/M |
| 3300025869|Ga0209308_10083160 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300025879|Ga0209555_10096323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1276 | Open in IMG/M |
| 3300025880|Ga0209534_10299517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 741 | Open in IMG/M |
| 3300025889|Ga0208644_1259603 | Not Available | 713 | Open in IMG/M |
| 3300026097|Ga0209953_1031935 | Not Available | 831 | Open in IMG/M |
| 3300026187|Ga0209929_1043314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1305 | Open in IMG/M |
| 3300027522|Ga0209384_1129495 | Not Available | 571 | Open in IMG/M |
| 3300027917|Ga0209536_103000447 | Not Available | 544 | Open in IMG/M |
| 3300028418|Ga0228615_1083106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 902 | Open in IMG/M |
| 3300031851|Ga0315320_10526464 | Not Available | 791 | Open in IMG/M |
| 3300032277|Ga0316202_10350886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 688 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 21.71% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 21.71% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 16.45% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.21% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.58% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.61% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.95% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.29% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.63% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.97% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.97% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.32% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.66% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.66% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.66% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.66% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.66% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.66% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300005433 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022905 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG | Environmental | Open in IMG/M |
| 3300022914 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025623 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025694 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025707 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025722 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026097 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028418 | Seawater microbial communities from Monterey Bay, California, United States - 16D | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100857171 | 3300000117 | Marine | GYGEIKDGNKYTTVGAEKKFGDNFSMYAGYEMTDVPSGTDTADMAAGIKFTF* |
| JGI20158J14315_101699222 | 3300001355 | Pelagic Marine | KKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF* |
| JGI24003J15210_100361971 | 3300001460 | Marine | DGNKYTTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFTF* |
| JGI24003J15210_100503771 | 3300001460 | Marine | DGNKYTTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFKF* |
| Ga0066830_101092492 | 3300005433 | Marine | DGNKYWTYGADKKIGENFSMYAGYEVTDKPTGTDTTNMAAGIKFTF* |
| Ga0066865_104312722 | 3300005523 | Marine | KKIGENFSMYAGYEVTDKPTGTDTTSMAAGIKFTF* |
| Ga0075462_100131461 | 3300006027 | Aqueous | DDTTYSVGYGKIEDGTAYTTVGAVKKIGDNFSMYGAFQTEDPASGVDTQDMAVGIKFTF* |
| Ga0075461_102511381 | 3300006637 | Aqueous | VGAEKKIGDNFSMYGAFEMTDPASGVDTQDAAVGIKFTF* |
| Ga0070749_106025411 | 3300006802 | Aqueous | GAEKKIGDNFSMYGAFEMTDPASGVDTQDAAVGIKFTF* |
| Ga0070754_103582431 | 3300006810 | Aqueous | TYSVGYGKVEDGAAYTTVGAEKKIGDNFSMYGAFEMTDPASGVDTQDAAVGIKFTF* |
| Ga0075476_100081797 | 3300006867 | Aqueous | DGAAYTTVGAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF* |
| Ga0075476_100086351 | 3300006867 | Aqueous | VGAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF* |
| Ga0075476_100559161 | 3300006867 | Aqueous | GAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF* |
| Ga0075476_101834631 | 3300006867 | Aqueous | GEIVDGNKYTTVGAEKKIGTNFSMYAGYEMTDVPSGTDTADMAAGIKFTF* |
| Ga0075476_102986021 | 3300006867 | Aqueous | AYTTVGAEKKIGENFSVYGAFEMTDVTSGVDTQDAAAGIKFTF* |
| Ga0075481_100050401 | 3300006868 | Aqueous | TFSVGYGEIKDGNKYTTVGAEKKFGDNFSMYAGYEMTDVTSGTDTADMAAGIKFTF* |
| Ga0075481_100246394 | 3300006868 | Aqueous | EKKFGDNFSMYAGYQMTDVVSGTDTNDMAAGIKFKF* |
| Ga0075479_101803912 | 3300006870 | Aqueous | KKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF* |
| Ga0070750_101288201 | 3300006916 | Aqueous | GAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF* |
| Ga0070746_100863181 | 3300006919 | Aqueous | GAEKKFGDNFSMYAGYQMTDVVSGTDTNDMAAGIKFKF* |
| Ga0070747_11497831 | 3300007276 | Aqueous | KIGENFSLYGAFQQTDVPTGVDTQDAAAGIKFTF* |
| Ga0099847_10477863 | 3300007540 | Aqueous | GTAYTTVGAEKKLGDNFSMYAGYEMTDVVSGTDTADMAAGIKFTF* |
| Ga0099846_12620851 | 3300007542 | Aqueous | GYGKVKSGTAYTTVGAEKTIGDNFSMYAGYEMTDVVSGTDTADMAAGIKFTF* |
| Ga0102945_10686482 | 3300007609 | Pond Water | DDTTYSVGYGKVEDGAAYTTVGAEKKIGENFSMYGAFEMTDPASGVDTQDAAAGIKFTF* |
| Ga0102948_11120912 | 3300007623 | Water | VGYGEIEDGNKYTTFGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF* |
| Ga0099850_10162821 | 3300007960 | Aqueous | GTAYTTVGAEKKIGENFSIYGAYEITDPTSGVDTQDMAAGIKFTF* |
| Ga0099850_11186861 | 3300007960 | Aqueous | KIGDNFSMYAGYEMTDVVSGTDTADMAAGIKFTF* |
| Ga0099850_13733201 | 3300007960 | Aqueous | TYSVGYGKIEDGAAYTTVGAEKKIGENFSVYGAFEMTDPASGVDTQDAAAGIKFTF* |
| Ga0075480_100178276 | 3300008012 | Aqueous | TVGAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF* |
| Ga0075480_102951862 | 3300008012 | Aqueous | FSVGYGKVKSGTAYTTVGAEKKIGDNFSMYAGYEMTDVVSGTDTADMAAGIKFTF* |
| Ga0102963_11070122 | 3300009001 | Pond Water | TYGAEKKIGSNFSMYAGYEITDVPSGTDTNDMAVGMKFTF* |
| Ga0102963_12184001 | 3300009001 | Pond Water | KFGENFSMYGAFQQTDVVSGVDTQDMAAGIKFTF* |
| Ga0102963_14027192 | 3300009001 | Pond Water | YTTVGAEKKIGDNFSMYGAFEMTDPASGVDTQDAAVGISFTF* |
| Ga0115566_100392151 | 3300009071 | Pelagic Marine | NKYTTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFTF* |
| Ga0115566_100759103 | 3300009071 | Pelagic Marine | IEDGNKYTTVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFKF* |
| Ga0115566_101516513 | 3300009071 | Pelagic Marine | VGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF* |
| Ga0115552_10487281 | 3300009077 | Pelagic Marine | NKYTTVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFKF* |
| Ga0115552_12622272 | 3300009077 | Pelagic Marine | KFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF* |
| Ga0115552_12825012 | 3300009077 | Pelagic Marine | GAEKKFGENFSMYGAYQMTDVPTGTDTNDMAVGIKFTF* |
| Ga0118687_102165981 | 3300009124 | Sediment | AYTTVGAEKKIGDNFSMYAGYEMTDVVSGTDTADMAAGIKFTF* |
| Ga0115548_10665092 | 3300009423 | Pelagic Marine | SVGYGEIEDGNKYTTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFTF* |
| Ga0115548_12322002 | 3300009423 | Pelagic Marine | EIEDGNKYTTVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFKF* |
| Ga0115546_10858762 | 3300009435 | Pelagic Marine | EIEDGNKYTTVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFIF* |
| Ga0115546_12350042 | 3300009435 | Pelagic Marine | YTTVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFKF* |
| Ga0115559_10358224 | 3300009438 | Pelagic Marine | VGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFIF* |
| Ga0115559_12632071 | 3300009438 | Pelagic Marine | IEDGNKYTTVGAEKKFGENFSMYGAFQQTDVVSGVDTQDAAAGIKFTF* |
| Ga0115558_11804872 | 3300009449 | Pelagic Marine | EIEDGNKYTTVGAEKKFGENFSMYGAYQMTDVPTGRDTNDMAAGIKFKF* |
| Ga0115571_10276475 | 3300009495 | Pelagic Marine | VGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFKF* |
| Ga0115571_11082143 | 3300009495 | Pelagic Marine | NKYSTVGAEKKIGDNFSMYGAFQTTDVVTGTDTNDMAAGIKFKF* |
| Ga0115567_101387601 | 3300009508 | Pelagic Marine | EKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF* |
| Ga0115567_101725511 | 3300009508 | Pelagic Marine | EDGNKYTTVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAVGIKFTF* |
| Ga0115012_118636501 | 3300009790 | Marine | NKYTTFGAEKKIGENFSAYAGYEMTDKPTGVDTNNMAAGIKFTF* |
| Ga0129348_11590131 | 3300010296 | Freshwater To Marine Saline Gradient | KVEDGAAYTTVGAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF* |
| Ga0129345_10078261 | 3300010297 | Freshwater To Marine Saline Gradient | KIGSNFSMYAGYEITDVPSGTDTNDMAVGMKFTF* |
| Ga0129342_11186481 | 3300010299 | Freshwater To Marine Saline Gradient | YTTVGAEKKIGDNFSMYAGYEMTDVVSGTDTADMAAGIKFKF* |
| Ga0136655_10093431 | 3300010316 | Freshwater To Marine Saline Gradient | VGAEKKFGDNFSMYAGYEMTDVVSGTDTADMAAGIKFTF* |
| Ga0129324_103114092 | 3300010368 | Freshwater To Marine Saline Gradient | TYGADKKIGENFSMYAGYEVTDKPTGTDTTSMAAGIKFTF* |
| Ga0181391_10210933 | 3300017713 | Seawater | EIEDGNKYTTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFTF |
| Ga0181390_10068236 | 3300017719 | Seawater | YGEIEDGNKYTTVGAEKKIGENFSLYGAFQQTDVPTGVDTQDAAAGIKFTF |
| Ga0181373_10907051 | 3300017721 | Marine | GYGEIEDGNKYTTVGAEKKIGDNFSLYGAFQQTDVPTGVDTQDAAAGIKFTF |
| Ga0181426_10085331 | 3300017733 | Seawater | TVSVGYGEIEDGNKYTTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFTF |
| Ga0187218_10090051 | 3300017737 | Seawater | TVSVGYGEIEDGNKYTTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFKF |
| Ga0181433_10731692 | 3300017739 | Seawater | GYGEIEDGNKYTTVGAEKKIGENFSLYGAFQQTDVPAGVDTQDAAAGIKFTF |
| Ga0181397_10844512 | 3300017744 | Seawater | SVGYGEIEDGNKYTTVGAEKKIGESFSLYGAFQQTDVPTGVDTQDAAAGIKFTF |
| Ga0181389_10860552 | 3300017746 | Seawater | GYGEIEDGNKYTTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFKF |
| Ga0181393_10035637 | 3300017748 | Seawater | VGYGEIEDGNKYTTVGAEKKIGESFSLYGAFQQTDVPTGVDTQDAAAGIKFTF |
| Ga0181392_10663232 | 3300017749 | Seawater | EGGNKYTTVGAEKKIGENFSLYGAFQQTDVPTGVDTQDAAAGIKFTF |
| Ga0181400_11284701 | 3300017752 | Seawater | TFSVGYGEIEDGNKYSTVGAAKKIGDNFSVYGAFQTTDVVTGTDTQDMAAGIKFKF |
| Ga0181422_10361913 | 3300017762 | Seawater | VGAEKKFGDNFSMYAGYEMTDVTSGTDTADMAAGIKFTF |
| Ga0181406_10324473 | 3300017767 | Seawater | ATTISIGYGEIEDGNKYTTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFTF |
| Ga0187220_12021302 | 3300017768 | Seawater | DGNKYTTVGAEKKIGESFSLYGAFQQTDVPTGVDTQDAAAGIKFTF |
| Ga0181395_10047781 | 3300017779 | Seawater | AEKKIGENFSLYGAFQQTDVPTGVDTQDAAAGIKFTF |
| Ga0181584_100114918 | 3300017949 | Salt Marsh | EDGAAYTTVGAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0181584_100473711 | 3300017949 | Salt Marsh | VGAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0181607_103650981 | 3300017950 | Salt Marsh | KYTTVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0181607_105038891 | 3300017950 | Salt Marsh | VGASKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFKF |
| Ga0181583_100392961 | 3300017952 | Salt Marsh | KKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0181580_100117689 | 3300017956 | Salt Marsh | DYVNSNTTVGAEKKVADNFSVDGAFEMTDPASGVDTQDAAAGIKFTF |
| Ga0181582_106712961 | 3300017958 | Salt Marsh | VEDGAAYTTVGAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0181582_108862841 | 3300017958 | Salt Marsh | KYWTYGADKKIGENFSMYAGYEVTDKPTGTDTTSMAAGIKFTF |
| Ga0181581_104950012 | 3300017962 | Salt Marsh | KIKSGTAYTTVGAEKKIGENFSMYAGYEMTDVVSGTDTADMAAGIKFTF |
| Ga0181587_100550611 | 3300017968 | Salt Marsh | EKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0181587_101728031 | 3300017968 | Salt Marsh | IGYGKVEDGAAYTTVGAEKKIGENFSMYGAVEMTDPASGVDTQDAAVGIKFTF |
| Ga0181585_100502531 | 3300017969 | Salt Marsh | TTVGAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0181585_103653701 | 3300017969 | Salt Marsh | GYGKVEDGAAYTTVGAEKKIGDNFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0181579_102551851 | 3300018039 | Salt Marsh | YSVGYGEIKDGNAYTTVGAEKKIGENFSVYGAFEMTDVTSGVDTQDAAAGIKFTF |
| Ga0181558_101164691 | 3300018417 | Salt Marsh | TTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFTF |
| Ga0181558_105260852 | 3300018417 | Salt Marsh | GADKKIGENFSMYAGYEMTDKPTGTDTTSMAAGIKFTF |
| Ga0181567_102954411 | 3300018418 | Salt Marsh | DKKIGENFSMYAGYEVTDKPTGTDTTNMAAGIKFTF |
| Ga0181567_106432331 | 3300018418 | Salt Marsh | TTVGAEKKICENFSVYGAFEMTDVTSGVDTQDAAAGIKFTF |
| Ga0181592_102468762 | 3300018421 | Salt Marsh | TTVGAEKKFGENFSMYCAYQITDVPTGTDTNDMAAGIKFTF |
| Ga0181593_109618821 | 3300018423 | Salt Marsh | EKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0181566_106502583 | 3300018426 | Salt Marsh | YWTYGADKKIGENFSMYAGYEVTDKPTGIDTTNMAAGIKFTF |
| Ga0181568_101570291 | 3300018428 | Salt Marsh | KYTTFGAEKKIGENFSAYAGYEMTDKPTGTDTTNMAAGIKFTF |
| Ga0181564_100236687 | 3300018876 | Salt Marsh | DGNKYTTVGAEKKFGDNFSMYAGYEMTDVTSGTDTADMAAGIKFTF |
| Ga0213862_103644632 | 3300021347 | Seawater | FFVGYGEIVDGNKYWTYGADKKIGENFSMYAGYEVTDKPTGTDTTNMAAGIKFTF |
| Ga0213859_102231851 | 3300021364 | Seawater | YSIGYGKVEDGASYTTVGAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0222717_100330771 | 3300021957 | Estuarine Water | GYGEIEDGNKYTTVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0222718_100713881 | 3300021958 | Estuarine Water | GNKYTTFGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0222718_101649523 | 3300021958 | Estuarine Water | NKYTTVGAEKKFSENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0222718_102671162 | 3300021958 | Estuarine Water | FGAEKKIGENFSVYGAIEMTDPASGVDTQDAAAGIKFTF |
| Ga0222716_101923623 | 3300021959 | Estuarine Water | KVEDGAAYTTVGAEKKIGDNFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0222715_100427861 | 3300021960 | Estuarine Water | FGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0222715_101378811 | 3300021960 | Estuarine Water | NKYTTVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0222715_101738211 | 3300021960 | Estuarine Water | TTVGAEKKIGDNFSMYGAFEMTDPASGVDTQDAAAGIKFTF |
| Ga0222715_102814191 | 3300021960 | Estuarine Water | AEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0222719_105580171 | 3300021964 | Estuarine Water | TTVGAEKKFGENFSMYGAFQQTDVVSGVDTQDMAAGIKFTF |
| Ga0255756_12447911 | 3300022905 | Salt Marsh | KVKSGTAYTTVGAEKKFGDNFSMYAGYQMTDVVSGTDTNDMAAGIKFKF |
| Ga0255767_12908221 | 3300022914 | Salt Marsh | GNAYTTVGAEKKIGENFSVYGAFEMTDVTSGVDTQDAAAGIKFTF |
| Ga0255753_11354723 | 3300022926 | Salt Marsh | TTVGAEKKIGDNFSMYAGYEMTDVVSGTDTADMAAGIKFTF |
| Ga0255769_100326994 | 3300022927 | Salt Marsh | GEIEDGNKYTTFGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0255758_100802361 | 3300022928 | Salt Marsh | KDGNKYTTVGAEKKFGDNFSMYAGYEMTDVTSGTDTADMAAGIKFTF |
| (restricted) Ga0233433_102890281 | 3300022931 | Seawater | NKYTTVGAEKKIGESFSLYGAFQQTDVPTGVDTQDAAAGIKFTF |
| (restricted) Ga0233427_101566171 | 3300022933 | Seawater | EIEDGNKYSTVGAEKKIGDNFSMYGAFQTTDVVTGTDTNDMAAGIKFKF |
| Ga0255781_102461432 | 3300022934 | Salt Marsh | TLSVGYGEIVDGNKYWTYGADKKIGENFSMYAGYEVTDKPTGTDTTNMAAGIKFTF |
| Ga0255766_100054791 | 3300023172 | Salt Marsh | YTTVGAEKKIGENFSVYGAFEMTDVTSGVDTQDAAAGIKFTF |
| Ga0255766_103782481 | 3300023172 | Salt Marsh | KKLGDNFSMYAGYEMTDVVSGTDTADMAAGIKFTF |
| Ga0255766_104055862 | 3300023172 | Salt Marsh | DGNAYTTVGAEKKIGDNFSVYGAFEMTDPASGVDTQDAAAGIKFTF |
| Ga0255772_100052091 | 3300023176 | Salt Marsh | TYSIGYGKVEDGAAYTTVGAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0209535_10661211 | 3300025120 | Marine | VSVGYGEIEDGNKYTTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFKF |
| Ga0209041_10532583 | 3300025623 | Marine | ISVGYGEIEDGNKYTTVGAEKKIGESFSLYGAFQQTDVPTGVDTQDAAAGIKFTF |
| Ga0209716_10225291 | 3300025626 | Pelagic Marine | GAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFKF |
| Ga0208004_11264541 | 3300025630 | Aqueous | DTTYSVGYGKVEDGAAYTTVGAEKKIGDNFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0209194_11603081 | 3300025632 | Pelagic Marine | EDGNKYTTVGAEKKFGENFSMYGAFQQTDVVSGVDTQDAAAGIKFTF |
| Ga0209833_10483491 | 3300025641 | Pelagic Marine | EDGNKYTTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFTF |
| Ga0209833_11326372 | 3300025641 | Pelagic Marine | SVGYGEIEDGNKYTTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFTF |
| Ga0208428_10298993 | 3300025653 | Aqueous | KSGTAYTTVGAEKKFGDNFSMYAGYQMTDVVSGTDTNDMAAGIKFKF |
| Ga0208162_10167521 | 3300025674 | Aqueous | DTTYSVGYGKVEDGAAYTTVGAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0208019_11387812 | 3300025687 | Aqueous | TYSVGYGKIEDGAAYTTVGAEKKIGENFSVYGAFEMTDPASGVDTQDAAAGIKFTF |
| Ga0209406_10362321 | 3300025694 | Pelagic Marine | VGYGEIEDGNKYTTVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0209532_12231301 | 3300025696 | Pelagic Marine | DGNKYTTVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0209715_11537662 | 3300025699 | Pelagic Marine | EIEDGNKYTTVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAVGIKFTF |
| Ga0209667_11396061 | 3300025707 | Marine | VGAEKKIGESFSLYGAFQQTDVPTGVDTQDAAAGIKFTF |
| Ga0209305_12469111 | 3300025712 | Pelagic Marine | EKKFGENFSMYGAYQMTDVPTGTDTNDMAVGIKFTF |
| Ga0209660_12789462 | 3300025722 | Marine | YTTVGAEKKIGESFSLYGAFQQTDVPTGVDTQDAAAGIKFTF |
| Ga0208899_11160572 | 3300025759 | Aqueous | AEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0208767_10834382 | 3300025769 | Aqueous | TVGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0208767_12317781 | 3300025769 | Aqueous | AYTTVGAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0208543_10031006 | 3300025810 | Aqueous | KYTTFGAEKKFGDNFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0208785_10896572 | 3300025815 | Aqueous | DGAAYTTVGAEKKIGENFSVYGAFEMTDPASGVDTQDAAAGIKFTF |
| Ga0208547_12108131 | 3300025828 | Aqueous | NKYWTYGADKKIGENFSMYAGYEVTDKPTGTDTTSMAAGIKFTF |
| Ga0209308_100831604 | 3300025869 | Pelagic Marine | VGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0209555_100963231 | 3300025879 | Marine | GKVKSGTAYTTVGAEKTIGDNFSMYAGYEMTDVVSGTDTNGMAAGIKYKF |
| Ga0209534_102995172 | 3300025880 | Pelagic Marine | TVGAEKKFGENFSMYGAFQQTDVVSGVDTQDAAAGIKFTF |
| Ga0208644_12596032 | 3300025889 | Aqueous | GAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0209953_10319352 | 3300026097 | Pond Water | TVGAEKKIGENFSMYGAFEMTDPASGVDTQDAAVGIKFTF |
| Ga0209929_10433141 | 3300026187 | Pond Water | KKFGENFSMYGAFQQTDVVSGVDTQDMAAGIKFTF |
| Ga0209384_11294952 | 3300027522 | Marine | EDGNKYSTVGAEKKIGENFSMYGAFQTTDVVTGTDTQDMAAGIKFRF |
| Ga0209536_1030004471 | 3300027917 | Marine Sediment | YGEIEDGNKYTTFGAEKKFGENFSMYGAYQMTDVPTGTDTNDMAAGIKFTF |
| Ga0228615_10831062 | 3300028418 | Seawater | TVGASKKIGDNFSLYGAFQTTDVVTGTDTNDMAAGIKFKF |
| Ga0315320_105264641 | 3300031851 | Seawater | YGEIVDGNKYTTVGAEKKFGDNFSMYAGYEMTDVTSGTDTADMAAGIKFTF |
| Ga0316202_103508861 | 3300032277 | Microbial Mat | NKYTTVGAEKKFGDNFSMYGAFQQTDVVSGVDTQDMAAGIKFTF |
| ⦗Top⦘ |