| Basic Information | |
|---|---|
| Family ID | F045655 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ELHKSGSHEFLNWMVLLGAVTPARADVRYFGELPRINLAAVEWRL |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.66 % |
| % of genes near scaffold ends (potentially truncated) | 98.68 % |
| % of genes from short scaffolds (< 2000 bps) | 95.39 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.763 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.763 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.526 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.789 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 24.66% β-sheet: 23.29% Coil/Unstructured: 52.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF07746 | LigA | 76.32 |
| PF01557 | FAA_hydrolase | 5.26 |
| PF13378 | MR_MLE_C | 1.97 |
| PF01979 | Amidohydro_1 | 1.32 |
| PF04519 | Bactofilin | 1.32 |
| PF02518 | HATPase_c | 1.32 |
| PF07883 | Cupin_2 | 1.32 |
| PF00561 | Abhydrolase_1 | 0.66 |
| PF08530 | PepX_C | 0.66 |
| PF07690 | MFS_1 | 0.66 |
| PF02738 | MoCoBD_1 | 0.66 |
| PF05036 | SPOR | 0.66 |
| PF01547 | SBP_bac_1 | 0.66 |
| PF14535 | AMP-binding_C_2 | 0.66 |
| PF03243 | MerB | 0.66 |
| PF00180 | Iso_dh | 0.66 |
| PF11249 | DUF3047 | 0.66 |
| PF09335 | SNARE_assoc | 0.66 |
| PF13594 | Obsolete Pfam Family | 0.66 |
| PF02900 | LigB | 0.66 |
| PF04879 | Molybdop_Fe4S4 | 0.66 |
| PF00196 | GerE | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 1.32 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.66 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.66 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.76 % |
| Unclassified | root | N/A | 7.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_11082872 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300002557|JGI25381J37097_1059415 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 615 | Open in IMG/M |
| 3300004062|Ga0055500_10014708 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300004267|Ga0066396_10068880 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300004268|Ga0066398_10176631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 551 | Open in IMG/M |
| 3300004629|Ga0008092_11023404 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300005093|Ga0062594_101837685 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005093|Ga0062594_103015056 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 526 | Open in IMG/M |
| 3300005166|Ga0066674_10072189 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300005171|Ga0066677_10715511 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005178|Ga0066688_10279567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1073 | Open in IMG/M |
| 3300005295|Ga0065707_10701303 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 639 | Open in IMG/M |
| 3300005332|Ga0066388_100094464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3429 | Open in IMG/M |
| 3300005332|Ga0066388_102517343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 936 | Open in IMG/M |
| 3300005332|Ga0066388_105281846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300005341|Ga0070691_10148806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1199 | Open in IMG/M |
| 3300005440|Ga0070705_101037000 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005441|Ga0070700_101455208 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005444|Ga0070694_100471236 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300005444|Ga0070694_101926895 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 505 | Open in IMG/M |
| 3300005445|Ga0070708_100340479 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300005468|Ga0070707_100753019 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005471|Ga0070698_101602175 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005543|Ga0070672_101535635 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005545|Ga0070695_101370683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300005552|Ga0066701_10836911 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 547 | Open in IMG/M |
| 3300005563|Ga0068855_102175239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
| 3300005586|Ga0066691_10355421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 867 | Open in IMG/M |
| 3300005586|Ga0066691_10756580 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 574 | Open in IMG/M |
| 3300005713|Ga0066905_100971466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300005713|Ga0066905_101694568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 581 | Open in IMG/M |
| 3300005713|Ga0066905_101714084 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 578 | Open in IMG/M |
| 3300005844|Ga0068862_101177580 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 764 | Open in IMG/M |
| 3300006046|Ga0066652_100034669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3657 | Open in IMG/M |
| 3300006049|Ga0075417_10208644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 927 | Open in IMG/M |
| 3300006791|Ga0066653_10331792 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 768 | Open in IMG/M |
| 3300006796|Ga0066665_11526152 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 522 | Open in IMG/M |
| 3300006845|Ga0075421_100772678 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300006845|Ga0075421_100851492 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300006845|Ga0075421_102422277 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 549 | Open in IMG/M |
| 3300006853|Ga0075420_100770030 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300006876|Ga0079217_11113261 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 591 | Open in IMG/M |
| 3300006903|Ga0075426_10262646 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300006914|Ga0075436_100034483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3490 | Open in IMG/M |
| 3300007076|Ga0075435_100673844 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300007265|Ga0099794_10033545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2414 | Open in IMG/M |
| 3300009078|Ga0105106_11085052 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 568 | Open in IMG/M |
| 3300009088|Ga0099830_11401463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300009089|Ga0099828_11518061 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 590 | Open in IMG/M |
| 3300009089|Ga0099828_11825272 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 534 | Open in IMG/M |
| 3300009098|Ga0105245_10801254 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 980 | Open in IMG/M |
| 3300009177|Ga0105248_11570161 | Not Available | 745 | Open in IMG/M |
| 3300009553|Ga0105249_10711144 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1065 | Open in IMG/M |
| 3300009553|Ga0105249_12042969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 646 | Open in IMG/M |
| 3300009792|Ga0126374_11530257 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
| 3300009810|Ga0105088_1096181 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 544 | Open in IMG/M |
| 3300010047|Ga0126382_11327956 | Not Available | 652 | Open in IMG/M |
| 3300010047|Ga0126382_11732223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 585 | Open in IMG/M |
| 3300010303|Ga0134082_10082355 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300010304|Ga0134088_10361616 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 705 | Open in IMG/M |
| 3300010321|Ga0134067_10290693 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 627 | Open in IMG/M |
| 3300010325|Ga0134064_10094146 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300010333|Ga0134080_10702304 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300010359|Ga0126376_10595041 | Not Available | 1045 | Open in IMG/M |
| 3300010359|Ga0126376_11277609 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 753 | Open in IMG/M |
| 3300010359|Ga0126376_11483105 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 706 | Open in IMG/M |
| 3300010359|Ga0126376_12157555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 601 | Open in IMG/M |
| 3300010360|Ga0126372_10577844 | Not Available | 1073 | Open in IMG/M |
| 3300010360|Ga0126372_13030221 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
| 3300010362|Ga0126377_11314902 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 795 | Open in IMG/M |
| 3300010362|Ga0126377_11955356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 662 | Open in IMG/M |
| 3300010371|Ga0134125_11385561 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 766 | Open in IMG/M |
| 3300010376|Ga0126381_101669823 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 920 | Open in IMG/M |
| 3300010397|Ga0134124_11302465 | Not Available | 750 | Open in IMG/M |
| 3300010401|Ga0134121_10214125 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300010403|Ga0134123_13213923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 526 | Open in IMG/M |
| 3300011119|Ga0105246_10864468 | Not Available | 808 | Open in IMG/M |
| 3300011270|Ga0137391_10890995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 729 | Open in IMG/M |
| 3300011271|Ga0137393_10857736 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 775 | Open in IMG/M |
| 3300011434|Ga0137464_1228713 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
| 3300012202|Ga0137363_10694632 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 861 | Open in IMG/M |
| 3300012203|Ga0137399_11652543 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 529 | Open in IMG/M |
| 3300012205|Ga0137362_11190714 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 646 | Open in IMG/M |
| 3300012351|Ga0137386_10237695 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1309 | Open in IMG/M |
| 3300012357|Ga0137384_10194681 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1696 | Open in IMG/M |
| 3300012362|Ga0137361_10385898 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1286 | Open in IMG/M |
| 3300012685|Ga0137397_11212111 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
| 3300012918|Ga0137396_10134436 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1792 | Open in IMG/M |
| 3300012918|Ga0137396_11092386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 571 | Open in IMG/M |
| 3300012922|Ga0137394_10245462 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1531 | Open in IMG/M |
| 3300012922|Ga0137394_10403246 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1166 | Open in IMG/M |
| 3300012925|Ga0137419_10367677 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1117 | Open in IMG/M |
| 3300012929|Ga0137404_10538545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1045 | Open in IMG/M |
| 3300012930|Ga0137407_11250209 | Not Available | 705 | Open in IMG/M |
| 3300012930|Ga0137407_12113070 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 538 | Open in IMG/M |
| 3300012944|Ga0137410_10902445 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300014310|Ga0075331_1090484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. WS9 | 708 | Open in IMG/M |
| 3300014326|Ga0157380_10980089 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 877 | Open in IMG/M |
| 3300014885|Ga0180063_1197045 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 648 | Open in IMG/M |
| 3300015251|Ga0180070_1054429 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 552 | Open in IMG/M |
| 3300015254|Ga0180089_1014077 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1416 | Open in IMG/M |
| 3300015262|Ga0182007_10155805 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 779 | Open in IMG/M |
| 3300015264|Ga0137403_10017397 | All Organisms → cellular organisms → Bacteria | 7757 | Open in IMG/M |
| 3300015371|Ga0132258_12654453 | Not Available | 1250 | Open in IMG/M |
| 3300015372|Ga0132256_102335104 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 638 | Open in IMG/M |
| 3300017656|Ga0134112_10039567 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1684 | Open in IMG/M |
| 3300017657|Ga0134074_1341478 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 551 | Open in IMG/M |
| 3300018031|Ga0184634_10430057 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 598 | Open in IMG/M |
| 3300018078|Ga0184612_10490005 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 603 | Open in IMG/M |
| 3300018482|Ga0066669_12035964 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 539 | Open in IMG/M |
| 3300019233|Ga0184645_1084713 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300019279|Ga0184642_1605549 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300019487|Ga0187893_10218330 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1442 | Open in IMG/M |
| 3300019879|Ga0193723_1005526 | All Organisms → cellular organisms → Bacteria | 4278 | Open in IMG/M |
| 3300020004|Ga0193755_1054986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1297 | Open in IMG/M |
| 3300020006|Ga0193735_1164028 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 563 | Open in IMG/M |
| 3300020062|Ga0193724_1072972 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 716 | Open in IMG/M |
| 3300021344|Ga0193719_10205559 | Not Available | 840 | Open in IMG/M |
| 3300022534|Ga0224452_1071916 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1043 | Open in IMG/M |
| 3300025910|Ga0207684_11524506 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
| 3300025940|Ga0207691_11408702 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 572 | Open in IMG/M |
| 3300025949|Ga0207667_11779075 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300025961|Ga0207712_11146580 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 693 | Open in IMG/M |
| 3300026295|Ga0209234_1138994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300026297|Ga0209237_1223689 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 585 | Open in IMG/M |
| 3300026325|Ga0209152_10037036 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1684 | Open in IMG/M |
| 3300026332|Ga0209803_1250424 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 612 | Open in IMG/M |
| 3300026550|Ga0209474_10557129 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 583 | Open in IMG/M |
| 3300027332|Ga0209861_1054254 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 591 | Open in IMG/M |
| 3300027654|Ga0209799_1043267 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300027671|Ga0209588_1097553 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 946 | Open in IMG/M |
| 3300027846|Ga0209180_10295522 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 929 | Open in IMG/M |
| 3300027875|Ga0209283_10171126 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1442 | Open in IMG/M |
| 3300027882|Ga0209590_10820373 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 590 | Open in IMG/M |
| 3300028381|Ga0268264_11346792 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 724 | Open in IMG/M |
| 3300028792|Ga0307504_10147157 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300028828|Ga0307312_10511283 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300030336|Ga0247826_10992875 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
| 3300031198|Ga0307500_10309883 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 504 | Open in IMG/M |
| 3300031720|Ga0307469_10110290 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1960 | Open in IMG/M |
| 3300031720|Ga0307469_12379780 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 3300031781|Ga0318547_10075676 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1875 | Open in IMG/M |
| 3300031879|Ga0306919_10345352 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1136 | Open in IMG/M |
| 3300032075|Ga0310890_10397268 | Not Available | 1022 | Open in IMG/M |
| 3300032180|Ga0307471_104119923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 513 | Open in IMG/M |
| 3300032180|Ga0307471_104166154 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 511 | Open in IMG/M |
| 3300032205|Ga0307472_100673932 | Not Available | 925 | Open in IMG/M |
| 3300032205|Ga0307472_102120935 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 565 | Open in IMG/M |
| 3300032770|Ga0335085_11703340 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300033513|Ga0316628_102885776 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300033550|Ga0247829_10138745 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300034178|Ga0364934_0005040 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 4589 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.26% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.95% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.63% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.97% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.32% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.66% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.66% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.66% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.66% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015251 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_110828721 | 3300000363 | Soil | LHKTGEHEFLNWMVLIGAVSPARAQVRYFGELRRINLAAVEWSLP* |
| JGI25381J37097_10594153 | 3300002557 | Grasslands Soil | ELHKTGSHEFLNWMVLIGAVTPARADVRYFGELPRINLAAVEWRMR* |
| Ga0055500_100147083 | 3300004062 | Natural And Restored Wetlands | GVDELHKTGEHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLS* |
| Ga0066396_100688803 | 3300004267 | Tropical Forest Soil | TGEHEFLNWMVLLGAISPARAQVRYFGELRRINLAAVEWSLA* |
| Ga0066398_101766312 | 3300004268 | Tropical Forest Soil | LDLTADELHKTGSHEFLNWMVLLGALTPARAEVRYFGELPRINLAAVEWKIG* |
| Ga0008092_110234041 | 3300004629 | Tropical Rainforest Soil | TADELHKTGSHEFLNWMVLLGALTPARAEVRYFGELPRINLAAVEWKLG* |
| Ga0062594_1018376853 | 3300005093 | Soil | ELHKTGEHEFLNWMVLIGAVSPARAQVRYFGELRRINLAAVEWSLP* |
| Ga0062594_1030150562 | 3300005093 | Soil | ELTADELHKSGSHEFLNWMVLLGAVTPARADVRFFGELPRINMAAVEWRL* |
| Ga0066674_100721894 | 3300005166 | Soil | EHEFLNWMVLIGAVTPARADVRYFGELGRINLAAVEWRVG* |
| Ga0066677_107155111 | 3300005171 | Soil | HEFLNWMVLLGAVTPARADVRYFGELRRINMAAVEWSLP* |
| Ga0066688_102795673 | 3300005178 | Soil | DKAGEHEFLNWMTLIGAVTPARADVRYFGELGRINLAAVEWRVA* |
| Ga0065707_107013032 | 3300005295 | Switchgrass Rhizosphere | LLDLTADELHKTGSHEFLNWMVLLGAITPARAEVRYFGELPRINLAAVEWRL* |
| Ga0066388_1000944646 | 3300005332 | Tropical Forest Soil | DELHKTGSHEFLNWMVLLGAVSPARAEVRYFGELPRINLAAVEWRLP* |
| Ga0066388_1025173431 | 3300005332 | Tropical Forest Soil | DELHKTGSHEFLNWMVLLGAVSPAPAQVRYFGELPRINMAAVEWSLA* |
| Ga0066388_1052818463 | 3300005332 | Tropical Forest Soil | EHEFLNWMVVLGAISPAPGDLRYFGELGRINLAAFEWRLA* |
| Ga0070691_101488063 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | ELHKTGEHEFLNWMVLLGAVAPARAQVRYFGELRRINLAAVEWSLP* |
| Ga0070705_1010370001 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | EHEFLNWMVLIGAVTPARADVRYFGELRRINMAAVEWRLA* |
| Ga0070700_1014552083 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | TGSHEFLNWMVLLGAVTPAPAEVRYFGELPRINLAAVEWSLS* |
| Ga0070694_1004712363 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LHKTGEHEFLNWMVLLGAVTPARAQVRYFGELRRINLAAVEWSLP* |
| Ga0070694_1019268953 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | TADELHKAGEHELLNWIVVAGAVAPARAELRYFGELPRINLTAVEWRLP* |
| Ga0070708_1003404791 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | HKTGEHEFLNWMVLIGAITPARAQMRYFGELRRINLAAAEWSLA* |
| Ga0070707_1007530193 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TVGELHKTGEHEFLNWMVLIGAITPARAQVRYFGELRRINLAAVEWSLP* |
| Ga0070698_1016021753 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TADELHKTGSHEFLNWMVLLGAITPARADVRYFGELPRINLAAVEWRL* |
| Ga0070672_1015356351 | 3300005543 | Miscanthus Rhizosphere | DELHKTGEHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLS* |
| Ga0070695_1013706831 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ELDKSGEHEFLNWMVLLGAVSPARADVRYFGELPRINMAAVEWRLA* |
| Ga0066701_108369113 | 3300005552 | Soil | DELHKTGSHEFLNWMVLIGAVTPARADVRYFGELLRINLAAVEWRVR* |
| Ga0068855_1021752391 | 3300005563 | Corn Rhizosphere | KTGEHEFLNWMVLLGAVAPARAQVRYFGELRRINLAAVEWSLP* |
| Ga0066691_103554211 | 3300005586 | Soil | LSADELHKSGGHEFLNWMVLMGAVTPARAAVRYFGELRRINLAAVEWRLA* |
| Ga0066691_107565803 | 3300005586 | Soil | SGGHEFLNWMVLLGAVTPARADVRYFGELPRINLAAVEWRLG* |
| Ga0066905_1009714663 | 3300005713 | Tropical Forest Soil | GEHEFLNWMVLIGAVSPARADVRYFGELGRIDLAAVEWRVG* |
| Ga0066905_1016945683 | 3300005713 | Tropical Forest Soil | DELHKTGSHEFLNWMVLLGAVTPARAQVRYFGELPRINMAAVEWTLS* |
| Ga0066905_1017140841 | 3300005713 | Tropical Forest Soil | ELHKTGEHEFLNWMVVLGAITPARGDLRYFAELGRINLAAFEWSLA* |
| Ga0068862_1011775803 | 3300005844 | Switchgrass Rhizosphere | DELHKSGSHEFLNWMVLLGAITPARADVRYFGELRRINLAAVEWRLS* |
| Ga0066652_1000346696 | 3300006046 | Soil | TGSHELLNWMVLLGAVAPARARVRFFGEMGRIDLAALEWLLADPQGGHE* |
| Ga0075417_102086441 | 3300006049 | Populus Rhizosphere | DELHKSGSHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLG* |
| Ga0066653_103317924 | 3300006791 | Soil | GELHKAGEHEFLNWMVLIGAVTPARADVRYFGELGRINLAAVEWRVG* |
| Ga0066665_115261523 | 3300006796 | Soil | DELHKTGSHEFLNWMVLLGAITPARAAVRYFGELPRINLAAVEWRL* |
| Ga0075421_1007726783 | 3300006845 | Populus Rhizosphere | LHKTGSHEFLNWMVLLGAVTPAPADVRYFGELPRINLAAVEWRL* |
| Ga0075421_1008514925 | 3300006845 | Populus Rhizosphere | LTADELHKTGSHEFLNWMVLLGAVTPAPADVRYFGELPRINLAAVEWRL* |
| Ga0075421_1024222771 | 3300006845 | Populus Rhizosphere | QALTMDELHKTGEHEFLNWMVLLGAVTPAPAEVRYFCELGRINLAAVEWRVA* |
| Ga0075420_1007700303 | 3300006853 | Populus Rhizosphere | FLNWMVLLGAITPARADVRYFGELPRINLAAVEWRL* |
| Ga0079217_111132613 | 3300006876 | Agricultural Soil | GEHEFLNWMVLLGAVTPARADVRYFGELPRINMAAVEWRL* |
| Ga0075426_102626461 | 3300006903 | Populus Rhizosphere | ELHKTGEHEFLNWMVLIGAITPARAQVRYFGELRRINLAAVEWSLA* |
| Ga0075436_1000344831 | 3300006914 | Populus Rhizosphere | NWMVLMGAVTPARADVRYFGELPRINMAAVEWRLA* |
| Ga0075435_1006738443 | 3300007076 | Populus Rhizosphere | HEFLNWMVLLGAITPARAVVRYFGELPRINLAAVEWTLA* |
| Ga0099794_100335451 | 3300007265 | Vadose Zone Soil | DELHKSGGHEFLNWMVLLGAVTPARADVRYFGELRRINLAAVEWRLA* |
| Ga0105106_110850521 | 3300009078 | Freshwater Sediment | LHKTGEHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLS* |
| Ga0099830_114014633 | 3300009088 | Vadose Zone Soil | LDLTADELHKTGSHEFLNWMVLLGAITPSRADVRYFGELPRINLAAVEWRL* |
| Ga0099828_115180613 | 3300009089 | Vadose Zone Soil | SDELHKTGSHEFLNWMVLLGAITPARADVRYFGELPRINLAAVEWRL* |
| Ga0099828_118252723 | 3300009089 | Vadose Zone Soil | WMVLIGAVSPARADVRYFGELRRINMAAVEWRLA* |
| Ga0105245_108012541 | 3300009098 | Miscanthus Rhizosphere | MDELHKAGEHEFLNWMVLLGAVSPARAAVRYFGELPRINLAAVEWSLA* |
| Ga0105248_115701613 | 3300009177 | Switchgrass Rhizosphere | LTADELHKSGSHEFLNWMVLLGAVTPARAEVRYFGELPRINMAAVEWSLS* |
| Ga0105249_107111441 | 3300009553 | Switchgrass Rhizosphere | LNWMVLIGAVSPARAQVRYFGELRRINLAAVEWSLP* |
| Ga0105249_120429691 | 3300009553 | Switchgrass Rhizosphere | QALTADELHKAGEHEFLNWMVLLGAVSPARAAVRYFGELPRINLAAVEWSLA* |
| Ga0126374_115302573 | 3300009792 | Tropical Forest Soil | FLNWMVLLGALTPARAEVRYFGELPRINLAAVEWKLG* |
| Ga0105088_10961812 | 3300009810 | Groundwater Sand | MQDLHESGSHEFLNWMVLLGAVTPARADVRYFGELPRINLAAVEWRAP* |
| Ga0126382_113279563 | 3300010047 | Tropical Forest Soil | FLNWMVLIGAVTPARAEVRYFGELRRINLAAVEWRLG* |
| Ga0126382_117322233 | 3300010047 | Tropical Forest Soil | GDELHKTGSHEFLNWMVLIGAVTPARADVRYFGELRRLNLAAIEWRVR* |
| Ga0134082_100823551 | 3300010303 | Grasslands Soil | DELHKSGEHEFLNWMVLIGAITPARADVRYFGELGRINLAAVEWRVE* |
| Ga0134088_103616163 | 3300010304 | Grasslands Soil | EFLNWMVLLGAVSPARAEVRYFGELPRINLAAVEWNLA* |
| Ga0134067_102906931 | 3300010321 | Grasslands Soil | WMVLLGAVTPARADVRYFGELPRINMAAVEWRVA* |
| Ga0134064_100941461 | 3300010325 | Grasslands Soil | HEFLNWMVLIGAVTPARADVRYFGELPRINLAAVEWRMR* |
| Ga0134080_107023042 | 3300010333 | Grasslands Soil | GEHEFLNWMVLIGAVTPARADVRYFGELGRINLAAVEWRVG* |
| Ga0126376_105950411 | 3300010359 | Tropical Forest Soil | QTLTSAELHKTGEHEFLNWMVVLGAVTPAPGDLRYFGELGRINLAAFEWRVA* |
| Ga0126376_112776091 | 3300010359 | Tropical Forest Soil | TGSHEFLNWMVLLGAITPARAEVRYFGELPRINLAAVEWKLG* |
| Ga0126376_114831051 | 3300010359 | Tropical Forest Soil | LTADELHKTGSHEFLNWMVLLGALTPARAEVRYFGELPRINLAAVEWKIG* |
| Ga0126376_121575551 | 3300010359 | Tropical Forest Soil | HEFLNWMVLIGAVTPARADVRYFGELRRINMAAVEWRLP* |
| Ga0126372_105778444 | 3300010360 | Tropical Forest Soil | LTTAELHKTGEHEFLNWLVLIGAVTPARADVRYFGELGRINMAAVEWRLA* |
| Ga0126372_130302211 | 3300010360 | Tropical Forest Soil | GDELDKSGEHEFLNWMVLLGAISPARAQVRYFGELRRINLAAVEWSLA* |
| Ga0126377_113149021 | 3300010362 | Tropical Forest Soil | LHEAGGHELLNWMVVAGATAPARAREVYFGELGRINLAAVEWERP* |
| Ga0126377_119553563 | 3300010362 | Tropical Forest Soil | ADELHKTGSHEFLNWMVLLGALTPARADVRYFGELPRINLAAVEWQLG* |
| Ga0134125_113855611 | 3300010371 | Terrestrial Soil | EHEFLNWMVLIGAITPARAQVRYFGELRRINLAAVEWSLP* |
| Ga0126381_1016698234 | 3300010376 | Tropical Forest Soil | EHEFLNWMVLIGAVTPARADVRYFGELPRINMAAVEWRLG* |
| Ga0134124_113024653 | 3300010397 | Terrestrial Soil | DLTADELHKTGSHEFLNWMVLLGAITPARAEVRYFGELPRINLAAVEWRL* |
| Ga0134121_102141254 | 3300010401 | Terrestrial Soil | WMVLLGAVSPARAAVRYFGELPRINLAAVEWSLA* |
| Ga0134123_132139233 | 3300010403 | Terrestrial Soil | LNWIVVAGAVTPARAELRYLGELARINLTAVEWRLA* |
| Ga0105246_108644683 | 3300011119 | Miscanthus Rhizosphere | WMVLLGAVTPARAQVRYFGELPRINLAAVEWTLA* |
| Ga0137391_108909951 | 3300011270 | Vadose Zone Soil | DELHKTGSHEFLNWMVLLGAITPARADVRHFGELPRINLAAVEWSLR* |
| Ga0137393_108577361 | 3300011271 | Vadose Zone Soil | GEHEFLNWMVLLGAVTPARADVRYFGELPRINLAAVEWRLG* |
| Ga0137464_12287131 | 3300011434 | Soil | ELHKAGEHEFLNWMVLLGAVSPARAAVRYFGELPRINLAAVEWSLA* |
| Ga0137363_106946321 | 3300012202 | Vadose Zone Soil | GEHEFLNWMVLIGAITPARAQVRYFGELRRINLAAVEWSLR* |
| Ga0137399_116525431 | 3300012203 | Vadose Zone Soil | DELHKSGGHEFLNWMVLLGAVTPARADVRYFGELPRINLAAVEWRLG* |
| Ga0137362_111907143 | 3300012205 | Vadose Zone Soil | WMVLLGAVTPARADVRYFGELRRINMAAVEWSLP* |
| Ga0137386_102376953 | 3300012351 | Vadose Zone Soil | NWMVLIGAVTPARADVRYFGELPRINLAAVEWRMR* |
| Ga0137384_101946811 | 3300012357 | Vadose Zone Soil | HKTGSHEFLNWMVLIGAVTPARADVRYFGELPRINLAAVEWRMR* |
| Ga0137361_103858984 | 3300012362 | Vadose Zone Soil | DLTSDELHKTGSHEFLNWMVLLGAITPARADVRYFGELPRINLAAVEWRL* |
| Ga0137397_112121113 | 3300012685 | Vadose Zone Soil | FLNWMVLLGAVTPARADVRYFGELPRINLAAVEWRLG* |
| Ga0137396_101344361 | 3300012918 | Vadose Zone Soil | TGSHEFLNWMVLLGAITPARADVRYFGELPRINLAAVEWRL* |
| Ga0137396_110923863 | 3300012918 | Vadose Zone Soil | HKTGSHEFLNWMVLIGAVTPARADVRYFGELRRINLAAVEWRVR* |
| Ga0137394_102454621 | 3300012922 | Vadose Zone Soil | HEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLS* |
| Ga0137394_104032463 | 3300012922 | Vadose Zone Soil | FLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLP* |
| Ga0137419_103676771 | 3300012925 | Vadose Zone Soil | WMVLLGAVTPARADVRYFGELPRINLAAVEWSLR* |
| Ga0137404_105385451 | 3300012929 | Vadose Zone Soil | RNLGLDELHKTGEHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLS* |
| Ga0137407_112502092 | 3300012930 | Vadose Zone Soil | NWMVLIGAITPARADVRYFGELGRINLAAVEWRVA* |
| Ga0137407_121130703 | 3300012930 | Vadose Zone Soil | DKSGEHEFLNWMVLLGAVSPARADVRYFGELPRINMAAVEWRLA* |
| Ga0137410_109024451 | 3300012944 | Vadose Zone Soil | ADELHKAGEHELLNWIVVAGAVTPAPAELRYFGELARINLTAVEWKLA* |
| Ga0075331_10904841 | 3300014310 | Natural And Restored Wetlands | ELHKTGSHEFLNWMVLLGAVTPARADVRYFGELPRINLAAVEWGLG* |
| Ga0157380_109800893 | 3300014326 | Switchgrass Rhizosphere | GSHEFLNWMVLLGAVTPARADVRFFGELPRINMAAVEWRL* |
| Ga0180063_11970453 | 3300014885 | Soil | LNWMVAAGATAPARAREIYFGELGRINLAAVEWDVR* |
| Ga0180070_10544293 | 3300015251 | Soil | ELHKSGGHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLS* |
| Ga0180089_10140771 | 3300015254 | Soil | KTGEHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLP* |
| Ga0182007_101558051 | 3300015262 | Rhizosphere | HEFLNWMVLIGAVSPARAQVRYFGELRRINLAAVEWSLP* |
| Ga0137403_1001739711 | 3300015264 | Vadose Zone Soil | LTADELHKAGEHEFLNWMVLLGAVSPARAVVRYFGELPRINLAAVEWSLA* |
| Ga0132258_126544533 | 3300015371 | Arabidopsis Rhizosphere | WMVLLGAVSPARADVRYFGELPRINMAAVEWRLP* |
| Ga0132256_1023351041 | 3300015372 | Arabidopsis Rhizosphere | TSGELHKTGSHEFLNWMVLLGAITPARADVRYFGELPRINLAAVEWRL* |
| Ga0134112_100395673 | 3300017656 | Grasslands Soil | ATGSHELLNWMVLLGAVAPARARVRFFGEMGRIDLAALEWLLADPQGGHE |
| Ga0134074_13414781 | 3300017657 | Grasslands Soil | TGSHEFLNWMVLLGAITPARADVRYFGELPRINLAAVEWRLR |
| Ga0184634_104300571 | 3300018031 | Groundwater Sediment | ELHKSGSHEFLNWMVLLGAVTPARADVRYFGELPRINLAAVEWRL |
| Ga0184612_104900053 | 3300018078 | Groundwater Sediment | DELHKSGSHEFLNWMVLLGAVTPARADVRYFGELPRINLAAVEWRL |
| Ga0066669_120359641 | 3300018482 | Grasslands Soil | FLNWMVLLGAVTPARADVRYFGELPRINMAAVEWRVA |
| Ga0184645_10847133 | 3300019233 | Groundwater Sediment | HKSGSHEFLNWMVLLGAVTPARADVRYFGELPRINLAAVEWRL |
| Ga0184642_16055493 | 3300019279 | Groundwater Sediment | QELTADELHKSGSHEFLNWMVLLGAVTPARADVRYFGELPRINLAAVEWRL |
| Ga0187893_102183301 | 3300019487 | Microbial Mat On Rocks | ELHKAGEHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLS |
| Ga0193723_10055266 | 3300019879 | Soil | KTGEHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLS |
| Ga0193755_10549861 | 3300020004 | Soil | LGVDELHKTGEHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLS |
| Ga0193735_11640283 | 3300020006 | Soil | NWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLS |
| Ga0193724_10729723 | 3300020062 | Soil | NWMVLIGAITPARAQVRYFGELRRINLAAVEWSLP |
| Ga0193719_102055593 | 3300021344 | Soil | GSHEFLNWMVLLGAITPARAEVRYFGELPRINMAAVEWSLS |
| Ga0224452_10719163 | 3300022534 | Groundwater Sediment | KTGEHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLP |
| Ga0207684_115245063 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | KTGSHEFLNWMVLLGAITPARADVRYFGELPRINLAAVEWRL |
| Ga0207691_114087021 | 3300025940 | Miscanthus Rhizosphere | DELHKTGEHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLS |
| Ga0207667_117790753 | 3300025949 | Corn Rhizosphere | KTGEHEFLNWMVLLGAVAPARAQVRYFGELRRINLAAVEWSLP |
| Ga0207712_111465801 | 3300025961 | Switchgrass Rhizosphere | TADELHKAGEHEFLNWMVLLGAVSPARAAVRYFGELPRINLAAVEWSLA |
| Ga0209234_11389941 | 3300026295 | Grasslands Soil | EHEFLNWMALIGAVTPARADVRYFGELGRINLAAVEWRIG |
| Ga0209237_12236892 | 3300026297 | Grasslands Soil | LSGDELHKSGGHEFLNWMVLLGAVSPARADVRYFGELRRINLAAVEWRLA |
| Ga0209152_100370362 | 3300026325 | Soil | LQELGADELHKTGSHEFLNWMVLIGAVTPARADVRYFGELPRINLAAVEWRMR |
| Ga0209803_12504243 | 3300026332 | Soil | TVGELHKSGEHEFLNWMVLIGAVTPARADVRYFGELPRINLAAVEWRL |
| Ga0209474_105571291 | 3300026550 | Soil | ALGPDELHKTGSHEFLNWMVLLGAVSPARAEVRYFGELPRINLAAVEWRLR |
| Ga0209861_10542543 | 3300027332 | Groundwater Sand | KTGEHEFLNWMVLLGAVTPARADVRYFGELPRINLAAVEWRAP |
| Ga0209799_10432673 | 3300027654 | Tropical Forest Soil | HKTGSHEFLNWMVLIGAVTPARADVCYFGELRRINLAAIEWRVR |
| Ga0209588_10975531 | 3300027671 | Vadose Zone Soil | SGGHEFLNWMVLLGAVTPARADVRYFGELRRINLAAVEWRLA |
| Ga0209180_102955223 | 3300027846 | Vadose Zone Soil | SDELHKTGSHEFLNWMVLLGAITPARADVRYFGELPRINLAAVEWRLQ |
| Ga0209283_101711261 | 3300027875 | Vadose Zone Soil | EHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLP |
| Ga0209590_108203731 | 3300027882 | Vadose Zone Soil | VAELHKAGEHEFLNWMVLIGAVTPARADVRYFGALPRINMAAVEWRLA |
| Ga0268264_113467921 | 3300028381 | Switchgrass Rhizosphere | EFLNWMVLLGAITPARADVRYFGELRRINLAAVEWRV |
| Ga0307504_101471573 | 3300028792 | Soil | LNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLS |
| Ga0307312_105112831 | 3300028828 | Soil | GSHEFLNWMVLLGAVTPARADVRYFGELPRINLAAVEWRL |
| Ga0247826_109928753 | 3300030336 | Soil | ELHKTGEHEFLNWMVLIGAVSPARAQVRYFGELRRINLAAVEWSLP |
| Ga0307500_103098831 | 3300031198 | Soil | LTADELHKTGSHEFLNWMVLLGAITPARADIRYFGELPRINLAAVEWRL |
| Ga0307469_101102901 | 3300031720 | Hardwood Forest Soil | TGEHEFLNWMVLIGAISPARAHVRYFGELRRINLAAVEWSLA |
| Ga0307469_123797803 | 3300031720 | Hardwood Forest Soil | LHKTGSHEFLNWMVLLGAITPSRADVRYFGELPRINLAAVEWRL |
| Ga0318547_100756763 | 3300031781 | Soil | NWMVLLGALTPARAEVRYFGELPRINLAAVEWKLG |
| Ga0306919_103453521 | 3300031879 | Soil | LTADELHKTGSHEFLNWMVLLGALTPARAEVRYFGELPRINLAAVEWKLG |
| Ga0310890_103972683 | 3300032075 | Soil | LTADELHKTGSHEFLNWMVLLGAVTPARAQVRYFGELPRINMAAVEWTLS |
| Ga0307471_1041199231 | 3300032180 | Hardwood Forest Soil | ELHKTGSHEFLNWMVLLGAITPARADVRYFGELPRINLAAVEWRL |
| Ga0307471_1041661542 | 3300032180 | Hardwood Forest Soil | ELHKAGEHEFLNWMVLLGAVSPARAAVRYFGELPRINLAAVEWSLA |
| Ga0307472_1006739321 | 3300032205 | Hardwood Forest Soil | DELHKTGSHEFLNWMVLLGAITPARAEVRYFGELPRINLAAVEWRL |
| Ga0307472_1021209353 | 3300032205 | Hardwood Forest Soil | GEHEFLNWMVLIGAITPARAQVRYFGELRRINLAAVEWSLR |
| Ga0335085_117033403 | 3300032770 | Soil | GHEFLNWMVLIGAVTPAAADVRYFGELPRINMAAVEWRLP |
| Ga0316628_1028857761 | 3300033513 | Soil | GVDELHKTGEHEFLNWMVLLGAVTPARAQVRYFGELPRINLAAVEWSLP |
| Ga0247829_101387451 | 3300033550 | Soil | ELHKTGSHEFLNWMVLLGAITPARAEVRYFGELPRINLAAVEWRL |
| Ga0364934_0005040_4448_4588 | 3300034178 | Sediment | ELDKAGEHEFLNWMTLIGAVTPAPADVRYFGELGRINLAAVEWRLP |
| ⦗Top⦘ |