Basic Information | |
---|---|
Family ID | F045634 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 152 |
Average Sequence Length | 41 residues |
Representative Sequence | HADRIVHLFDGLIVEEEAGANRREIEDAKRELKESGFGEIA |
Number of Associated Samples | 122 |
Number of Associated Scaffolds | 152 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.03 % |
% of genes from short scaffolds (< 2000 bps) | 93.42 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.526 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.842 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.368 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (63.158 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 20.29% Coil/Unstructured: 59.42% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 152 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 86.84 |
PF12704 | MacB_PCD | 6.58 |
PF00072 | Response_reg | 2.63 |
PF07228 | SpoIIE | 1.97 |
PF00118 | Cpn60_TCP1 | 0.66 |
PF09992 | NAGPA | 0.66 |
PF03928 | HbpS-like | 0.66 |
COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
---|---|---|---|
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.18 % |
Unclassified | root | N/A | 13.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664022|INPgaii200_c1205969 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
3300000574|JGI1357J11328_10113362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
3300000890|JGI11643J12802_10468592 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300000953|JGI11615J12901_10624104 | Not Available | 813 | Open in IMG/M |
3300004157|Ga0062590_101192501 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300005093|Ga0062594_100757453 | Not Available | 889 | Open in IMG/M |
3300005093|Ga0062594_102315801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 584 | Open in IMG/M |
3300005290|Ga0065712_10286982 | Not Available | 884 | Open in IMG/M |
3300005331|Ga0070670_100184170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1813 | Open in IMG/M |
3300005334|Ga0068869_100444282 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300005339|Ga0070660_100764068 | Not Available | 812 | Open in IMG/M |
3300005343|Ga0070687_100416530 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300005345|Ga0070692_11020052 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300005354|Ga0070675_100659606 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300005406|Ga0070703_10567383 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005437|Ga0070710_11273230 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300005444|Ga0070694_100984100 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300005444|Ga0070694_101642437 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300005459|Ga0068867_100827274 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 828 | Open in IMG/M |
3300005467|Ga0070706_101821589 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005468|Ga0070707_100992710 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300005547|Ga0070693_100869017 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300005549|Ga0070704_100005036 | All Organisms → cellular organisms → Bacteria | 7682 | Open in IMG/M |
3300005552|Ga0066701_10162557 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
3300005564|Ga0070664_101746344 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300005598|Ga0066706_11248740 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300005842|Ga0068858_100602977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1065 | Open in IMG/M |
3300005844|Ga0068862_101701672 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300005874|Ga0075288_1032597 | Not Available | 771 | Open in IMG/M |
3300006049|Ga0075417_10397474 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300006797|Ga0066659_10502917 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300006797|Ga0066659_11382552 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300006806|Ga0079220_10636737 | Not Available | 767 | Open in IMG/M |
3300006845|Ga0075421_102562940 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300006852|Ga0075433_10674862 | Not Available | 906 | Open in IMG/M |
3300006854|Ga0075425_102973126 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300006871|Ga0075434_101029233 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 837 | Open in IMG/M |
3300006881|Ga0068865_100128299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1897 | Open in IMG/M |
3300006881|Ga0068865_101829902 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300007076|Ga0075435_100253637 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
3300009094|Ga0111539_10453925 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
3300009094|Ga0111539_13303358 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300009101|Ga0105247_10907380 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300009137|Ga0066709_103920825 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300009148|Ga0105243_11032803 | Not Available | 826 | Open in IMG/M |
3300009148|Ga0105243_11120591 | Not Available | 796 | Open in IMG/M |
3300009156|Ga0111538_13019073 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300009162|Ga0075423_11120556 | Not Available | 838 | Open in IMG/M |
3300009162|Ga0075423_13176537 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300009553|Ga0105249_10035944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4493 | Open in IMG/M |
3300009553|Ga0105249_10834482 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 987 | Open in IMG/M |
3300009553|Ga0105249_12851520 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300010043|Ga0126380_11228182 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300010045|Ga0126311_10051546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2647 | Open in IMG/M |
3300010146|Ga0126320_1407251 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300010335|Ga0134063_10014237 | All Organisms → cellular organisms → Bacteria | 3182 | Open in IMG/M |
3300010362|Ga0126377_12438810 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300010397|Ga0134124_10279968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1546 | Open in IMG/M |
3300010397|Ga0134124_12818495 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300010398|Ga0126383_13437479 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300010399|Ga0134127_12571677 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300010400|Ga0134122_10332382 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
3300010401|Ga0134121_10034684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4100 | Open in IMG/M |
3300010401|Ga0134121_10837291 | Not Available | 887 | Open in IMG/M |
3300010403|Ga0134123_10541313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
3300010403|Ga0134123_10909721 | Not Available | 887 | Open in IMG/M |
3300010403|Ga0134123_11062555 | Not Available | 830 | Open in IMG/M |
3300011119|Ga0105246_11308873 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300011119|Ga0105246_11834708 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300011119|Ga0105246_12135685 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300012200|Ga0137382_10592677 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300012201|Ga0137365_11033956 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300012202|Ga0137363_10007836 | All Organisms → cellular organisms → Bacteria | 6698 | Open in IMG/M |
3300012202|Ga0137363_10137941 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
3300012203|Ga0137399_10959966 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300012207|Ga0137381_10861923 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300012353|Ga0137367_10792689 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300012354|Ga0137366_10126463 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1929 | Open in IMG/M |
3300012355|Ga0137369_10666010 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300012360|Ga0137375_11102837 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300012469|Ga0150984_119721379 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300012681|Ga0136613_10794471 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300012918|Ga0137396_11146284 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300012922|Ga0137394_10442167 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300012923|Ga0137359_10000359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 34610 | Open in IMG/M |
3300012923|Ga0137359_10331743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1353 | Open in IMG/M |
3300012925|Ga0137419_11369874 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300012929|Ga0137404_10254988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1507 | Open in IMG/M |
3300012944|Ga0137410_10005646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 8512 | Open in IMG/M |
3300012948|Ga0126375_11583684 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300012955|Ga0164298_11037017 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300012955|Ga0164298_11708241 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300012957|Ga0164303_10234089 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1041 | Open in IMG/M |
3300013297|Ga0157378_10453739 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
3300013297|Ga0157378_11253705 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 782 | Open in IMG/M |
3300013297|Ga0157378_11850403 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300013297|Ga0157378_12953755 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300013308|Ga0157375_11888799 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300014326|Ga0157380_11370339 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300014326|Ga0157380_11690252 | Not Available | 690 | Open in IMG/M |
3300015262|Ga0182007_10257361 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300015373|Ga0132257_100320851 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
3300015373|Ga0132257_101376863 | Not Available | 897 | Open in IMG/M |
3300016422|Ga0182039_12122500 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300017792|Ga0163161_10206381 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
3300018061|Ga0184619_10137141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1113 | Open in IMG/M |
3300018084|Ga0184629_10327797 | Not Available | 806 | Open in IMG/M |
3300018422|Ga0190265_12758504 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300018422|Ga0190265_13507288 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300018422|Ga0190265_13571298 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300018468|Ga0066662_11398695 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300018469|Ga0190270_12718703 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300019377|Ga0190264_12100161 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300020003|Ga0193739_1038768 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300020059|Ga0193745_1077637 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300021412|Ga0193736_1024360 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 809 | Open in IMG/M |
3300025911|Ga0207654_11390450 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300025913|Ga0207695_11556288 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300025914|Ga0207671_10088105 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
3300025918|Ga0207662_10644358 | Not Available | 740 | Open in IMG/M |
3300025918|Ga0207662_11183674 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300025919|Ga0207657_10478220 | Not Available | 976 | Open in IMG/M |
3300025926|Ga0207659_10482291 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1048 | Open in IMG/M |
3300025933|Ga0207706_11224026 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 623 | Open in IMG/M |
3300025937|Ga0207669_10976335 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300025944|Ga0207661_11458463 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300025945|Ga0207679_10443918 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300025945|Ga0207679_11896089 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300025945|Ga0207679_12142561 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300025961|Ga0207712_12098934 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300025993|Ga0208415_1013311 | Not Available | 780 | Open in IMG/M |
3300026088|Ga0207641_10312900 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
3300026089|Ga0207648_10686315 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300026305|Ga0209688_1041197 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300026555|Ga0179593_1212261 | All Organisms → cellular organisms → Bacteria | 2643 | Open in IMG/M |
3300027748|Ga0209689_1163452 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300027909|Ga0209382_11893664 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300028380|Ga0268265_12655490 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300028381|Ga0268264_10711323 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 998 | Open in IMG/M |
3300028381|Ga0268264_11510405 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300028578|Ga0272482_10326461 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300031538|Ga0310888_10859367 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300031562|Ga0310886_10549365 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300031716|Ga0310813_10653665 | Not Available | 935 | Open in IMG/M |
3300031716|Ga0310813_10977811 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300031901|Ga0307406_10464908 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300031908|Ga0310900_10510771 | Not Available | 936 | Open in IMG/M |
3300032017|Ga0310899_10129313 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1056 | Open in IMG/M |
3300032075|Ga0310890_11754054 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300032211|Ga0310896_10642729 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300033412|Ga0310810_11207609 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300034165|Ga0364942_0274127 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.21% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.89% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.29% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.29% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.29% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.97% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.97% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.32% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.32% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.32% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.32% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.66% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.66% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.66% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.66% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.66% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.66% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.66% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.66% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.66% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.66% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_12059691 | 2228664022 | Soil | YAQHADRIVHLFDGLIVEEETGANRREIEEAKQELRESGFTEVQ |
JGI1357J11328_101133621 | 3300000574 | Groundwater | VHLFDGLIIEEEAGANRREIEEAKRELKESGFGEIA* |
JGI11643J12802_104685922 | 3300000890 | Soil | VHLFDGLIVEEEAGADRREIQEARRELAESGFGAIS* |
JGI11615J12901_106241042 | 3300000953 | Soil | QHADRIVHLFDGLIVEEEAGSDRREIQEAKRELAESGFGAIQ* |
Ga0062590_1011925011 | 3300004157 | Soil | DRIVHLFDGLIVEEEAGANRREVEDAKREGKENGFGAIG* |
Ga0062594_1007574532 | 3300005093 | Soil | QHADRIVHLFDGLIVEEEAGADRREIREAKRELAESGFGAIS* |
Ga0062594_1023158011 | 3300005093 | Soil | DPRYAHQADRIVHLFDGLIVEEEAGANRREIEEAKQDLRESGFTEVQ* |
Ga0065712_102869822 | 3300005290 | Miscanthus Rhizosphere | QHADRIVHLFDGLIVEEEAGADRREIQDAKRELAESGFGAIQ* |
Ga0070670_1001841701 | 3300005331 | Switchgrass Rhizosphere | RYAQHADRIVHLFDGLIVEEEAGANRREVEEARRAIGEDVRGAIG* |
Ga0068869_1004442823 | 3300005334 | Miscanthus Rhizosphere | DRIVHLFDGLIVEEEAGADRREIQDAKRELAESGFGAIQ* |
Ga0070660_1007640682 | 3300005339 | Corn Rhizosphere | AQHADRIVHLFDGLIVEEEAGADRREIQEAKRELAESGFGAIS* |
Ga0070687_1004165301 | 3300005343 | Switchgrass Rhizosphere | RYAQHADRIVHLFDGLIVEEEAGADRREIQEAKRELAESGFGAIS* |
Ga0070692_110200521 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | RYAQHADRIVHLFDGLIVEEETGSASRKAEIEAAKKELKESGFTEVQ* |
Ga0070675_1006596061 | 3300005354 | Miscanthus Rhizosphere | ARYAQHADRIVHLFDGVIVEEEAGANRREVADGKRDGQENGLGAIG* |
Ga0070703_105673832 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | QHADRIVHLFDGLIVEEEAGADRREIQEAKRELAESGFGAIQ* |
Ga0070710_112732302 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | QHADRIVHLFDGLIVEEEAGANRRQIEEAKHELRESGFTEVQ* |
Ga0070694_1009841002 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | YAQHADRIVHLFDGLIVEEEAGSERREIHEQQLKEAGFGAIS* |
Ga0070694_1016424371 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AQHADRIVHLFDGLIVEEETGANRRQIEEAKQELRESGFVEVQ* |
Ga0068867_1008272742 | 3300005459 | Miscanthus Rhizosphere | DRIVHLFDGLIVEEEAGANRREVEDAKREAKENGFGAIG* |
Ga0070706_1018215892 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AQHADRIVHLFDGLIVEEEAGAHRREIEEAKRELKESGFGDIA* |
Ga0070707_1009927101 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ADRIVHLFDGLIVEEETGANRRQIEEAKQELRESGFVEVK* |
Ga0070693_1008690172 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | AQHADRIVHLFDGLIVEEEAGADRREIREAKRELAESGFGAIQ* |
Ga0070704_1000050361 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PRYAQHADRIVHLFDGLIVEEETGSASRKAEIEAAKKELKESGFTEVQ* |
Ga0066701_101625573 | 3300005552 | Soil | ADRIVHLFDGLIVEEEAGAHRREIEEAKRELKESGFGDIA* |
Ga0070664_1017463442 | 3300005564 | Corn Rhizosphere | LFDGLIVEEEAGSERREIQEAKRELAESGFGVIQ* |
Ga0066706_112487402 | 3300005598 | Soil | IVHLFDGLIVEEEAGANRREVEDARREAKENGFGAKG* |
Ga0068858_1006029773 | 3300005842 | Switchgrass Rhizosphere | HADRIVHLFDGLIVEEETGSASRKAEIEAAKKELKESGFTEVQ* |
Ga0068862_1017016722 | 3300005844 | Switchgrass Rhizosphere | ADRIVHLFDGLIVEEEAGADRREIREAKRELAESGFGAIS* |
Ga0075288_10325971 | 3300005874 | Rice Paddy Soil | ADRIVHLFDGLIVEEEAGANRREIEEAKQELRESGFTEVQ* |
Ga0075417_103974742 | 3300006049 | Populus Rhizosphere | VHLFDGLIVEEETGSASRAAEIEQAKRELKESGFKEVV* |
Ga0066659_105029173 | 3300006797 | Soil | HLFDGLIVEEEAGANRREIEEAKRELRESGFTEVQ* |
Ga0066659_113825522 | 3300006797 | Soil | RIVHLFDGLIVEEEPGSHRREIEEAKRELKESGFGEIP* |
Ga0079220_106367371 | 3300006806 | Agricultural Soil | HLFDGLIVEEEAGADRREIREAKRELAESGFGAIS* |
Ga0075421_1025629402 | 3300006845 | Populus Rhizosphere | HADRIVHLFDGLIVEEEAGANRREIEEAKQELRESGFTEVQ* |
Ga0075433_106748622 | 3300006852 | Populus Rhizosphere | DRIVHLFDGQIVEEEQGAERREIMERELKESGFGAIS* |
Ga0075425_1029731261 | 3300006854 | Populus Rhizosphere | QHADRIVHLFDGLIVKEETGANRRQIEEAKQELRESGFTEVQ* |
Ga0075434_1010292331 | 3300006871 | Populus Rhizosphere | LFDGLIVEEETGANRREIEEAKKELRESGFTEVQ* |
Ga0068865_1001282991 | 3300006881 | Miscanthus Rhizosphere | HADRIVHLFDGLIVEEEAGADRREIREAKRELAESGFGAIS* |
Ga0068865_1018299022 | 3300006881 | Miscanthus Rhizosphere | HLFDGLIVEEEAGANRREIEDAKKELRESGFTEVQ* |
Ga0075435_1002536373 | 3300007076 | Populus Rhizosphere | LFDGLIVEEETGSASRAAEIEQAKRELKESGFKEVV* |
Ga0111539_104539253 | 3300009094 | Populus Rhizosphere | YAQQADRIVHLFEGLIVEEEAGSERREIHEQQLKEAGFGAIS* |
Ga0111539_133033582 | 3300009094 | Populus Rhizosphere | YAQHADRIVHLFDGLIVEEEAGADRREIQEAKRELAESGFGAIS* |
Ga0105247_109073802 | 3300009101 | Switchgrass Rhizosphere | YAQHADRIVHLFDGLIVEEEAGADRREIIEAKRELAQSGFGEIA* |
Ga0066709_1039208251 | 3300009137 | Grasslands Soil | YAQHADRIVHLFDGLIVEEETGSASRRAEIEAAKRELKESGFGDIQ* |
Ga0105243_110328032 | 3300009148 | Miscanthus Rhizosphere | RYAQHADRIVHLFDGLIVEEEAGANRREVEDAKREKKENGLGAIG* |
Ga0105243_111205912 | 3300009148 | Miscanthus Rhizosphere | DARYAQHADRIVHLFDGVIVEEEAGANRREVADDKRDGKENSLGAIG* |
Ga0111538_130190732 | 3300009156 | Populus Rhizosphere | FDGLIVEEETGSASRKAEIEAAKRELKESGFTEVQ* |
Ga0075423_111205561 | 3300009162 | Populus Rhizosphere | VHLFDGLIVEEEAGAARREIQEAKRELAESGFGAIQ* |
Ga0075423_131765371 | 3300009162 | Populus Rhizosphere | VHLFDGLIVEEEAGSERREIHEQQLKEAGFGAIS* |
Ga0105249_100359444 | 3300009553 | Switchgrass Rhizosphere | RYAQHADRIVHLFDGLIVEEEAGANRREVEDARRDAKENGRGAIG* |
Ga0105249_108344823 | 3300009553 | Switchgrass Rhizosphere | LFDGLIVEEEAGADRREIQDAKRELAESGFGAIQ* |
Ga0105249_128515201 | 3300009553 | Switchgrass Rhizosphere | IVHLFDGLIVEEEAGANRREVEDAKREKKENGFGAIG* |
Ga0126380_112281821 | 3300010043 | Tropical Forest Soil | HLFDGLIVEEETGANRREIEEAKQELRESGFTEVQ* |
Ga0126311_100515464 | 3300010045 | Serpentine Soil | QHADRIVHLFDGLIVEEEAGSERREIREARRELAESGFGAIQ* |
Ga0126320_14072512 | 3300010146 | Soil | ADRIVHLFDGLIVEEEAGSERREIREAKRELAESGFGAIS* |
Ga0134063_100142371 | 3300010335 | Grasslands Soil | IVHLFDGLIVEEEAGANRREIEEAKRELKESGFGEIP* |
Ga0126377_124388101 | 3300010362 | Tropical Forest Soil | DRIVHLFDGLIVEEEAGSDRREIQEAKRELAESGFGAIS* |
Ga0134124_102799683 | 3300010397 | Terrestrial Soil | YAQHADRIVHLFDGLIVEEEAGANRRQIEEAKQELRESGFTEVQ* |
Ga0134124_128184952 | 3300010397 | Terrestrial Soil | LFDGLIVEEEAGADRREIREAKRELAESGFGAIS* |
Ga0126383_134374792 | 3300010398 | Tropical Forest Soil | AQHADRIVHLFDGLIVEEETGSASRRAEIEEAKRELKESGFGDIQ* |
Ga0134127_125716772 | 3300010399 | Terrestrial Soil | RYAQHADRIVHLFDSLIVEEEAGSERREIHEQQLKEAGFGAIG* |
Ga0134122_103323821 | 3300010400 | Terrestrial Soil | IVHLFDGLIVEEETGSASRKAEIEAAKKELKESGFTEVQ* |
Ga0134121_100346841 | 3300010401 | Terrestrial Soil | HADRIVHLFDGLIVEEEAGANRREIEDAKKELRESGFTEVQ* |
Ga0134121_108372912 | 3300010401 | Terrestrial Soil | HLFDGLIVEEEAGANRREVEDARRDARESGLGAIG* |
Ga0134123_105413133 | 3300010403 | Terrestrial Soil | ARYAQHADRIVHLFDGLIVEEEAGANRREVEDARRDAKENGRGAIG* |
Ga0134123_109097211 | 3300010403 | Terrestrial Soil | IVHLFDGVIVEEEAGANRREVADAKGDGKENGLGAIG* |
Ga0134123_110625551 | 3300010403 | Terrestrial Soil | LFDGLIVEEEAGADRREIQEAKRELAESGFGAIQ* |
Ga0105246_113088731 | 3300011119 | Miscanthus Rhizosphere | PRYAQHADRIVHLFDGLIVEEEAGADRREIQDAKRELAESGFGAIQ* |
Ga0105246_118347081 | 3300011119 | Miscanthus Rhizosphere | DARYAQHADRIVHLFDGLIVEEEAGANRREVEDAKREGKENGFGAIG* |
Ga0105246_121356851 | 3300011119 | Miscanthus Rhizosphere | AQHADRIVHLFDGVIVEEEAGANRREVADAKGDGKENGLGAIG* |
Ga0137382_105926771 | 3300012200 | Vadose Zone Soil | IVHLFDGLIVEEEAGANRREIEEAKKELRESGFTEVQ* |
Ga0137365_110339561 | 3300012201 | Vadose Zone Soil | HLFDGLIVEEEAGSNRREILEAKRELKESGFGEIA* |
Ga0137363_100078361 | 3300012202 | Vadose Zone Soil | RIVHMFDGLIVEEETGANRREIEDAKRELKESGFGDIA* |
Ga0137363_101379411 | 3300012202 | Vadose Zone Soil | IVHMFDGLIVEEEAGANRREIEDAKRELKESGFGDIA* |
Ga0137399_109599661 | 3300012203 | Vadose Zone Soil | QHADRIVHLFDGLIVEEEAGANRREIEDAKRELKESGFGDIA* |
Ga0137381_108619232 | 3300012207 | Vadose Zone Soil | QHADRIVHLFDGLIVEEETGSASRRAEIEAAKRELKESGFGDIQ* |
Ga0137367_107926891 | 3300012353 | Vadose Zone Soil | HLFDGLIVEEEAGANRREIEDAKRELRESGFGAIA* |
Ga0137366_101264631 | 3300012354 | Vadose Zone Soil | QHADRIVQLFDELIVEEETGAQRLAGERELKESGFGEVSLSA* |
Ga0137369_106660101 | 3300012355 | Vadose Zone Soil | LFDGLIVEEEAGSHRREIEDAKRELKESGFGEIP* |
Ga0137375_111028372 | 3300012360 | Vadose Zone Soil | AQHADRIVHLFDGLIVEEEAGSHRREIEDAKRELKESGFGEIP* |
Ga0150984_1197213792 | 3300012469 | Avena Fatua Rhizosphere | AQHADRIVHLFDGLIVEEETGANRRQIEEAKQELRESGFVEVK* |
Ga0136613_107944712 | 3300012681 | Polar Desert Sand | ADRIVHLFDGLIVEEEPGANRREIEDAKRELKESGFGAIA* |
Ga0137396_111462842 | 3300012918 | Vadose Zone Soil | ADRIGRLVDGLIWEGEAGANRRECEDAKRELKESGFGDIA* |
Ga0137394_104421673 | 3300012922 | Vadose Zone Soil | VHLFDGLIVEEEAGTNRRAVVDAKRADKDDGFGAIG* |
Ga0137359_100003591 | 3300012923 | Vadose Zone Soil | IVHLFDGLIVEEEAGANRREIEEAKRELKESGFGEIA* |
Ga0137359_103317433 | 3300012923 | Vadose Zone Soil | DRIVHLFDGLIVEEEAGANRREIEDAKRELKESGFGDIA* |
Ga0137419_113698742 | 3300012925 | Vadose Zone Soil | HADRIVHLFDGLIVEEEAGANRREIEDAKRELKESGFGEIA* |
Ga0137404_102549883 | 3300012929 | Vadose Zone Soil | YAQHADRIVHLFDGLIVEEEAGANRREIEEAKKELRESGFTEVQ* |
Ga0137410_100056469 | 3300012944 | Vadose Zone Soil | DRIVHLFDGLIVEEEAGTNRRAVVDAKRGGKDDGFGAIG* |
Ga0126375_115836842 | 3300012948 | Tropical Forest Soil | AQHADRIVHLFDGLIVEEEAGADRREIIEAKRELKESGFGAIG* |
Ga0164298_110370172 | 3300012955 | Soil | VHLFDGLIVEEEAGANRREIEDAKKELRESGFTEVQ* |
Ga0164298_117082412 | 3300012955 | Soil | RIVHLFDGLIVEEEAGADRREIREAKRELAESGFGAIQ* |
Ga0164303_102340891 | 3300012957 | Soil | RIVHLFDGLIVEEEAGADRREIIEAKRELAQSGFGEIA* |
Ga0157378_104537391 | 3300013297 | Miscanthus Rhizosphere | QHADRIVHLFDGLIVEEEAGANRREVEDAKRASNGDGRGAAG* |
Ga0157378_112537051 | 3300013297 | Miscanthus Rhizosphere | IVHLFDGLIVEEEAGANRREIEEAKQDLRESGFTEVQ* |
Ga0157378_118504032 | 3300013297 | Miscanthus Rhizosphere | YAQHADRIVHLFDGVIVEEEAGANRREVEDAKREAKENGFGAIG* |
Ga0157378_129537552 | 3300013297 | Miscanthus Rhizosphere | RIVHLFDGLIVEEEAGSERREIQEAKRELAESGFGVIQ* |
Ga0157375_118887991 | 3300013308 | Miscanthus Rhizosphere | LRYAQHADRIVHLFDGLIVEEEAGADRREIREAKRELAGRGFGAIS* |
Ga0157380_113703391 | 3300014326 | Switchgrass Rhizosphere | ADRIVHLFDGLIVEEEAGSQRREIHEQQLKEAGFGAIS* |
Ga0157380_116902521 | 3300014326 | Switchgrass Rhizosphere | LFDGLIVEEEAGSERREIREAKRELAESGFGAIQ* |
Ga0182007_102573611 | 3300015262 | Rhizosphere | DRIVHLFDGLIVEEEAGSERREIQEAKKELAESGFGVIQ* |
Ga0132257_1003208513 | 3300015373 | Arabidopsis Rhizosphere | YAQHADRIVHLFDGLIVEEEVGSERREIHEQQLKEAGFGAIS* |
Ga0132257_1013768632 | 3300015373 | Arabidopsis Rhizosphere | HADRIVHLFDGLIVEEEAGSERREIREAKRELAESGFGAIQ* |
Ga0182039_121225002 | 3300016422 | Soil | VHLFDGLIVEEESGANRREIEEAKQELRESGFTEVQ |
Ga0163161_102063811 | 3300017792 | Switchgrass Rhizosphere | DRIVHLFDGLIVEEEAGSERREIREAKRELAESGFGAIQ |
Ga0184619_101371411 | 3300018061 | Groundwater Sediment | DRIVHLFDGLIVEEEAGSNRREILEAKRELKESGFGEIA |
Ga0184629_103277972 | 3300018084 | Groundwater Sediment | YAQHADRIVHLFDGLIVEEEAGANRREVEDAKRDAKENGFGAIR |
Ga0190265_127585041 | 3300018422 | Soil | VHLFDGLIVEEEAGSERREIREAKRELAESGFGAIS |
Ga0190265_135072881 | 3300018422 | Soil | HDARYAQHADRIVHLFDGLIVEEEAGANRREVEDARRANENGLGAIG |
Ga0190265_135712982 | 3300018422 | Soil | RIVHLFDGLIVEEEAGANRREIEDAKRELKESGFGAIA |
Ga0066662_113986952 | 3300018468 | Grasslands Soil | HLFDGLIVEEEAGANRREIEEAKRELRESGFTEVQ |
Ga0190270_127187032 | 3300018469 | Soil | DARYAQHADRIVHLFDGVIVEEEAGANRRELEEAKREPKENGFGAIG |
Ga0190264_121001611 | 3300019377 | Soil | ADRIVHLFDGLIVEEEAGANRREIEDAKRELKESGFGDV |
Ga0193739_10387681 | 3300020003 | Soil | YAQHADRIVHLFDGLIVEEETGSASRKAEMEAAKRELKESGFTEVQ |
Ga0193745_10776372 | 3300020059 | Soil | QHADRIVHLFDGLIVEEEAGANRREIEEAKKELRESGFTEVQ |
Ga0193736_10243602 | 3300021412 | Soil | HLFDGLIVEEEAGANRREIEEARRAIGEDGLGAAG |
Ga0207654_113904502 | 3300025911 | Corn Rhizosphere | DRIVHLFDGLIVEEEAGADRREIQEAKRELAESGFGAIQ |
Ga0207695_115562882 | 3300025913 | Corn Rhizosphere | RYAQHADRIVHLFDGLIVEEEAGSERREIHEQQLKEAGFGAIS |
Ga0207671_100881054 | 3300025914 | Corn Rhizosphere | YAQHADRIVHLFDGLIVEEEAGADRREIQEAKRELAESGFGAIS |
Ga0207662_106443582 | 3300025918 | Switchgrass Rhizosphere | IVHLFDGLIVEEEAGSERREIREAKRELAESGFGAIQ |
Ga0207662_111836741 | 3300025918 | Switchgrass Rhizosphere | RYAQHADRIVHLFDGLIVEEEAGANRREIEDAKKELRESGFTEVQ |
Ga0207657_104782202 | 3300025919 | Corn Rhizosphere | AQHADRIVHLFDGLIVEEEAGADRREIQEAKRELAESGFGAIS |
Ga0207659_104822911 | 3300025926 | Miscanthus Rhizosphere | DARYAQHADRIVHLFDGVIVEEEAGANRREVADGKRDGQENGLGAIG |
Ga0207706_112240261 | 3300025933 | Corn Rhizosphere | VHLFDGLIVEEETGSASRKAEIEAAKRELKESGFTEVQ |
Ga0207669_109763352 | 3300025937 | Miscanthus Rhizosphere | AQHADRIVHLFDGLIVEDETGSASRKAEIEAAKRELKESGFTEVQ |
Ga0207661_114584632 | 3300025944 | Corn Rhizosphere | VHLFDGLIVEEEAGSERREIREAKRELEESGFGAIS |
Ga0207679_104439183 | 3300025945 | Corn Rhizosphere | ADRIIHLFDGLIVEEEAGSERREIQEAKRELAESGFGVIQ |
Ga0207679_118960892 | 3300025945 | Corn Rhizosphere | IVHLFDGLIVEEEAGADRREIQDAKRELAESGFGAIQ |
Ga0207679_121425611 | 3300025945 | Corn Rhizosphere | DRIVHLFDGLIVEEEAGSERREIHEQQLKEAGFGAIS |
Ga0207712_120989342 | 3300025961 | Switchgrass Rhizosphere | HHADRIVHLFDGLIVEEEAGANRREVEDAKREKKENGFGAIG |
Ga0208415_10133112 | 3300025993 | Rice Paddy Soil | ADRIVHLFDGLIVEEEAGANRREIEEAKQELRESGFTEVQ |
Ga0207641_103129001 | 3300026088 | Switchgrass Rhizosphere | HLFDGLIVEEEAGSDRREIREAKRELAESGFGAIQ |
Ga0207648_106863153 | 3300026089 | Miscanthus Rhizosphere | DRIVHLFDGVIVEEEAGANRREVADGKRDGQENGLGAIG |
Ga0209688_10411972 | 3300026305 | Soil | HDDRIVHLFDGLIVEEEAGAHRREIEEAKRELKESGFGEIP |
Ga0179593_12122614 | 3300026555 | Vadose Zone Soil | MAQHADRIVHMFDGLIVEEETGANRREIEDAKRELKESGFGDIA |
Ga0209689_11634521 | 3300027748 | Soil | HADRIVHLFDGLIVEEEAGAHRREIEEAKRELKESGFGEIP |
Ga0209382_118936642 | 3300027909 | Populus Rhizosphere | HADRIVHLFDGLIVEEEAGANRREIEEAKQELRESGFTEVQ |
Ga0268265_126554901 | 3300028380 | Switchgrass Rhizosphere | AQHADRIVHLFDGLIVEEEAGADRREIREAKRELAESGFGAIS |
Ga0268264_107113232 | 3300028381 | Switchgrass Rhizosphere | HLFDGLIVEEEAGADRREIREAKRELAESGFGAIQ |
Ga0268264_115104051 | 3300028381 | Switchgrass Rhizosphere | PRYAQHADRIVHLFDGLIVEEEAGADRREIQDAKRELAESGFGAIQ |
Ga0272482_103264611 | 3300028578 | Soil | AQHADRIVHLFDGLIVEEEAGANRREIEEAKRELKESGFGDIK |
Ga0310888_108593672 | 3300031538 | Soil | QHADRIVHLFDGLIVEEEAGADRREIQEAKRELAESGFGAIS |
Ga0310886_105493652 | 3300031562 | Soil | YAQHADRIVHLFDGLIVEEETGSASRKAEIEAAKRELKESGFTEVQ |
Ga0310813_106536651 | 3300031716 | Soil | VHLFDGLIVEEETGANRRQIEEAKQELRESGFVEVQ |
Ga0310813_109778111 | 3300031716 | Soil | YAQHADRIVHLFDGLIVEEETGANRRQIEEAKQELRESGFVEVQ |
Ga0307406_104649081 | 3300031901 | Rhizosphere | VHLFDGLIVEEEAGANRREIEDAKRELKESGFGAIA |
Ga0310900_105107711 | 3300031908 | Soil | DRIVHLFDGLIVEEEAGADRREIREAKRELAESGFGAIQ |
Ga0310899_101293133 | 3300032017 | Soil | AQHADRIVHLFDGLIVEEEAGANRREVEDARRDARENGRGATG |
Ga0310890_117540542 | 3300032075 | Soil | AQHADRIIHLFDGLIVEEEAGADRREIREAKRELAESGFGAIS |
Ga0310896_106427291 | 3300032211 | Soil | IIHLFDGLIVEEEAGADRREIREAKRELAESGFGAIS |
Ga0310810_112076092 | 3300033412 | Soil | DRIIHLFDGLIVEEEAGADRREIQEAKRELAESGFGAIS |
Ga0364942_0274127_2_145 | 3300034165 | Sediment | DARYAQHADRIVHLFDGLIVEEEAGANRREVEDAKREAKENGLGAIG |
⦗Top⦘ |