| Basic Information | |
|---|---|
| Family ID | F045629 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 38 residues |
| Representative Sequence | VLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLEKF |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.47 % |
| % of genes near scaffold ends (potentially truncated) | 99.34 % |
| % of genes from short scaffolds (< 2000 bps) | 92.11 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.447 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.974 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.684 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.38% β-sheet: 20.31% Coil/Unstructured: 70.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF00977 | His_biosynth | 82.89 |
| PF00117 | GATase | 9.21 |
| PF00475 | IGPD | 3.29 |
| PF01502 | PRA-CH | 0.66 |
| PF00815 | Histidinol_dh | 0.66 |
| PF15780 | ASH | 0.66 |
| PF08029 | HisG_C | 0.66 |
| PF00213 | OSCP | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG0131 | Imidazoleglycerol phosphate dehydratase HisB | Amino acid transport and metabolism [E] | 3.29 |
| COG0040 | ATP phosphoribosyltransferase | Amino acid transport and metabolism [E] | 0.66 |
| COG0139 | Phosphoribosyl-AMP cyclohydrolase | Amino acid transport and metabolism [E] | 0.66 |
| COG0141 | Histidinol dehydrogenase | Amino acid transport and metabolism [E] | 0.66 |
| COG0712 | FoF1-type ATP synthase, delta subunit | Energy production and conversion [C] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02FQTAD | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300000955|JGI1027J12803_109005000 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101444995 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300003988|Ga0055475_10036653 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300004091|Ga0062387_100800653 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300005332|Ga0066388_100122565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3126 | Open in IMG/M |
| 3300005340|Ga0070689_101776883 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005434|Ga0070709_10149671 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300005539|Ga0068853_102439003 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005555|Ga0066692_10089645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1803 | Open in IMG/M |
| 3300005569|Ga0066705_10452828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 804 | Open in IMG/M |
| 3300005591|Ga0070761_10989503 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005712|Ga0070764_10489327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300005993|Ga0080027_10356229 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006800|Ga0066660_10202726 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300006854|Ga0075425_100992246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300006854|Ga0075425_101102076 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300006893|Ga0073928_10771738 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300007258|Ga0099793_10203582 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300009089|Ga0099828_10523727 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300009617|Ga0116123_1022130 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300010043|Ga0126380_10181915 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300010043|Ga0126380_11056147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300010043|Ga0126380_12151568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300010358|Ga0126370_11019901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300010360|Ga0126372_10121413 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
| 3300010366|Ga0126379_12412647 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300011269|Ga0137392_10865813 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300011270|Ga0137391_10670016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300011271|Ga0137393_10765906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300012096|Ga0137389_10354945 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300012189|Ga0137388_11670675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300012203|Ga0137399_10068882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2647 | Open in IMG/M |
| 3300012207|Ga0137381_10720989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300012210|Ga0137378_10954306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300012582|Ga0137358_10141159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1639 | Open in IMG/M |
| 3300012683|Ga0137398_10299867 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300012685|Ga0137397_10070515 | All Organisms → cellular organisms → Bacteria | 2528 | Open in IMG/M |
| 3300012917|Ga0137395_11025555 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012923|Ga0137359_10047030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3748 | Open in IMG/M |
| 3300012944|Ga0137410_11613578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300012955|Ga0164298_11700516 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012971|Ga0126369_10208579 | All Organisms → cellular organisms → Bacteria | 1890 | Open in IMG/M |
| 3300015241|Ga0137418_10797110 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 709 | Open in IMG/M |
| 3300015242|Ga0137412_10152620 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300016357|Ga0182032_11525619 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300016387|Ga0182040_11078394 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300016730|Ga0181515_1334261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300017942|Ga0187808_10561900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300017943|Ga0187819_10216052 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300017946|Ga0187879_10749617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300017955|Ga0187817_10129132 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300017975|Ga0187782_10538403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300017975|Ga0187782_11661573 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300017999|Ga0187767_10021417 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300018006|Ga0187804_10316669 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300018006|Ga0187804_10408953 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300018015|Ga0187866_1161776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300018047|Ga0187859_10257616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300018088|Ga0187771_11572743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300019789|Ga0137408_1252065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300020581|Ga0210399_10253729 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300020581|Ga0210399_10412764 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300020583|Ga0210401_11426609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300021046|Ga0215015_10683020 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300021086|Ga0179596_10382109 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300021170|Ga0210400_10022935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4857 | Open in IMG/M |
| 3300021180|Ga0210396_10276060 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300021180|Ga0210396_10376434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1250 | Open in IMG/M |
| 3300021180|Ga0210396_10575641 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300021181|Ga0210388_10531704 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300021181|Ga0210388_11465972 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300021401|Ga0210393_10617189 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300021420|Ga0210394_11613166 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300021479|Ga0210410_10950855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300021479|Ga0210410_11662380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300024179|Ga0247695_1052074 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300024182|Ga0247669_1018766 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300025898|Ga0207692_11220629 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300025916|Ga0207663_11138074 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300025938|Ga0207704_10211088 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300025939|Ga0207665_11029465 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300025939|Ga0207665_11270739 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300026089|Ga0207648_11850541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300026296|Ga0209235_1193119 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300026322|Ga0209687_1271021 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300026325|Ga0209152_10166655 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300026328|Ga0209802_1195164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300026333|Ga0209158_1237702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300026342|Ga0209057_1015914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4419 | Open in IMG/M |
| 3300026532|Ga0209160_1138154 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300026557|Ga0179587_10874188 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300026869|Ga0207821_1005109 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300026909|Ga0207858_1016410 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300027000|Ga0207803_1019236 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300027061|Ga0209729_1029970 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300027107|Ga0208367_107462 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300027587|Ga0209220_1122793 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300027587|Ga0209220_1126112 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300027610|Ga0209528_1026622 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300027625|Ga0208044_1011237 | All Organisms → cellular organisms → Bacteria | 3421 | Open in IMG/M |
| 3300027643|Ga0209076_1044230 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300027660|Ga0209736_1089494 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300027662|Ga0208565_1124108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300027855|Ga0209693_10346247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300027855|Ga0209693_10496076 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027884|Ga0209275_10111884 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300027903|Ga0209488_10571038 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300027903|Ga0209488_10926895 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300028536|Ga0137415_10169671 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300028746|Ga0302233_10196167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300028781|Ga0302223_10114880 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300028906|Ga0308309_11063403 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300030043|Ga0302306_10209128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300030659|Ga0316363_10240541 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300031231|Ga0170824_128359116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300031236|Ga0302324_100060854 | All Organisms → cellular organisms → Bacteria | 6694 | Open in IMG/M |
| 3300031564|Ga0318573_10126233 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300031573|Ga0310915_11135080 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031708|Ga0310686_101967402 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300031719|Ga0306917_11483860 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031720|Ga0307469_11588413 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300031740|Ga0307468_101388101 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300031768|Ga0318509_10362760 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300031820|Ga0307473_10380607 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300031823|Ga0307478_10457767 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300031823|Ga0307478_11292793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300031832|Ga0318499_10343019 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031879|Ga0306919_10675728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300031879|Ga0306919_11156224 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300031942|Ga0310916_10194242 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300031945|Ga0310913_11282083 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031962|Ga0307479_10709845 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300032001|Ga0306922_11877350 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300032041|Ga0318549_10377598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300032059|Ga0318533_10129502 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300032076|Ga0306924_10083256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3590 | Open in IMG/M |
| 3300032091|Ga0318577_10099714 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300032091|Ga0318577_10393774 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300032160|Ga0311301_11602335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300032160|Ga0311301_12000602 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300032174|Ga0307470_11170596 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300032180|Ga0307471_100877808 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300032180|Ga0307471_101165552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
| 3300032180|Ga0307471_101314532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
| 3300032205|Ga0307472_101430409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300032892|Ga0335081_10873025 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300032893|Ga0335069_12380062 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300032954|Ga0335083_10384171 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300033405|Ga0326727_10568845 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300033561|Ga0371490_1092787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300033755|Ga0371489_0250837 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.29% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.63% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.97% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.32% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.66% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.66% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.66% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.66% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.66% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027107 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF029 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_05373380 | 2170459005 | Grass Soil | VLIPCIDLQAGQAVQLVRGRRLELAVADVFAQLEKFKRYPGCTSLISTP |
| JGI1027J12803_1090050004 | 3300000955 | Soil | VLIPCIDLQAGQAVQLVHGRRRELSVADVFAQLEKF |
| JGIcombinedJ26739_1014449951 | 3300002245 | Forest Soil | MMIPCIDLQSGRAVQLVHGRERRLAVDDVLGLLDRF |
| Ga0055475_100366531 | 3300003988 | Natural And Restored Wetlands | VIVACIDLQDGRAVQLVGGRRRALAVDDVFGLLDRFRRHRMLQ |
| Ga0062387_1008006531 | 3300004091 | Bog Forest Soil | MLIPCIDLQGGQAVQLVHGRKRELVVKDVLGLLERFRGYEWL |
| Ga0066388_1001225655 | 3300005332 | Tropical Forest Soil | VLIPCIDLQGGRAVQLVHGQRRELAVADVMGLLKRFGHHSWLHVI |
| Ga0070689_1017768831 | 3300005340 | Switchgrass Rhizosphere | VLIPCIDLQGGQAVQLVHGRRRELAVKDVFGLLDKFQKYDW |
| Ga0070709_101496713 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIPCIDLQSGHAVQLVHGRRCELAVFDVFAQLEKFRRYKWLHIID |
| Ga0068853_1024390031 | 3300005539 | Corn Rhizosphere | VLIPCIDLQGGQAVQLVHGRRRELAVKDVFGLLDKFQKYDWLHI |
| Ga0066692_100896454 | 3300005555 | Soil | VLIPCIDLQSGQAVQLVRGQKRELAVVNVFGLLKKFK |
| Ga0066705_104528282 | 3300005569 | Soil | VLIPCIDLQDGQAVQLVRGRKRELAVADVFGLLHEFSKYTW |
| Ga0070761_109895032 | 3300005591 | Soil | VLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLEKF |
| Ga0070764_104893271 | 3300005712 | Soil | MIIPCIDLQNGEAVQLVRGRKRALSIHDVLGLLERF |
| Ga0080027_103562291 | 3300005993 | Prmafrost Soil | MLIPCIDLQGGQAVQLVHGRKRELVVGDVLGLLEKFKGY |
| Ga0066660_102027263 | 3300006800 | Soil | VLIPCIDLQDGQAVQLVHGRKRELAVADVFGLLKKF |
| Ga0075425_1009922462 | 3300006854 | Populus Rhizosphere | VLIPCIDLQSGQAVQLVHGRRRELAVPDVESQLEKFRRY |
| Ga0075425_1011020761 | 3300006854 | Populus Rhizosphere | LLIPCIDLQGGQAVQLVHGRKRELAVADVFAQLHKF |
| Ga0073928_107717382 | 3300006893 | Iron-Sulfur Acid Spring | VLIPCIDLQNGMAVQLIHGRKRELAIIDVLGVLEKFKDY |
| Ga0099793_102035821 | 3300007258 | Vadose Zone Soil | VLIPCIDLQEGKAVQLVHGRKRELAISDVMSLLLKFQK |
| Ga0099828_105237271 | 3300009089 | Vadose Zone Soil | MLIPCIDLQRGQAVQLVHGRKRALAVNDVLGLLDRFGHHKWL |
| Ga0116123_10221301 | 3300009617 | Peatland | MLIPCIDLQDGQAVQLAHGRKRELAVADVLGLLDRFGHY |
| Ga0126380_101819151 | 3300010043 | Tropical Forest Soil | VLIPCIDLQGGQAVQLVHGRRRELAVADVFGLLERFAKY |
| Ga0126380_110561471 | 3300010043 | Tropical Forest Soil | MLIPCIDLQAGQAVQLVHGRRRELAVADVFAQLEK |
| Ga0126380_121515681 | 3300010043 | Tropical Forest Soil | VLIPCIDLQGGQAVQLVHGRRRELAVADVFGLLEKFSAYEWLN |
| Ga0126370_110199011 | 3300010358 | Tropical Forest Soil | VLIPCIDLQDGQAVQLVHGRKRELAVSDVFGLLQK |
| Ga0126372_101214134 | 3300010360 | Tropical Forest Soil | VLIPCIDLQGGQAVQLVHGRRRELAVSDVFGLLERFGHHPWLNVI |
| Ga0126379_124126471 | 3300010366 | Tropical Forest Soil | VLIPCIDLQDGQAVQLVHGRKPELAVADVFGLLRKFAK |
| Ga0137392_108658131 | 3300011269 | Vadose Zone Soil | MLIPCIDLQSGRAVQLVHGRERRLAVKDVLSLLHRFGG |
| Ga0137391_106700161 | 3300011270 | Vadose Zone Soil | MLIPCIDLQGGQAVQLVHGRKRELAVSDVFGLLRKFKK |
| Ga0137393_107659062 | 3300011271 | Vadose Zone Soil | VLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLRK |
| Ga0137389_103549451 | 3300012096 | Vadose Zone Soil | VLIPCIDLLGGQAVQWVHGRKRELAVADVFGLLRKFK |
| Ga0137388_116706752 | 3300012189 | Vadose Zone Soil | VLIPCIDLQGGQAVQLVNGRKRELAVADVFGLLKKF |
| Ga0137399_100688825 | 3300012203 | Vadose Zone Soil | VLIPCIDLQDGQAVQLVHGRKRELAVTDVFGLLKKF |
| Ga0137381_107209892 | 3300012207 | Vadose Zone Soil | VLIPCIDLQGGQAVQLVHGRKRELAVADVFSLLRK |
| Ga0137378_109543062 | 3300012210 | Vadose Zone Soil | VLIPCIDLQDGHAVQLVHGQKRELAIANVFGLLGKFK |
| Ga0137358_101411594 | 3300012582 | Vadose Zone Soil | VLIPCIDLQGGQAVQLVHGKKRELAVADVFGLLEKFKS |
| Ga0137398_102998671 | 3300012683 | Vadose Zone Soil | VLIPCIDLQGGQAVQLVHGRRRELAVADVFGLLERFK |
| Ga0137397_100705155 | 3300012685 | Vadose Zone Soil | VLIPCIDVQGGQAVQLVHGRRRELAVSDVFGLLKKFGHHEWL |
| Ga0137395_110255551 | 3300012917 | Vadose Zone Soil | VLIPCIDLQQGQAVQLVHGRRRELAIADVMSLLLKFKKY |
| Ga0137359_100470306 | 3300012923 | Vadose Zone Soil | VLIPCIDLQGGQAVQLVHGKKRELAVADVFGLLQKFKS |
| Ga0137410_116135782 | 3300012944 | Vadose Zone Soil | MLIPCIDLQSGQAVQLVRGRRRELSVSDVNAQLHKF |
| Ga0164298_117005161 | 3300012955 | Soil | MMIPCIDLQDGRAVQLVHGRERKLAVDDVFGLLDRFGRYP |
| Ga0126369_102085791 | 3300012971 | Tropical Forest Soil | LQGGQAVQLVHGRKRELAVSDVFGLLRKFAKYPWLH |
| Ga0137418_107971103 | 3300015241 | Vadose Zone Soil | VLIPCIDLQGGQAVQLVHGRKRELAVADVFGVLEKFRNY |
| Ga0137412_101526201 | 3300015242 | Vadose Zone Soil | VLIPCIDLQNGQAVQLVHGRRRELAVADVFGLLEKFSHYKW |
| Ga0182032_115256192 | 3300016357 | Soil | MLIPCIDLQDGQAVQLLHGRKRELAVADVFGLLHKFRKYPW |
| Ga0182040_110783942 | 3300016387 | Soil | VLIPCIDLQGGQAVQLVRGRKRELAVADVLGLLDRFGRH |
| Ga0181515_13342611 | 3300016730 | Peatland | MLIPCIDLQDGQAVQLVHGRKRELAVADVLGLLDR |
| Ga0187808_105619001 | 3300017942 | Freshwater Sediment | MLIPCIDLQRGQAVQLVHGRKRELAVADVLGLLERF |
| Ga0187819_102160522 | 3300017943 | Freshwater Sediment | MMIPCIDLQDGRAVQLVHGRERKLAVDDVLGLLDRFG |
| Ga0187879_107496172 | 3300017946 | Peatland | VLIPCIDLQDGQAVQLVHGRKRELAVADVLGLLDRFGHYAWLHV |
| Ga0187817_101291321 | 3300017955 | Freshwater Sediment | LLIPCIDLQRGKAVQLVHGRKRELAVADVLGLLERFS |
| Ga0187782_105384031 | 3300017975 | Tropical Peatland | LLIPCIDLQDGQAVQLVRGRKRELAVADVLGLLERFGHYAWLH |
| Ga0187782_116615732 | 3300017975 | Tropical Peatland | VLIPCIDLQNGVAVQLVHGRKKALEVEDVMSLLERFGRYSWLHV |
| Ga0187767_100214173 | 3300017999 | Tropical Peatland | VLIPCIDLQHGQAVQLVQGRRRALAVADVMGLLDRFSS |
| Ga0187804_103166692 | 3300018006 | Freshwater Sediment | VLIPCIDLQGGQAVQLVHGRKRELAVVDVLGLLERFSRYE |
| Ga0187804_104089532 | 3300018006 | Freshwater Sediment | LLIPCIDLQRGKAVQLVHGRKRELAVADVLGLLQRFSQYEWLH |
| Ga0187866_11617762 | 3300018015 | Peatland | VLIPCIDLQDGQAVQLVHGRKRELAVADVLGLLDRFGHY |
| Ga0187859_102576161 | 3300018047 | Peatland | VLIPCIDLQDGQAVQLVHGRKRELAVADVLGLLDRFSRYA |
| Ga0187771_115727432 | 3300018088 | Tropical Peatland | IDLQGGKAVQLVRGRRRALAIDDVLGLLDRFRDYPISK |
| Ga0137408_12520651 | 3300019789 | Vadose Zone Soil | MLIPCIDLQSGQAVQLVHGRRRELSVSDVNAQLHKFRHYK |
| Ga0210399_102537291 | 3300020581 | Soil | MLIPCIDLQAGQAVQLVHGRKRELAVADVFGLLEKFG |
| Ga0210399_104127641 | 3300020581 | Soil | VLIPCIDLQQGKAVQLVHGRKRELAIADVMSLLLRFKKYEWLH |
| Ga0210401_114266091 | 3300020583 | Soil | MLIPCIDLQSGQAVQLVHGRRRELAVSDVFGLLRKFGHN |
| Ga0215015_106830201 | 3300021046 | Soil | VLIPCIDLQDGQAVQLVHGTRRELDVADVFGLLRK |
| Ga0179596_103821092 | 3300021086 | Vadose Zone Soil | VLIPCIDLQSGQAVQLVRGQKRELAVVDVFGLLKKFKQY |
| Ga0210400_100229351 | 3300021170 | Soil | VLIPCIDLQRGKAVQLVHGRKRELAVADVMSLLLKFKKYEW |
| Ga0210396_102760601 | 3300021180 | Soil | VLIPCIDLQGGQAVQLVHGRRRELAVSDVFGLLEKFGHH |
| Ga0210396_103764343 | 3300021180 | Soil | MLIACIDLQGGQAVQLVHGRKRELAVKDVFGLLERFRG |
| Ga0210396_105756411 | 3300021180 | Soil | LIIPCIDLQDGRAVQLVRGRKLRLAVEDVFGLLDR |
| Ga0210388_105317043 | 3300021181 | Soil | MIIPCIDLQGGKAVQLVRGKRRVLAVDDVLGLLDRF |
| Ga0210388_114659721 | 3300021181 | Soil | VLIPCIDLQRRQAVQLVHGRKRELAVADVLGLLARFSRYEWLHVI |
| Ga0210393_106171892 | 3300021401 | Soil | VLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLERFKSYLW |
| Ga0210394_116131662 | 3300021420 | Soil | VLIPCIDLQGGQAVQLVHGRRRELVVADVFGLLDKFRNYPWLH |
| Ga0210410_109508552 | 3300021479 | Soil | VLIPCIDLEGGQAVQLVRGRKRELAVADVFGLLEQFQ |
| Ga0210410_116623802 | 3300021479 | Soil | MLIPCIDLQGGQAVQLVHGRKRELAVADVVGLLKKFK |
| Ga0247695_10520742 | 3300024179 | Soil | VLIPCIDLLDGQAVQLVHGRRCELAVADVFKQLEKFK |
| Ga0247669_10187663 | 3300024182 | Soil | VLIPCIDLQDGQAVQLVHGRRRELAVADVFGLLERF |
| Ga0207692_112206292 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VLIPCIDLQGGQSVQLVHGRKRELAVADVFGLLEKF |
| Ga0207663_111380741 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VLIPCIDLQNGQAVQLVHGRKRELAVADVFGLLERFK |
| Ga0207704_102110883 | 3300025938 | Miscanthus Rhizosphere | VLIPCIDLQSGQAVQLVHGRRRELAVADVFAQLEKFKHYP |
| Ga0207665_110294652 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VLIPCIDLQAGQAVQLVHGRRRELAVADVFGLLEKFREYSWLH |
| Ga0207665_112707392 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPCIDLQSGRAVQLVHGRERRLAVDDVLGLLDRFGG |
| Ga0207648_118505412 | 3300026089 | Miscanthus Rhizosphere | VLIPCIDLQAGQAVQLVRGRRLELAVADVFALSREV |
| Ga0209235_11931192 | 3300026296 | Grasslands Soil | VIVPCIDLQGGKAVQLVRGRRRRLAVDDVLGLLDRF |
| Ga0209687_12710212 | 3300026322 | Soil | VLIPCIDLQDGQAVQLVRGRKRELAVADVFGLLHEFSKY |
| Ga0209152_101666552 | 3300026325 | Soil | VIIPCIDLQAGRAVQLIRGRKLRLAVEDVFGLLDRFRDYSLL |
| Ga0209802_11951641 | 3300026328 | Soil | VLIPCIDLQGGQAVQLVRGRKRELAVAAVFGLLRK |
| Ga0209158_12377021 | 3300026333 | Soil | VLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLKKFKK |
| Ga0209057_10159141 | 3300026342 | Soil | VLIPCIDLQGGQAVQLVRGRKRELAVAAVFGLLRKFKR |
| Ga0209160_11381541 | 3300026532 | Soil | LLIPCIDLQSGQAVQLVHGRRRELAVPDVASQLRKFRRYRW |
| Ga0179587_108741881 | 3300026557 | Vadose Zone Soil | VLIPCIDLQSGEAVQLVRGRRRELAVSDVGAQLHAFRH |
| Ga0207821_10051091 | 3300026869 | Tropical Forest Soil | MLIPCIDLQRGKAVQLVHGRRRELAVDDVMGLLDRFSGYEWLH |
| Ga0207858_10164102 | 3300026909 | Tropical Forest Soil | MLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLDRFGQHRWLH |
| Ga0207803_10192362 | 3300027000 | Tropical Forest Soil | MLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLDH |
| Ga0209729_10299702 | 3300027061 | Forest Soil | MLIPCIDLQSGQAVQLVHGRRRELAVSDVNAQLHKFRRYQWLH |
| Ga0208367_1074621 | 3300027107 | Forest Soil | VLIPCIDLQGGQAVQLVHGRRRELAVTDVFGLLKKFGHH |
| Ga0209220_11227932 | 3300027587 | Forest Soil | VLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLKK |
| Ga0209220_11261121 | 3300027587 | Forest Soil | VLIPCIDLQQGKAVQLVHGKKRELAIADVMSLLLK |
| Ga0209528_10266223 | 3300027610 | Forest Soil | VLIPCIDLQQGRAVQLVHGRKRELAIADVMSLLLRF |
| Ga0208044_10112371 | 3300027625 | Peatlands Soil | VLIPCIDLQDGQAVQLVHGRKRELAVADVLGLLDRF |
| Ga0209076_10442301 | 3300027643 | Vadose Zone Soil | VLIPCIDLQDGQAVQLVHGRKRELAVADVFGLLKKFKKYPWL |
| Ga0209736_10894942 | 3300027660 | Forest Soil | MLIPCIDLQNGMAVQLIHGRKRELAISDVLGVLEKFKNYEW |
| Ga0208565_11241081 | 3300027662 | Peatlands Soil | MLIPCIDLQDGQAVQLVHGRKREFAVADVLGLLDRFGHYAWL |
| Ga0209693_103462471 | 3300027855 | Soil | VLIPCIDLQGGQAVQLVQGHKLELAVADVFGLLRKFK |
| Ga0209693_104960762 | 3300027855 | Soil | VLIPCIDLQDGQAVQLVHGRRRELAVADVFGLLEKFS |
| Ga0209275_101118841 | 3300027884 | Soil | VLIPCIDLQRGQAVQLVHGRKRELAVADVFGLLEKFKS |
| Ga0209488_105710381 | 3300027903 | Vadose Zone Soil | VLIPCIDLQQGQAVQLVHGRRRELAIADVMSVLLKFKK |
| Ga0209488_109268951 | 3300027903 | Vadose Zone Soil | VLIPCIDLQQGQAVQLVHGRRRELAIADVMSLLLK |
| Ga0137415_101696714 | 3300028536 | Vadose Zone Soil | VLIPCIDLQDGQAVQLVHGRKRELAVADVFGLLEKFKK |
| Ga0302233_101961672 | 3300028746 | Palsa | VLIPCIDLQNSRAVQLIHGRRKALEVEDVTGLLHKFRRYSW |
| Ga0302223_101148802 | 3300028781 | Palsa | MLVPCIDLQDGRAVQLVHGRKRRLAVDDVLGLVARFSVY |
| Ga0308309_110634032 | 3300028906 | Soil | MLIPCIDLQDGRAVQLVHGRERKLAVEDVFGLLDRF |
| Ga0302306_102091282 | 3300030043 | Palsa | VLIPCIDLQNSRAVQLIHGRRKALEVEDVTGLLHKFRR |
| Ga0316363_102405412 | 3300030659 | Peatlands Soil | MMIPCIDLQDGRAVQLVHGRERKLAVDDVFGLLDRFG |
| Ga0170824_1283591162 | 3300031231 | Forest Soil | MMIPCIDLQDGRAVQLIHGRERKLAVDDVFGLLDRFG |
| Ga0302324_1000608541 | 3300031236 | Palsa | VIVPCIDLQGGRAVQLVRGQRLALSVDDVLGLLER |
| Ga0318573_101262333 | 3300031564 | Soil | VLIPCIDLQDGQAVQLVHGRRRELAVGDVFGQLHK |
| Ga0310915_111350801 | 3300031573 | Soil | MLIPCIDLQRGQAVQLVHGRRRELAVADVLGLHRRFSHYRWLH |
| Ga0310686_1019674021 | 3300031708 | Soil | MLIPCIDLQDGRAVQLVHGRERKLAVDDVFGLLDRFGGY |
| Ga0306917_114838602 | 3300031719 | Soil | MLIPCIDLQGGQAVQLVHGRKRELAVTDVLGLLDRFGHHRWLHV |
| Ga0307469_115884132 | 3300031720 | Hardwood Forest Soil | VIIPCIDLQGGRAVQLVHGRKLRLAVEDVFGLLDRFR |
| Ga0307468_1013881012 | 3300031740 | Hardwood Forest Soil | VLIPCIDLQGGQAVQLIHGRRRELAVSDVFGLLNKFGHHEWLHVI |
| Ga0318509_103627601 | 3300031768 | Soil | VLIPCIDLQGGQAVQLVRGRKRELAVADVLGLLDRFGRHHWLH |
| Ga0307473_103806071 | 3300031820 | Hardwood Forest Soil | LLIPCIDLQSGQAVQLVHGRRRELAVSDVASQLEKF |
| Ga0307478_104577672 | 3300031823 | Hardwood Forest Soil | VLIPCIDLQGGQAVQLVHGRRRELAVSDVFGLLKKFGRHEWLHVI |
| Ga0307478_112927931 | 3300031823 | Hardwood Forest Soil | VLIPCIDLQGGQAVQLVHGRKRELAVADVFGQLEKFKSYEW |
| Ga0318499_103430192 | 3300031832 | Soil | VLIPCIDLQGGQAVQLVRGRKRELAVADVLGLLDRFGRHRWLHVI |
| Ga0306919_106757281 | 3300031879 | Soil | MLIPCIDLQSGQVVQLVRGRRRELALPDVFAQLDR |
| Ga0306919_111562242 | 3300031879 | Soil | MLIPCIDLQDGQAVQLLHGRKPELAVADVFGLLHKFRKYPWL |
| Ga0310916_101942424 | 3300031942 | Soil | VLIPCIDLQGGRAVQLVHGRKRELAVADVFGLLDRFGRYGWL |
| Ga0310913_112820831 | 3300031945 | Soil | VLIPCIDLQRGQAVQLVHGRRRELAVSDVMGLVKRF |
| Ga0307479_107098452 | 3300031962 | Hardwood Forest Soil | MMIPCIDLQDGRAVQLVHGRERKLAVDDVIGLLDRFGR |
| Ga0306922_118773502 | 3300032001 | Soil | VLIPCIDLQGGQAVQLVHGRKRELAVADVLGLLGR |
| Ga0318549_103775981 | 3300032041 | Soil | LLIPCIDLQSGQAVQLVRGRRRELAVPDVFAQLDK |
| Ga0318533_101295021 | 3300032059 | Soil | MLIPCIDLQRGQAVQLVHGRRRELAVADVLGLLRRFSHYRW |
| Ga0306924_100832561 | 3300032076 | Soil | MLIPCIDLQGGQAVQLVHGRKRELAVTDVLGLLDRFGH |
| Ga0318577_100997143 | 3300032091 | Soil | VLIPCIDLQDGQAVQLVHGRRRELAVGDVFGLLHKVRSYP |
| Ga0318577_103937742 | 3300032091 | Soil | VLIPCIDLQSGQAVQLVHGRRCELAVADVFAQLERFKSY |
| Ga0311301_116023351 | 3300032160 | Peatlands Soil | VLIPCIDLQDGQAVQLVHGRKRELAVADVLGLLDRFG |
| Ga0311301_120006022 | 3300032160 | Peatlands Soil | VLIPCIDLQGGQAVQLVNGRRRELAVADVFGLLQRFEG |
| Ga0307470_111705962 | 3300032174 | Hardwood Forest Soil | VLIPCIDLQGGQAVQLVHGRRRELAVSDVFGLLKKFGHHKWL |
| Ga0307471_1008778083 | 3300032180 | Hardwood Forest Soil | MLIPCIDLQSGQAVQLVHGRRRELAVSDVNAQLHKFRRYKWL |
| Ga0307471_1011655521 | 3300032180 | Hardwood Forest Soil | MLIPCIDLQGGQAVQLVHGKKRELAVSDVFGLLRKFR |
| Ga0307471_1013145321 | 3300032180 | Hardwood Forest Soil | VLIPCIDLQGGQAVQLVHGRRRELAVSDVFGLLEKFRSYPW |
| Ga0307472_1014304091 | 3300032205 | Hardwood Forest Soil | VLIPCIDLQGGQAVQLVHGRRRELAVKDVFGLLDKFQIYKWLHII |
| Ga0335081_108730251 | 3300032892 | Soil | MLIPCIDLQSSQAVQLVHGRKRELAVSDVFSLLERF |
| Ga0335069_123800621 | 3300032893 | Soil | VLIPCIDLQDGQAVQLVHGRRRELAVADVMGLLERF |
| Ga0335083_103841711 | 3300032954 | Soil | MLIPCIDLQQGQAVQLVHGRKRELAIADVLGLLERFS |
| Ga0326727_105688452 | 3300033405 | Peat Soil | MLVPCIDLQDGRAVQLVHGRRLRLAVDDALGLVEKFSGYS |
| Ga0371490_10927872 | 3300033561 | Peat Soil | VLIPCIDLQAGQAVQLVHGRKRELAVADVLGLLDR |
| Ga0371489_0250837_1_114 | 3300033755 | Peat Soil | MLVPCIDLQDGRAVQLVHGRRLRLAVDDALGLVEKFSG |
| ⦗Top⦘ |