| Basic Information | |
|---|---|
| Family ID | F045612 |
| Family Type | Metagenome |
| Number of Sequences | 152 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRICEGAEDCEV |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 59.87 % |
| % of genes near scaffold ends (potentially truncated) | 30.26 % |
| % of genes from short scaffolds (< 2000 bps) | 56.58 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (79.605 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (20.395 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.053 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (74.342 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.97% β-sheet: 13.51% Coil/Unstructured: 63.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF00535 | Glycos_transf_2 | 3.95 |
| PF12850 | Metallophos_2 | 1.97 |
| PF00149 | Metallophos | 1.32 |
| PF02557 | VanY | 1.32 |
| PF04404 | ERF | 1.32 |
| PF13385 | Laminin_G_3 | 1.32 |
| PF05876 | GpA_ATPase | 0.66 |
| PF13306 | LRR_5 | 0.66 |
| PF00145 | DNA_methylase | 0.66 |
| PF10544 | T5orf172 | 0.66 |
| PF06725 | 3D | 0.66 |
| PF05136 | Phage_portal_2 | 0.66 |
| PF03016 | Exostosin | 0.66 |
| PF13704 | Glyco_tranf_2_4 | 0.66 |
| PF00589 | Phage_integrase | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.32 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.32 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.66 |
| COG5511 | Phage capsid protein | Mobilome: prophages, transposons [X] | 0.66 |
| COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 79.61 % |
| All Organisms | root | All Organisms | 20.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.39% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.42% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.21% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.55% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 7.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.61% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 2.63% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.97% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.97% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.32% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.32% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.66% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.66% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.66% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.66% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.66% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12547J11936_100094812 | 3300000736 | Freshwater And Sediment | MKYQYTYEDFVYSLKWLCDEGYIEKFIDEDGNTCVRICEGAEDCEV* |
| JGI25908J49247_100240724 | 3300003277 | Freshwater Lake | MMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV* |
| JGI25926J51410_10038197 | 3300003490 | Freshwater Lake | MMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRICEGAEDCEV* |
| Ga0079957_10459736 | 3300005805 | Lake | MKYTYEDFMAALSYLELEGYIERFIDKDGSECVRICEGAEDCEV* |
| Ga0079957_12247891 | 3300005805 | Lake | RAGGLMKYTYEDFMAALSYLELEGYIERFIDKDGSECVRICEGAEDCEV* |
| Ga0075464_100180341 | 3300006805 | Aqueous | MKYTYEDFMAALSYLELEGYIERFIDKDGSECVRICEGAEECEV* |
| Ga0102828_10063003 | 3300007559 | Estuarine | MMHQYTYEDFMSSLKWLEAEGYIEKFYDTNGDLCVCVCEGAEDCEV* |
| Ga0102828_11177353 | 3300007559 | Estuarine | MTHQYTYEDFMSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV* |
| Ga0110929_11092762 | 3300008072 | Water Bodies | VSAKYTYEDFLAALSYLEQEGFVERFLNEKGEEMIRICEGAEHL* |
| Ga0114340_100024845 | 3300008107 | Freshwater, Plankton | VTAYTYGDFLAALEYLEAEGYIERFFDETGAECVRICEGAEECEV* |
| Ga0114363_10625233 | 3300008266 | Freshwater, Plankton | VSAKYTYEDFLAALSYLEREGFVERFLNEKGEEMIRICEGAEHL* |
| Ga0114880_10009758 | 3300008450 | Freshwater Lake | MTHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV* |
| Ga0114880_10018978 | 3300008450 | Freshwater Lake | MMHQYTYEDFMSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV* |
| Ga0114880_100376513 | 3300008450 | Freshwater Lake | MMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRICEGA |
| Ga0102829_12049982 | 3300009026 | Estuarine | MSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV* |
| Ga0114980_100170575 | 3300009152 | Freshwater Lake | MKYQYTYEDFMHSLKWLEAEGYIEQFIDEDGNVCVRICEGAENCEL* |
| Ga0114980_100385067 | 3300009152 | Freshwater Lake | MKYQYTYEDFMHSLKWLEAEGYIEQFIDGDGNVCVRIC |
| Ga0114963_101882182 | 3300009154 | Freshwater Lake | MSSLKWLEAEGYIEKFYDSNNELCVRICEGAEDCEV* |
| Ga0114968_100047612 | 3300009155 | Freshwater Lake | MMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEI* |
| Ga0114968_100054004 | 3300009155 | Freshwater Lake | MTHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEI* |
| Ga0114968_100160535 | 3300009155 | Freshwater Lake | MSSLKWLEAEGYIEKFYDNNGDLCVRICEGAEDCEV* |
| Ga0114968_100657791 | 3300009155 | Freshwater Lake | MNYQYTYEDFMHSLKWLEAEGYIEQFIDEDGNNCVRICEGAEDCEV* |
| Ga0114968_103339722 | 3300009155 | Freshwater Lake | MNYQYTYEDFVSSLKWLCDEGYIEKFIDEDGNTCVRICEGAEDCEI* |
| Ga0114981_100126113 | 3300009160 | Freshwater Lake | MKYQYTYEDFMHSLKWLEAEGYIEQFIDGDGNVCVRICEGAENYEL* |
| Ga0114966_106029201 | 3300009161 | Freshwater Lake | MMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRV |
| Ga0114974_100021484 | 3300009183 | Freshwater Lake | MMHQYTYEDFMSSLKWLEAEGYIEKFYDSNNELCVRICEGAEDCEV* |
| Ga0114974_1000560111 | 3300009183 | Freshwater Lake | MKYQYTYEDFVSSLKWLCDEGYIEKFIDEDGNTCVRICEGAEDCEI* |
| Ga0114974_100794722 | 3300009183 | Freshwater Lake | MPHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV* |
| Ga0114974_100977782 | 3300009183 | Freshwater Lake | MSSLKWLEAEGYIEKFYDSNNELCVRICEGAEDCEI* |
| Ga0114971_103765761 | 3300009185 | Freshwater Lake | RAGMTHQYTYEDFMSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV* |
| Ga0114964_102975601 | 3300010157 | Freshwater Lake | MRAEHLANRAGMTHQYTYEDFMSSLKWLEAEGYIEKFYDSNNELCVRICEGAEDCEV* |
| Ga0136644_106046341 | 3300010334 | Freshwater Lake | VKYTYSDFIASLKYLEDEGYIERFYDENGQECVRIADGAENAKI* |
| Ga0129333_102073733 | 3300010354 | Freshwater To Marine Saline Gradient | MATAYTYSDFIAALEYLEAEGYIERFYDSNGSECVRICEGAEEAEV* |
| Ga0129333_104553493 | 3300010354 | Freshwater To Marine Saline Gradient | VSANYTYEDFMAALSYLEREGFVERFLNEKGEEMIRICEGAEHL* |
| Ga0129333_105815003 | 3300010354 | Freshwater To Marine Saline Gradient | MAATYTYGDFIAALEYLEAEGYIERFIDKDGSECVRICEGAEDCEV* |
| Ga0129336_100116563 | 3300010370 | Freshwater To Marine Saline Gradient | VKYTLEDLNAALSYLEAEGYIERFVDSDGNDCVRICEGAEDCEV* |
| Ga0129336_101264433 | 3300010370 | Freshwater To Marine Saline Gradient | MAATYTYGDFIAALEYLEAEGYIERFYDGNGSECVRICEGAEECEV* |
| Ga0129336_102486865 | 3300010370 | Freshwater To Marine Saline Gradient | MSYTYADFISALEYLEAEGYIERFIDSDGSECVRICEGAETAEI* |
| Ga0129336_102776473 | 3300010370 | Freshwater To Marine Saline Gradient | MSAAYTYSDFLAALEYLEAEGYIERFIDSDGSECVRICEGAEDCEV* |
| Ga0129336_105292451 | 3300010370 | Freshwater To Marine Saline Gradient | TYEDFMAALSYLELEGYIERFIDKDGSECVRICEGAEDCEV* |
| Ga0129336_106333511 | 3300010370 | Freshwater To Marine Saline Gradient | MATAYTYGDFLAALEYLEAEGYIERFIDKDGSECVRICEGAEDCEV* |
| Ga0129336_106866452 | 3300010370 | Freshwater To Marine Saline Gradient | MATAYTYGDFIAALEYLEAEGYIERFYDSDGSECVRICEGAEEAEV* |
| Ga0129336_107204062 | 3300010370 | Freshwater To Marine Saline Gradient | MSAAYTYSDFLAALEYLEAEGYIERFFDSDGSECVRICEGAENCEV* |
| Ga0133913_100938346 | 3300010885 | Freshwater Lake | MHSLKWLEAEGYIEQFIDEDGNNCVRICEGAEDCEV* |
| Ga0133913_128758044 | 3300010885 | Freshwater Lake | MHQYTYEDFMSSLKWLEAEGYIERFYDSNNELCVRICEGAEDCEV* |
| Ga0151514_104442 | 3300011115 | Freshwater | MNYQYTYEDFVASIKWLCDEGYIEKFIDEDGNTCVRICEGAENCEI* |
| Ga0151516_1006867 | 3300011116 | Freshwater | MRESYTYGDFIASLKYLEAEGYIERFFDENGQECVRIADGAENAKI* |
| Ga0119951_10015867 | 3300012000 | Freshwater | MAATYTYGDFIAALDYLEAEGYIERFFDAAGHECVRICEGAEECEI* |
| Ga0164293_108218752 | 3300013004 | Freshwater | MATAYTYGDFIAALQYLEAEGYIERFYDGNGSECVRICEGAEDCEV* |
| Ga0164293_109098971 | 3300013004 | Freshwater | TYEDFVSSLKWLEAEGYIEKFYDNNGDLCVRMCEGAEDCEV* |
| (restricted) Ga0172374_12163023 | 3300013122 | Freshwater | VSAAYTYSDFISALEYLEAEGYIERFYDSDGSECVRICEGAEEAEV* |
| (restricted) Ga0172366_107194382 | 3300013128 | Sediment | VSTAYTYSDFISALEYLEAEGYIERFYDSDGSECVRICEGAEEAEV* |
| (restricted) Ga0172364_106603643 | 3300013129 | Sediment | LAALNWLEAEGYIEKFYDDSGHECVRICEGAEEAEV* |
| (restricted) Ga0172363_108577983 | 3300013130 | Sediment | TAYTYSDFISALEYLEAEGYIERFYDSDGSECVRICEGAEEAEV* |
| (restricted) Ga0172373_100545502 | 3300013131 | Freshwater | VSAAYTYTDFLAALNWLEAEGYIEKFYDSNGHECVRICEGAEEAEV* |
| (restricted) Ga0172372_101053987 | 3300013132 | Freshwater | DFLAALNWLEAEGYIEKFYDESGHECVRICEGAEEAEV* |
| (restricted) Ga0172375_106495852 | 3300013137 | Freshwater | VSTAYTYTDFLAALNWLEAEGYIEKFYDESGHECVRICEGAEEAEV* |
| Ga0177922_103626211 | 3300013372 | Freshwater | TYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV* |
| Ga0177922_1042002411 | 3300013372 | Freshwater | MKYQYTYEDFMHSLKWLEAEGYIEQFIDEDGNVCIRICEGAENCEL* |
| Ga0181364_10211973 | 3300017701 | Freshwater Lake | MRGKRQASRAGMTHQYTYEDFMSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV |
| Ga0181347_10423215 | 3300017722 | Freshwater Lake | QYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV |
| Ga0181347_11161842 | 3300017722 | Freshwater Lake | MMHQYNYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV |
| Ga0181362_10450724 | 3300017723 | Freshwater Lake | FMSSLKWLEAEGYIEKFYDNNGDLCVRICEGAEDCEV |
| Ga0181356_10178277 | 3300017761 | Freshwater Lake | SSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV |
| Ga0181356_11412301 | 3300017761 | Freshwater Lake | YTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV |
| Ga0181356_11428631 | 3300017761 | Freshwater Lake | TYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV |
| Ga0181356_12493052 | 3300017761 | Freshwater Lake | RGKRQASRAGMTHQYTYEDFMSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV |
| Ga0181357_11289194 | 3300017777 | Freshwater Lake | DFMSSLKWLEAEGYIEKFYDNNGDLCVRICEGAEDCEV |
| Ga0181357_11868402 | 3300017777 | Freshwater Lake | MMHQYAYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV |
| Ga0181357_13375721 | 3300017777 | Freshwater Lake | QASRAGMMHQYTYEDFMSSLKWLEAEGYIEKFYDSNNELCVRICEGAEDCEV |
| Ga0181349_10762801 | 3300017778 | Freshwater Lake | GKRQASRAGMMHQYTYEDFMFSLKWLEAEGYIEKFYDNNGDLCVRICEGAEDCEV |
| Ga0181346_10464956 | 3300017780 | Freshwater Lake | MHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV |
| Ga0181346_11058894 | 3300017780 | Freshwater Lake | QASRAGMMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRICEGAEDCEV |
| Ga0169931_101161185 | 3300017788 | Freshwater | VSAAYTYSDFISALEYLEAEGYIERFYDSDGSECVRICEGAEEAEV |
| Ga0169931_101602375 | 3300017788 | Freshwater | MGRIGLMEASYTYTDFLAALNWLEAEGYIEKFYDESGHECVRICEGAEEAEV |
| Ga0169931_105318293 | 3300017788 | Freshwater | VSAAYTYTDFLAALNWLEAEGYIEKFYDESGHECVRICEGAEEAEV |
| Ga0169931_107821721 | 3300017788 | Freshwater | FLAALNWLEAEGYIEKFYDESGHECVRICEGAEEAEV |
| Ga0187844_100549773 | 3300018868 | Freshwater | MMHQYTYEDFMSSIKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV |
| Ga0187843_101007031 | 3300019093 | Freshwater | MHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEG |
| Ga0181359_100002813 | 3300019784 | Freshwater Lake | MSSLKWLEAEGYIEKFYDNNGDLCVRICEGAEDCEV |
| Ga0181359_10080978 | 3300019784 | Freshwater Lake | MTHQYTYEDFMSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV |
| Ga0181359_10112928 | 3300019784 | Freshwater Lake | GKRQASRAGMTHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV |
| Ga0181359_10369523 | 3300019784 | Freshwater Lake | MSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV |
| Ga0181359_11041682 | 3300019784 | Freshwater Lake | MMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV |
| Ga0181359_12582992 | 3300019784 | Freshwater Lake | MSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCE |
| Ga0194112_110597752 | 3300020109 | Freshwater Lake | CAFRLVSTAYTYTDFLAALNWLEAEGYIEKFYDESGHECVRICEGAEEAEV |
| Ga0194134_100380137 | 3300020179 | Freshwater Lake | VSAAYTYTDFLAALNWLEAEGYIEKFYDDSGHECVRICEGAEEAEV |
| Ga0194134_101850772 | 3300020179 | Freshwater Lake | VSTYTYDDFLSALNYLEAEGYIERFFNSDGSECVRICEGAEDCEV |
| Ga0194134_102053631 | 3300020179 | Freshwater Lake | DFLSALNYLEAEGYIERFFNSDGSECVRICPGAEDCEV |
| Ga0194134_102902443 | 3300020179 | Freshwater Lake | VSTYTYDDFLSALSYLEAEGYIERFFNSDGSECVRICEGAEEAEV |
| Ga0194115_100645676 | 3300020183 | Freshwater Lake | VSAAYTYDDFLSALNYLEAEGYIERFFNADGSECVRICEGAEEAEV |
| Ga0194115_101338843 | 3300020183 | Freshwater Lake | VSAAYTYDDFLSALSYLEAEGYIERFFNSDGSECVRICEGAEDCEV |
| Ga0194115_101559462 | 3300020183 | Freshwater Lake | VSAAYTYDDFLSALNYLEAEGYIERFFNSDGSECVRICEGAEEAEV |
| Ga0194115_104861001 | 3300020183 | Freshwater Lake | VSTAYTYTDFLAALNWLEAEGYIEKFYDESGHECVRICEGAEEAEV |
| Ga0194123_102123721 | 3300021093 | Freshwater Lake | SALSYLEAEGYIERFFNSDGSECVRICEGAEDCEV |
| Ga0194117_102645644 | 3300021424 | Freshwater Lake | STAYTYTDFLAALNWLEAEGYIEKFYDESGHECVRICEGAEEAEV |
| Ga0222712_100421203 | 3300021963 | Estuarine Water | MMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGELCVRICEGAEDCEV |
| Ga0181354_10073045 | 3300022190 | Freshwater Lake | MRGKRQASRAGVMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCE |
| Ga0181354_11963003 | 3300022190 | Freshwater Lake | MMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRICEGAEDCEV |
| Ga0181351_10290193 | 3300022407 | Freshwater Lake | MRGKRQASRAGVMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRV |
| Ga0181351_11433971 | 3300022407 | Freshwater Lake | GMMHQYTYEDFMSSLKWLEAEGYIEKFYDSNNELCVRICEGAEDCEV |
| Ga0181351_11825902 | 3300022407 | Freshwater Lake | MRDKRQASRAGMMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV |
| Ga0214917_1000218548 | 3300022752 | Freshwater | MASNWTHEDFLGALSYLEAEGYIERFLDKDGHECVRICEGAEDCEI |
| Ga0214917_1000375027 | 3300022752 | Freshwater | MNYQYTYDDFIASLKWLQDEGYIEQFIDEDGNACVRICEGAENCEI |
| Ga0214917_100078207 | 3300022752 | Freshwater | VKYTYSDFIASLKYLEDEGYIERFYDENGQECVRIADGAENAKI |
| Ga0214917_1001485811 | 3300022752 | Freshwater | MKYTYEDFVSALSYLEAEGYIERFVDSDGNDCVRICEGAENCEV |
| Ga0214917_100199125 | 3300022752 | Freshwater | MAKHTYEELISSLNYLEAEGYIEKFIDEKGDICYRICEGAENCDV |
| Ga0214917_101464312 | 3300022752 | Freshwater | MNKTYTMQELESALSYLEAEGYIERFIDFNGNDCVRICEGAEDCEI |
| Ga0214921_1000220324 | 3300023174 | Freshwater | MTHQYTYEDFMSSLKWLEAEGYIEKFYDNNGELCVRICEGAEDCEV |
| Ga0214923_100029456 | 3300023179 | Freshwater | MATAYTYGDFIAALEYLEAEGYIERFYDSDGSECVRICEGAENCEI |
| Ga0214923_100041004 | 3300023179 | Freshwater | MSEQYTYQDFMASLKWLEAEGYIEKFYNEKNELCVRICEGAENCEV |
| Ga0214923_1000732818 | 3300023179 | Freshwater | MTEPYNYADFLASLKYLEDEGYIERFYDETGAECVRICEGAEECEV |
| Ga0214923_1001111015 | 3300023179 | Freshwater | MASNWTYEDFLGALSYLEAEGYIERFLDKDGHECVRICEGAEDCEI |
| Ga0214923_100250758 | 3300023179 | Freshwater | MAVTYTYGDFIAALDYLVAEGYIERFFDADGHECVRICEGAEECEI |
| Ga0214923_100965554 | 3300023179 | Freshwater | MRFIEMKYTYEDFMAALSYLELEGYIERFIDKDGSEYVRICEGAEDCEV |
| Ga0244775_101077082 | 3300024346 | Estuarine | MMHQYTYEDFMSSLKWLEAEGYIEKFYDTNGDLCVCVCEGAEDCEV |
| Ga0208975_10287831 | 3300027659 | Freshwater Lentic | YEDFMSSLKWLEAEGYIEKFYNTNNELCVRICEGAEDCEV |
| Ga0209087_11124031 | 3300027734 | Freshwater Lake | YEDLMSSLKWLEAEGYIEKFYDSNNELCVRICEGAEDCEV |
| Ga0209190_10913672 | 3300027736 | Freshwater Lake | MMHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEI |
| Ga0209085_11118703 | 3300027741 | Freshwater Lake | MRAEHLANRAGMTHQYTYEDFMSSLKWLEAEGYIEKFYDSNNELCVRICEGAEDCEV |
| Ga0209596_10026094 | 3300027754 | Freshwater Lake | MTHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEI |
| Ga0209296_10384634 | 3300027759 | Freshwater Lake | MMHQYTYEDFMSSLKWLEAEGYIEKFYDSNNELCVRICEGAEDCEV |
| Ga0209296_10977945 | 3300027759 | Freshwater Lake | MPHQYTYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEV |
| Ga0209353_102120724 | 3300027798 | Freshwater Lake | TYEDFMSSLKWLEAEGYIEKFYDNNGDLCVRICEGAEDCEV |
| Ga0209400_100136329 | 3300027963 | Freshwater Lake | MSSLKWLEAEGYIEKFYDNNGDLCVRVCEGAEDCEI |
| Ga0209400_11281112 | 3300027963 | Freshwater Lake | MNYQYTYEDFVSSLKWLCDEGYIEKFIDEDGNTCVRICEGAEDCEI |
| Ga0209298_100063162 | 3300027973 | Freshwater Lake | MMHQYTYEDFMSSLKWLEAEGYIERFYDSNNELCVRICEGAEDCEV |
| Ga0209298_100079158 | 3300027973 | Freshwater Lake | MKYQYTYEDFMHSLKWLEAEGYIEQFIDEDGNVCVRICEGAENCEL |
| Ga0209298_100118218 | 3300027973 | Freshwater Lake | MKYQYTYEDFMHSLKWLEAEGYIEQFIDGDGNVCVRICEGAENYEL |
| Ga0209299_100183910 | 3300027974 | Freshwater Lake | MHSLKWLEAEGYIEQFIDEDGNVCVRICEGAENCEL |
| Ga0119944_10011563 | 3300029930 | Aquatic | MGNLVKYDYSDFIAALEYLEAEGYIERFFDSDGSECVRICEGAEECEI |
| Ga0119944_10235782 | 3300029930 | Aquatic | VSAKYTYEDFLAALSYLEREGFVERFLNEKGEEMIRICEGAEHL |
| Ga0119944_10432571 | 3300029930 | Aquatic | MSYTYADFLAAINWLVAEGYIERFYDASGAECVRICEGAETAEI |
| Ga0119945_10005179 | 3300029933 | Aquatic | VKYDYSDFIAALEYLEAEGYIERFFDSDGSECVRICEGAEECEI |
| Ga0315288_106204004 | 3300031772 | Sediment | RQASRAGMMHQYTYEDFMSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV |
| Ga0315285_101856571 | 3300031885 | Sediment | GMMHQYTYEDFMSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV |
| Ga0315274_107096742 | 3300031999 | Sediment | MHQYTYEDFMSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV |
| Ga0315284_101654048 | 3300032053 | Sediment | SSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV |
| Ga0315295_115523581 | 3300032156 | Sediment | FMSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV |
| Ga0315268_101068533 | 3300032173 | Sediment | MSSLKWLEAEGYIEKFYDSNGDLCVRVCEGAEDCEV |
| Ga0315271_106634323 | 3300032256 | Sediment | SRAGMMHQYTYEDFMSSLKWLEAEGYIEKFYDSNGDLCVRVCEGAEDCEV |
| Ga0315286_122370302 | 3300032342 | Sediment | KRQASRAGMMHQYTYEDFMSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV |
| Ga0315275_104558375 | 3300032401 | Sediment | RAGMMHQYTYEDFMSSLKWLEAEGYIEKFYDTNGDLCVRVCEGAEDCEV |
| Ga0334722_103369332 | 3300033233 | Sediment | MMHQYTYEDFMSSLKWLEAEGYIEKFYDSNGDLCVRVCEGAEDCEV |
| Ga0334982_0220842_149_289 | 3300033981 | Freshwater | MATAYTYGDFLAALEYLEAEGYIERFFDDTGAECVRICEGAEECEV |
| Ga0334979_0175814_345_485 | 3300033996 | Freshwater | MATAYTYGDFIAALQYLEAEGYIERFYDGNGSECVRICEGAEDCEV |
| Ga0310127_002577_537_671 | 3300034072 | Fracking Water | MRYTYEDFMAALSYLECEGYIERFIDKDGSECVRICEGAEDCEV |
| Ga0310130_0093205_560_700 | 3300034073 | Fracking Water | MAAAYTYSDFIAALKYLEAEGYIERFYDSSGSECVRICEGAEECEV |
| Ga0310130_0253410_3_131 | 3300034073 | Fracking Water | MKYTYEDFMAALSYLELEGYIERFIDKDGNECVRICEGAEDCE |
| Ga0335036_0020970_610_750 | 3300034106 | Freshwater | MATAYTYGDFIAALEYLEAEGYIERFFDETGAECVRICEGAEDCEV |
| Ga0335036_0561350_122_256 | 3300034106 | Freshwater | MATAYTYADFLSALSYLEQEGFIERFVNEKGEEMVRICDGAEDL |
| Ga0335066_0005252_8060_8200 | 3300034112 | Freshwater | MATAYTMADFESAIKYLCDEGYIERFTDADGNECVRICEGAEECEV |
| ⦗Top⦘ |