| Basic Information | |
|---|---|
| Family ID | F045599 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AWALLKRGPDVKLDVGTSIEMEIQRPITVDASRISVAKATP |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.66 % |
| % of genes near scaffold ends (potentially truncated) | 98.68 % |
| % of genes from short scaffolds (< 2000 bps) | 83.55 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.789 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (8.553 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.632 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.237 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.59% β-sheet: 0.00% Coil/Unstructured: 88.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF04402 | SIMPL | 21.05 |
| PF01145 | Band_7 | 18.42 |
| PF06170 | DUF983 | 11.18 |
| PF13487 | HD_5 | 3.95 |
| PF05036 | SPOR | 3.29 |
| PF00990 | GGDEF | 1.97 |
| PF02321 | OEP | 1.32 |
| PF12840 | HTH_20 | 1.32 |
| PF16576 | HlyD_D23 | 0.66 |
| PF01916 | DS | 0.66 |
| PF01850 | PIN | 0.66 |
| PF14307 | Glyco_tran_WbsX | 0.66 |
| PF13205 | Big_5 | 0.66 |
| PF01022 | HTH_5 | 0.66 |
| PF13492 | GAF_3 | 0.66 |
| PF05016 | ParE_toxin | 0.66 |
| PF03544 | TonB_C | 0.66 |
| PF05173 | DapB_C | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 21.05 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 21.05 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 21.05 |
| COG5349 | Uncharacterized conserved protein, DUF983 family | Function unknown [S] | 11.18 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 2.63 |
| COG0289 | 4-hydroxy-tetrahydrodipicolinate reductase | Amino acid transport and metabolism [E] | 0.66 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1899 | Deoxyhypusine synthase | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.79 % |
| Unclassified | root | N/A | 9.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10003190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11856 | Open in IMG/M |
| 3300000567|JGI12270J11330_10255540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 562 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1018321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1049 | Open in IMG/M |
| 3300000650|AP72_2010_repI_A1DRAFT_1025014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300001087|JGI12677J13195_1009259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 702 | Open in IMG/M |
| 3300001175|JGI12649J13570_1017999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 773 | Open in IMG/M |
| 3300001471|JGI12712J15308_10073658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300004152|Ga0062386_100449487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1042 | Open in IMG/M |
| 3300004152|Ga0062386_101302440 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005434|Ga0070709_11436627 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005445|Ga0070708_101771770 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005534|Ga0070735_10201903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1216 | Open in IMG/M |
| 3300005541|Ga0070733_10049416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2632 | Open in IMG/M |
| 3300005541|Ga0070733_11174427 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005890|Ga0075285_1000405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4086 | Open in IMG/M |
| 3300005921|Ga0070766_10081086 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300005995|Ga0066790_10017338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3162 | Open in IMG/M |
| 3300006028|Ga0070717_12023279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 519 | Open in IMG/M |
| 3300006059|Ga0075017_100637918 | Not Available | 816 | Open in IMG/M |
| 3300006086|Ga0075019_10265747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1027 | Open in IMG/M |
| 3300006162|Ga0075030_101424274 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006806|Ga0079220_10736022 | Not Available | 732 | Open in IMG/M |
| 3300006893|Ga0073928_10183951 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300009524|Ga0116225_1550509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300009545|Ga0105237_11523356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 675 | Open in IMG/M |
| 3300009623|Ga0116133_1040911 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300009628|Ga0116125_1161412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 625 | Open in IMG/M |
| 3300009700|Ga0116217_10200639 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300009759|Ga0116101_1131715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella | 601 | Open in IMG/M |
| 3300010048|Ga0126373_10044888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3904 | Open in IMG/M |
| 3300010048|Ga0126373_11297771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300010358|Ga0126370_12104624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300010360|Ga0126372_10116454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2053 | Open in IMG/M |
| 3300010361|Ga0126378_11579483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 745 | Open in IMG/M |
| 3300010361|Ga0126378_12417964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300010366|Ga0126379_10139776 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
| 3300010376|Ga0126381_102176242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300010376|Ga0126381_103418146 | Not Available | 625 | Open in IMG/M |
| 3300010376|Ga0126381_104651372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300011120|Ga0150983_14444777 | Not Available | 699 | Open in IMG/M |
| 3300012202|Ga0137363_10500545 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300012349|Ga0137387_11059557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300012353|Ga0137367_10523894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300012363|Ga0137390_11243429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300012924|Ga0137413_10832217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300012971|Ga0126369_11482145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 768 | Open in IMG/M |
| 3300012984|Ga0164309_10264757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1220 | Open in IMG/M |
| 3300012989|Ga0164305_10928585 | Not Available | 734 | Open in IMG/M |
| 3300014151|Ga0181539_1217444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 727 | Open in IMG/M |
| 3300014165|Ga0181523_10079558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1986 | Open in IMG/M |
| 3300014199|Ga0181535_10121295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1664 | Open in IMG/M |
| 3300014200|Ga0181526_10678968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300014501|Ga0182024_10018364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 13029 | Open in IMG/M |
| 3300017936|Ga0187821_10027898 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
| 3300017936|Ga0187821_10136296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300017955|Ga0187817_10069959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2182 | Open in IMG/M |
| 3300017970|Ga0187783_11409221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300017972|Ga0187781_10422147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 953 | Open in IMG/M |
| 3300017972|Ga0187781_10622633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300017995|Ga0187816_10035807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2034 | Open in IMG/M |
| 3300017995|Ga0187816_10041967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1891 | Open in IMG/M |
| 3300018007|Ga0187805_10147573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1070 | Open in IMG/M |
| 3300018019|Ga0187874_10210879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300018019|Ga0187874_10385607 | Not Available | 566 | Open in IMG/M |
| 3300018057|Ga0187858_10616503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300018085|Ga0187772_10256669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1189 | Open in IMG/M |
| 3300018085|Ga0187772_11155236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300018085|Ga0187772_11207344 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300018086|Ga0187769_10860738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300018090|Ga0187770_11284067 | Not Available | 593 | Open in IMG/M |
| 3300018090|Ga0187770_11608391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300018090|Ga0187770_11809828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300019278|Ga0187800_1760937 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300019786|Ga0182025_1362332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1959 | Open in IMG/M |
| 3300020021|Ga0193726_1134763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300020579|Ga0210407_10907795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300021046|Ga0215015_10377255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300021170|Ga0210400_10038893 | All Organisms → cellular organisms → Bacteria | 3691 | Open in IMG/M |
| 3300021180|Ga0210396_10055485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3623 | Open in IMG/M |
| 3300021181|Ga0210388_10111395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2351 | Open in IMG/M |
| 3300021181|Ga0210388_10249542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1557 | Open in IMG/M |
| 3300021402|Ga0210385_10072803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2344 | Open in IMG/M |
| 3300021404|Ga0210389_11050321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300021406|Ga0210386_11253482 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300021407|Ga0210383_10978137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300021420|Ga0210394_10666175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300021477|Ga0210398_10011445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7852 | Open in IMG/M |
| 3300024123|Ga0228600_1013780 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300024271|Ga0224564_1023365 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300024271|Ga0224564_1109001 | Not Available | 564 | Open in IMG/M |
| 3300025412|Ga0208194_1025702 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300025434|Ga0208690_1051131 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300025612|Ga0208691_1084491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300025906|Ga0207699_10937478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300026984|Ga0208732_1007289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 882 | Open in IMG/M |
| 3300027109|Ga0208603_1013234 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300027570|Ga0208043_1105711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300027575|Ga0209525_1007478 | All Organisms → cellular organisms → Bacteria | 2562 | Open in IMG/M |
| 3300027576|Ga0209003_1014846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1213 | Open in IMG/M |
| 3300027590|Ga0209116_1037312 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300027660|Ga0209736_1161283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300027667|Ga0209009_1169840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300027676|Ga0209333_1108643 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300027765|Ga0209073_10397987 | Not Available | 564 | Open in IMG/M |
| 3300027783|Ga0209448_10293600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300027842|Ga0209580_10446467 | Not Available | 645 | Open in IMG/M |
| 3300027853|Ga0209274_10096311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1455 | Open in IMG/M |
| 3300027867|Ga0209167_10049438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2062 | Open in IMG/M |
| 3300027879|Ga0209169_10232235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 966 | Open in IMG/M |
| 3300027879|Ga0209169_10377710 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300027884|Ga0209275_10098389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1493 | Open in IMG/M |
| 3300027889|Ga0209380_10224046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300027898|Ga0209067_10580061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300027898|Ga0209067_10684783 | Not Available | 593 | Open in IMG/M |
| 3300027905|Ga0209415_10603902 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300027908|Ga0209006_10025763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5325 | Open in IMG/M |
| 3300027911|Ga0209698_10245983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300028788|Ga0302189_10404386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300028806|Ga0302221_10463188 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300028882|Ga0302154_10626834 | Not Available | 505 | Open in IMG/M |
| 3300029922|Ga0311363_10045681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6916 | Open in IMG/M |
| 3300030007|Ga0311338_10907825 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300030007|Ga0311338_11734732 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300030043|Ga0302306_10017046 | All Organisms → cellular organisms → Bacteria | 3054 | Open in IMG/M |
| 3300030056|Ga0302181_10404346 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300030503|Ga0311370_10273625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2206 | Open in IMG/M |
| 3300030509|Ga0302183_10118653 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300030524|Ga0311357_11768533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300030813|Ga0265750_1070713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300031128|Ga0170823_15482959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300031198|Ga0307500_10304228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300031233|Ga0302307_10017955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3998 | Open in IMG/M |
| 3300031249|Ga0265339_10261070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300031258|Ga0302318_10021878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2232 | Open in IMG/M |
| 3300031258|Ga0302318_10423076 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031572|Ga0318515_10682256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300031708|Ga0310686_100396278 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300031708|Ga0310686_107391072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1663 | Open in IMG/M |
| 3300031718|Ga0307474_10861034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300031753|Ga0307477_10409007 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300031754|Ga0307475_10791440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 753 | Open in IMG/M |
| 3300031823|Ga0307478_11055286 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300031823|Ga0307478_11424074 | Not Available | 575 | Open in IMG/M |
| 3300031910|Ga0306923_12510717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300031946|Ga0310910_10549203 | Not Available | 917 | Open in IMG/M |
| 3300031962|Ga0307479_10005985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11147 | Open in IMG/M |
| 3300031962|Ga0307479_11392257 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300032515|Ga0348332_13137005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2328 | Open in IMG/M |
| 3300032896|Ga0335075_11404342 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300033412|Ga0310810_10629276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1021 | Open in IMG/M |
| 3300033829|Ga0334854_156820 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300034163|Ga0370515_0188841 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.24% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.58% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.95% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.95% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.29% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.29% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.63% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.97% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.32% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.32% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.66% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.66% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.66% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.66% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.66% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.66% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000650 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1 | Environmental | Open in IMG/M |
| 3300001087 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 | Environmental | Open in IMG/M |
| 3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Host-Associated | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100031901 | 3300000567 | Peatlands Soil | AGIAGGVAWALLKHGPELKLEVGTSIEMEIQRDIPVDMSRTQVASARP* |
| JGI12270J11330_102555402 | 3300000567 | Peatlands Soil | AGIAWALLKRGNDVKLDVGTSIEMEIQRPISVDANRIQVAKATP* |
| AP72_2010_repI_A01DRAFT_10183213 | 3300000579 | Forest Soil | GGLAGLAGGVAWALLKHGPEVKLEVGTSLEMQIQRDVKIDASRIEVARAQ* |
| AP72_2010_repI_A1DRAFT_10250141 | 3300000650 | Forest Soil | GGYNGARIGGLAGLAGGVAWALLKHGPEVKLEVGTSLEMQIQRDVKIDASRIEVARAQ* |
| JGI12677J13195_10092592 | 3300001087 | Forest Soil | GIGWALLKRGNDVKLDVGTSIEMEIQRPITVDASRIAVAKATP* |
| JGI12649J13570_10179992 | 3300001175 | Forest Soil | RGPDVKLDVGTSIEMEIQRPITVDASRISVAKATP* |
| JGI12712J15308_100736583 | 3300001471 | Forest Soil | ALLKRGPDVKLDVGTSIEMEIQRDVPVDSSRIQLARVGS* |
| Ga0062386_1004494872 | 3300004152 | Bog Forest Soil | AAGVAWALLKHGPELKLDVGTSLEMEVQRDIVVDMSRVQVARAQ* |
| Ga0062386_1013024401 | 3300004152 | Bog Forest Soil | AWALLKRGADVKLEVGTSIEMEIQRPVTVDATRIAVAKAAP* |
| Ga0070709_114366272 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GGLAGMAGGVAWALLKHGPELKLDVGTSLEMEVQRDIPVDASRIQVAKAGS* |
| Ga0070708_1017717701 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | IAWALLKRGSDVKLDVGTSIEMEIQRPITVDASRIQVARVAH* |
| Ga0070735_102019031 | 3300005534 | Surface Soil | YGGLLGIAGGVAWALLKHGPDVKLEVGTSLEMEIQRSITVDASRIQVAKATQ* |
| Ga0070733_100494161 | 3300005541 | Surface Soil | GLAGGVAWALLKHGPELKLEVGTSIEMEIQRDVPIDMSRIQVARAQ* |
| Ga0070733_111744271 | 3300005541 | Surface Soil | YGGLIGIAGGVAWALLKHGPEVKLEVGTSIEMEIQRAITVDASRIQVAKAGS* |
| Ga0075285_10004051 | 3300005890 | Rice Paddy Soil | GGVAWALLKHGPDVKLAAGTSLEMEIQRDVPVDAARIQGVRAGS* |
| Ga0070766_100810861 | 3300005921 | Soil | WALLKRGNDVRLDVGTSIEMEIQRGITVDGSRIAVARAGP* |
| Ga0066790_100173386 | 3300005995 | Soil | LLKHGPEVKLEAGTSLEMEIQRSISVDASRIQVARAAQ* |
| Ga0070717_120232792 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IAGGVAWALLKHGPEVKLEVGTSIEMEIQRSISVDATRIQVARAAQ* |
| Ga0075017_1006379181 | 3300006059 | Watersheds | VAWALLKHGPELRLDVGTSIEMEIQRDIAVDSSRIQMAKVGS* |
| Ga0075019_102657471 | 3300006086 | Watersheds | GIGAAAGIAWALLKRGPDVRLEAGTSIEMEVQRDINVDASRIHMARVMQ* |
| Ga0075030_1014242742 | 3300006162 | Watersheds | GLIGLAGGVAWALLKHGPDVKLDVGTSIEMEIQRPIPVDMSRVQVAKAGS* |
| Ga0079220_107360222 | 3300006806 | Agricultural Soil | AGTAIALLSRGSDVRLDTGTSIEMIFQRPITLDEARVQAAAK* |
| Ga0073928_101839513 | 3300006893 | Iron-Sulfur Acid Spring | GIAWALLKRGSDVKLEVGTSTEMEILRPVAVDATRIAVAKAGQ* |
| Ga0116225_15505092 | 3300009524 | Peatlands Soil | AWALLKHGPDVKLDVGTSIEMEIQRPIPVDASRIQVAKVTQ* |
| Ga0105237_115233561 | 3300009545 | Corn Rhizosphere | QGPNVKLEVGTSLEMEIQRDVPVDATRIHLARAGS* |
| Ga0116133_10409113 | 3300009623 | Peatland | IGWALLKRGSDVRLDVGTSIEMEIQRPITVDASRIAVAKATP* |
| Ga0116125_11614121 | 3300009628 | Peatland | GVAWALLKHGPDVKLDVGTSIEMEIQRDVPIDANRIQIARAGS* |
| Ga0116217_102006393 | 3300009700 | Peatlands Soil | ALLKRGADVKLEVGTSIEMEIQRPITVDATRIAVAKATP* |
| Ga0116101_11317151 | 3300009759 | Peatland | LGDDVKLEVGTSIEMEIQRAITVDATRIAVAKAGS* |
| Ga0126373_100448885 | 3300010048 | Tropical Forest Soil | GVAWALLKHGPEVKLEVGTSIEMQIQRDVKIDASRIQLAKAQ* |
| Ga0126373_112977712 | 3300010048 | Tropical Forest Soil | AGIAGGVAWALLKHGPEVKLDVGTSIEMEIQRDVKIDATRIQVAKAQ* |
| Ga0126370_121046242 | 3300010358 | Tropical Forest Soil | VAWALLKHGAEVKLDVGTSIEMEIQRDVSIDATRIQVARAGS* |
| Ga0126372_101164541 | 3300010360 | Tropical Forest Soil | AGIAGGVAWALLKHGPEVRLEVGTSIEMQIQRDVKVDANRIQVARAQ* |
| Ga0126378_115794832 | 3300010361 | Tropical Forest Soil | LLKHGPDVKLDVGTSIEMEIQRAVTVDASRIQVAKAQ* |
| Ga0126378_124179642 | 3300010361 | Tropical Forest Soil | AGGLATGGLNGARAGAGMGAAAGIAWALLKHGPDVKLDVGTSIEMEVQRAIAVDASRI* |
| Ga0126379_101397761 | 3300010366 | Tropical Forest Soil | LLKHGPEVKLEVGTSLEMEIQRDVQVDASRIQVAKAQ* |
| Ga0126381_1021762421 | 3300010376 | Tropical Forest Soil | AGAAAGGFNGARYGGLAGIAGGVAWALLKHGPEVKLEVGTSIEMQIQRDVKVDASRIQLAKAQ* |
| Ga0126381_1034181461 | 3300010376 | Tropical Forest Soil | AWALLKHGPEVKLDVGTSIEMEIQRDVSIDATRIQVVRAGS* |
| Ga0126381_1046513721 | 3300010376 | Tropical Forest Soil | NGARYGGLAGIAGGVAWALLKHGPEVKLDVGTSIEMEIQRNVPIDATRIHVALQLNPGI* |
| Ga0150983_144447772 | 3300011120 | Forest Soil | AWALLKHGPEVKLPVGTSIEMEIQRDVKVDASRIQMAKAQ* |
| Ga0137363_105005451 | 3300012202 | Vadose Zone Soil | KRGADVKLDVGTSIEMEIQRAITVDAARIAVAKAGP* |
| Ga0137387_110595572 | 3300012349 | Vadose Zone Soil | GGAAWGLLKHGPDVKLEVGTSIEMEIQRSISVDPTRIHVARVGQ* |
| Ga0137367_105238942 | 3300012353 | Vadose Zone Soil | KHGTDAKLDVGTSIEMEIQRDVQVDSSRIQVAKAR* |
| Ga0137390_112434292 | 3300012363 | Vadose Zone Soil | GGLAGLAGGVAWALLKHGPEVKLQVGTSIEMEIQRSISVDASRIQVARAAQ* |
| Ga0137413_108322171 | 3300012924 | Vadose Zone Soil | LNGARYGGLAGLAGGVAWALLKHGPELKLEVGTSLEMEVQRDIPVDANRIQVAKAGS* |
| Ga0126369_114821451 | 3300012971 | Tropical Forest Soil | AWALLKHGPDVKLDVGTSIEMEIQRAVTVDASRIQVARAP* |
| Ga0164309_102647571 | 3300012984 | Soil | GGLAGLAGGAALALLKHSPDVKLDVGTSIEMEIQREIKVDASRIQVARAP* |
| Ga0164305_109285852 | 3300012989 | Soil | ALLKHGPEVKLEVGTSLEMEIQRDVKVDASRIQMAKAQ* |
| Ga0181539_12174442 | 3300014151 | Bog | GAAAGIAWALLKHGPDVKLEVGTSIEMEIQRDIPVDMSRTQVASARP* |
| Ga0181523_100795583 | 3300014165 | Bog | AAGVAWALLKRGADVRLEVGTSIQMEVQRPITIDASRISTARATP* |
| Ga0181535_101212953 | 3300014199 | Bog | GGVAWALLKHGPDVKLDVGTSIEMEIQRSIPVDASRIQVARAGS* |
| Ga0181526_106789681 | 3300014200 | Bog | KHGPDVKLDVGTSIEMEVQRPITVDASRIQVARAGS* |
| Ga0182024_1001836414 | 3300014501 | Permafrost | LAGGVAWALLKHGPDVKLGVGTSIEMEIQRAIPVDASRIQVAKAAR* |
| Ga0187821_100278983 | 3300017936 | Freshwater Sediment | MLTRGSDVRLETGTAIEMVFQRAITVDPSRISAAAK |
| Ga0187821_101362963 | 3300017936 | Freshwater Sediment | AWALLKHGPDVKLDVGTSLEMEIQRAVPVDASRIQVAKAGS |
| Ga0187817_100699594 | 3300017955 | Freshwater Sediment | VAWALLKHSPEVKLEVGTSLEMEIQRPIAVDASRIQVARAGQ |
| Ga0187783_114092212 | 3300017970 | Tropical Peatland | LKHGPEVKLDVGTSIEMEIQRDVPIDATRIQVARAGS |
| Ga0187781_104221472 | 3300017972 | Tropical Peatland | GGLNGARYGGLAGIAGGVAWALLKHGPDVKLDVGTSIEMEVQRDIPVDMSRVQVAKAQ |
| Ga0187781_106226331 | 3300017972 | Tropical Peatland | GGLNGARAAGLAGLVGGVAWALLKHGPELKLDVGTSIEMEVQRDIPVDMSRIQVAKAQ |
| Ga0187816_100358073 | 3300017995 | Freshwater Sediment | LKHGPDVKLDIGTSIEMVIQRDVRVDGSRIQVARAQ |
| Ga0187816_100419671 | 3300017995 | Freshwater Sediment | AWALLKHGPEVRLDVGTSIEMEIQRDITVDATRIQVAKAGS |
| Ga0187805_101475731 | 3300018007 | Freshwater Sediment | LAGIAGGVAWALLKHGPELKLEVGTSIEMEIQRSITVDASRIQVAKAR |
| Ga0187874_102108792 | 3300018019 | Peatland | GIAGGVAWALLKHGPDVKLDVGTSIEMEIQRSIPVDASRIQVARAGS |
| Ga0187874_103856072 | 3300018019 | Peatland | AAGIAWALLKHGPDVKLEVGTSIEMEIQRDIPVDMSRTQVASARP |
| Ga0187858_106165031 | 3300018057 | Peatland | KHGPDVKLEVGTSIEMEIQRPISVDASRIQVARAAR |
| Ga0187772_102566692 | 3300018085 | Tropical Peatland | WALLKHGPDVKLDVGTSIEMEVQRDIPVDMSRVQVAKAQ |
| Ga0187772_111552362 | 3300018085 | Tropical Peatland | IAWALLKRGPDVKLEVGTSIEMEIQRPITVDGSRITVAKAGS |
| Ga0187772_112073442 | 3300018085 | Tropical Peatland | TGVAWALLRHGPDVRLEVGTSIEMEIQRDIPVDTSRFQTVRAGG |
| Ga0187769_108607382 | 3300018086 | Tropical Peatland | GARIGGAAGLAAGVAWALLKHGPELKLDVGTSIEMEVQRDIPVDMSRVQVAKAQ |
| Ga0187770_112840672 | 3300018090 | Tropical Peatland | AWALLKHGPELKLDVGTSLEMEVQRDIPVDMSRIQVAGAQ |
| Ga0187770_116083911 | 3300018090 | Tropical Peatland | HGPELKLDVGTSLEMEVQRDIPVDMSRVQVAKANP |
| Ga0187770_118098281 | 3300018090 | Tropical Peatland | IGGAAGLAAGVAWALLKHGPELKLDVGTSIEMEVQRDIPVDMSRIQVAKAQ |
| Ga0187800_17609372 | 3300019278 | Peatland | LLKRSDVKLDVGTSIEMEVQRPIQIDPARIAVAKAMP |
| Ga0182025_13623321 | 3300019786 | Permafrost | WALLKRGADVKLDVGTSIEMEIQRPITVDATRISVAKATP |
| Ga0193726_11347631 | 3300020021 | Soil | YGGLAGLAGGVAWGLLKHGPDVKLEVGTSIEMEVQRAIQVDASRIQVARAAQ |
| Ga0210407_109077952 | 3300020579 | Soil | LLKHGPDVKLEVGTSLEMEIQRSITVDASRIQVAKAGS |
| Ga0215015_103772551 | 3300021046 | Soil | MCIRDSAWALLKRGSDVRLDVGTSVEMEIQRAITVDASRIQMARAAP |
| Ga0210400_100388931 | 3300021170 | Soil | LLKRGNDVKLDVGTSIEMEIQRAITVDARRIAVARAAP |
| Ga0210396_100554851 | 3300021180 | Soil | RGGGRAGIAGGVAWALLKHGPEVKLEVGTSLEMEIQRPIPVDGSRIQVARAAQ |
| Ga0210388_101113954 | 3300021181 | Soil | AWALLKHGPDVKLDVGTSLEMEIQRSIPVDASRIQVARATQ |
| Ga0210388_102495421 | 3300021181 | Soil | WALLKRGSDVRLDVGTSIEMEIQREIPLDGTRIALAKATP |
| Ga0210385_100728031 | 3300021402 | Soil | GVAWALLKHGPDVKLDVGTSLEMEIQRSIPVDASRIQVAKAGS |
| Ga0210389_110503212 | 3300021404 | Soil | GWALLKRGNDVRLDVGSSIEMEIQREIAVDGTRIAVAKAGQ |
| Ga0210386_112534822 | 3300021406 | Soil | LLKRGADVRLEVGTSIQMEVQRSITVDANRVSMARATP |
| Ga0210383_109781372 | 3300021407 | Soil | WALLKHGPEVKLEVGTSLEMEIQRPIPVDGSRIQVARVAQ |
| Ga0210394_106661751 | 3300021420 | Soil | VAWALLKHGPEVKLEVGTSLEMEIQRPIPVDGSRIQVARAAQ |
| Ga0210398_100114451 | 3300021477 | Soil | LLKRGSDVRLDVGTSIEMEIQREIPLDGTRIALAKATP |
| Ga0228600_10137801 | 3300024123 | Roots | VAWALLKRGPDVKLEVGTSIEMEIQRPITLDATRIAVAKATP |
| Ga0224564_10233651 | 3300024271 | Soil | RGNDVKLDVGTSIEMEIQRPVIVDSNRIAVAKATP |
| Ga0224564_11090012 | 3300024271 | Soil | NGARVGAGLGAAAGVAWALLKHGPDVRLGVGTSIEMQIQREIPVDASRIQFAKAGS |
| Ga0208194_10257022 | 3300025412 | Peatland | IGWALLKRGSDVRLDVGTSIEMEIQRPITVDASRIAVAKATP |
| Ga0208690_10511311 | 3300025434 | Peatland | LLKRGSDVKLDVGTSIEMEIQRPITVDASRIAVAKATP |
| Ga0208691_10844912 | 3300025612 | Peatland | WALLKHGPDVKLDVGTSIEMEVQRPITVDASRIQVARAGS |
| Ga0207699_109374781 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | KHGPELKLDVGTSLEMEVQRDIPVDASRIQVAKAGS |
| Ga0208732_10072891 | 3300026984 | Forest Soil | YGGLAGIAGGVAWALLKHGPEVKLPVGTSIEMEIQRDVKVDASRIQMAKAQ |
| Ga0208603_10132341 | 3300027109 | Forest Soil | WALLKRGNDVKLEVGTSIEMEIQRPVVVDAKRIAVAKAGP |
| Ga0208043_11057113 | 3300027570 | Peatlands Soil | LKRGNDVKLDVGTSIEMEIQRPISVDANRIQVAKATP |
| Ga0209525_10074783 | 3300027575 | Forest Soil | RGNDVKLEVGTSIEMEIQREIPLDGTRIALAKATP |
| Ga0209003_10148463 | 3300027576 | Forest Soil | HGPDVKLDVGTSIEMEIQRPISVDASRIQLARAAR |
| Ga0209116_10373121 | 3300027590 | Forest Soil | AWALLKRGPDVKLDVGTSIEMEIQRPITVDASRISVAKATP |
| Ga0209736_11612831 | 3300027660 | Forest Soil | YGGLAGIAGGVAWALLKHGPDVKLPVGTSIEMEIQRPISVDASRIQVARAAH |
| Ga0209009_11698402 | 3300027667 | Forest Soil | ALLKHGPDVKLPVGTSIEMEIQRPISVDASRIQVARAAH |
| Ga0209333_11086431 | 3300027676 | Forest Soil | KRGNDVKLDVGTSIEMEIQRPITVDATRIAMAKATP |
| Ga0209073_103979872 | 3300027765 | Agricultural Soil | AGTAIALLSRGSDVRLDTGTSIEMIFQRPITLDEARVQAAAK |
| Ga0209448_102936002 | 3300027783 | Bog Forest Soil | LKHGPDVRLGVGTSIEMEIQREIPVDARWIQMARAAP |
| Ga0209580_104464672 | 3300027842 | Surface Soil | IAGGVAWALLKHGPEVKLPVGTSIEMEIQRDVKVDASRIQMAKAQ |
| Ga0209274_100963111 | 3300027853 | Soil | LKRGSDVRLDVGTSIEMEIQREIPLDGTRIALAKATP |
| Ga0209167_100494383 | 3300027867 | Surface Soil | GLAGGVAWALLKHGPELKLEVGTSIEMEIQRDVPIDMSRIQVARAQ |
| Ga0209169_102322351 | 3300027879 | Soil | LKRGNDVRLDVGTSIEMEIQRGITVDASRIAVAKATP |
| Ga0209169_103777102 | 3300027879 | Soil | ALLRRGSDVKLDVGTSIEMEIQRPITVDASRIAMARATP |
| Ga0209275_100983892 | 3300027884 | Soil | GIAWALLKRGNDVKLEVGTSIEMEIQREIPLDGTRIALAKATQ |
| Ga0209380_102240461 | 3300027889 | Soil | GVAWALLKHGPEVKLEVGTSIEMEIQRAVPVDASRIQVARAGS |
| Ga0209067_105800612 | 3300027898 | Watersheds | GVAWALLKHGPDVKLDVGTSIEMEIQRPIPVDMSRVQVAKAGS |
| Ga0209067_106847832 | 3300027898 | Watersheds | LKHGPEVKLPVGTSIEMEIQRDVKVDASRIQMAKAQ |
| Ga0209415_106039021 | 3300027905 | Peatlands Soil | RGSDVKLDVGTSIEMEIQRPITVDASRIAVAKATP |
| Ga0209006_100257637 | 3300027908 | Forest Soil | WALLKRGPDVKLDVGTSIEMEIQRDVPVDSSRIQLARVGS |
| Ga0209698_102459833 | 3300027911 | Watersheds | GLIGLAGGVAWALLKHGPDVKLDVGTSIEMEIQRPIPVDMSRVQVAKAGS |
| Ga0302189_104043861 | 3300028788 | Bog | AVAWTMLKRGSDVKLDVGTSIEMEIQRPVTVDSSRITVAKATP |
| Ga0302221_104631882 | 3300028806 | Palsa | KRGNDVRLDVGTSIEMEIQRPITVDASRIAVAKATP |
| Ga0302154_106268342 | 3300028882 | Bog | GDDVKLDMGTSIEMEIQRAITVDAGRISVAKVSGQ |
| Ga0311363_100456811 | 3300029922 | Fen | GDDVKLDVGTSIEMEIQRAITVDAGRISVAKVSGQ |
| Ga0311338_109078252 | 3300030007 | Palsa | AAGIAWALLKRGNDVKLDVGTSIEMEIQRPITVDATRIAMAKATP |
| Ga0311338_117347321 | 3300030007 | Palsa | IGWALLKRGNDVRLDVGTSIEMEIQRPITVDTSRISLAKANP |
| Ga0302306_100170464 | 3300030043 | Palsa | LKRGSDVKLDVGTSIEMEIQRAITVDASRIAVAKVTP |
| Ga0302181_104043461 | 3300030056 | Palsa | AWALLKRGNDVRLDVGTSIEMEIQRPITVDASRIAVAKATP |
| Ga0311370_102736253 | 3300030503 | Palsa | SLGGLAAGGLNGARYGGLAGLAGGVAWALLKHGPELKLDVGTSLEMEVQRAIPVDATRIQVAKAGS |
| Ga0302183_101186532 | 3300030509 | Palsa | RGNDVKLDVGTSIEMEIQRPITVDATRIAMAKATP |
| Ga0311357_117685332 | 3300030524 | Palsa | HGPELKLEVGTSIEMEIQRDVIVDASRIQLAKAGS |
| Ga0265750_10707131 | 3300030813 | Soil | IAWALLKRGSDVRLDVGTSIEMEIQRDVPLDSSRLTLARAAP |
| Ga0170823_154829592 | 3300031128 | Forest Soil | LKHGPEVKLEVGTSIEMEIQRSISVDASRIQVAKATQ |
| Ga0307500_103042281 | 3300031198 | Soil | WALLKHGPEVKLQVGTSLEMEIQRDVKVDASRIQMAKAQ |
| Ga0302307_100179551 | 3300031233 | Palsa | LKHGPDVKLEVGTSIEMEIQRPITVDASRIQVARAGS |
| Ga0265339_102610702 | 3300031249 | Rhizosphere | AAGGLNGARYGGLAGLAGGVAWGLLKHGPDVKLEVGTSIEMEVQRAIQVDASRIQMARAA |
| Ga0302318_100218781 | 3300031258 | Bog | GWALLKRGNDVKLDVGTSIEMEIQRSITVDASRIAVAKATP |
| Ga0302318_104230761 | 3300031258 | Bog | KRGDDVKLDVGTSIEMEIQRAITVDAGRISVAKVSGQ |
| Ga0318515_106822561 | 3300031572 | Soil | GYNGARIGGLAGIAGGVAWALLKHGPEVRLEVGTSIEMQIQRDVKVDASRIQVAKAQ |
| Ga0310686_1003962782 | 3300031708 | Soil | GIGWALLKRGNDVKLDVGTSIEMEIQRPITVDASRIAVAKATP |
| Ga0310686_1073910723 | 3300031708 | Soil | KRGSDVKLDVGTSIEMEIQRPITVDTTRIVMARAGP |
| Ga0307474_108610342 | 3300031718 | Hardwood Forest Soil | RYGGLAGIAGGVAWALLKHGPEVKLDVGTSIEMEIQRSISVDASRIQVARAAQ |
| Ga0307477_104090073 | 3300031753 | Hardwood Forest Soil | GGVAWALLKHGPDVKLPVGTSIEMEIQRPISVDASRIQMARAAH |
| Ga0307475_107914401 | 3300031754 | Hardwood Forest Soil | LAGIAGGVAWALLKHGPEVKLPVGTSIEMEIQRDVKVDASRIQMAKAQ |
| Ga0307478_110552862 | 3300031823 | Hardwood Forest Soil | AGIGWALLKRGNDVKLDVGTSIEMEIQRPITVDASRIAVAKATP |
| Ga0307478_114240741 | 3300031823 | Hardwood Forest Soil | LKHGPELKLDVGTSIEMEIQRSITVDASRIQVAKAQ |
| Ga0306923_125107171 | 3300031910 | Soil | GGLNGARFGGLAGVAGGVAWALLKHGPEVKLEVGTSIEMQIQRDVKIDASRIQLARAQ |
| Ga0310910_105492032 | 3300031946 | Soil | WALLKHGPEVKLEVGTSIEMEIQRDVKVDSTRIQVARTQ |
| Ga0307479_100059851 | 3300031962 | Hardwood Forest Soil | LRRGADVKLDVGTSIEMEIQRAITVDGSRIALARVGH |
| Ga0307479_113922571 | 3300031962 | Hardwood Forest Soil | WALLKRGNDVRLDVGTSIEMEIQRAITVDGSRIAVTKAAP |
| Ga0348332_131370051 | 3300032515 | Plant Litter | RGNDVKLDVGTSIEMEIQRPITVDASRIAVARATP |
| Ga0335075_114043421 | 3300032896 | Soil | LKRGNDVRLDVGTSIEMEIQRDVPLDANRLTVARAGP |
| Ga0310810_106292762 | 3300033412 | Soil | GLAGGVAWALLKHGPDVKLEVGTSLEMEIQRDVPVDATRIHVARAGS |
| Ga0334854_156820_412_552 | 3300033829 | Soil | AAAGIAWALLKRGNDVRLDVGTSIEMEIQREIPLDRTRITLARATP |
| Ga0370515_0188841_741_878 | 3300034163 | Untreated Peat Soil | AAGIAWALLKRGPDVKLDVGTSIEMEIQRPVTVDTTRIALAKAAP |
| ⦗Top⦘ |