| Basic Information | |
|---|---|
| Family ID | F045593 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MATTLLDYRAMMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 58.55 % |
| % of genes near scaffold ends (potentially truncated) | 29.61 % |
| % of genes from short scaffolds (< 2000 bps) | 75.00 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.263 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.474 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (40.132 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF07077 | DUF1345 | 6.58 |
| PF08450 | SGL | 2.63 |
| PF11225 | DUF3024 | 2.63 |
| PF04430 | DUF498 | 1.97 |
| PF01522 | Polysacc_deac_1 | 1.97 |
| PF13344 | Hydrolase_6 | 1.97 |
| PF06772 | LtrA | 1.32 |
| PF01425 | Amidase | 1.32 |
| PF07690 | MFS_1 | 1.32 |
| PF13683 | rve_3 | 1.32 |
| PF00239 | Resolvase | 1.32 |
| PF00589 | Phage_integrase | 1.32 |
| PF13565 | HTH_32 | 1.32 |
| PF02469 | Fasciclin | 1.32 |
| PF13185 | GAF_2 | 1.32 |
| PF08281 | Sigma70_r4_2 | 1.32 |
| PF02927 | CelD_N | 1.32 |
| PF01740 | STAS | 0.66 |
| PF00211 | Guanylate_cyc | 0.66 |
| PF12728 | HTH_17 | 0.66 |
| PF03405 | FA_desaturase_2 | 0.66 |
| PF00313 | CSD | 0.66 |
| PF13546 | DDE_5 | 0.66 |
| PF00990 | GGDEF | 0.66 |
| PF13229 | Beta_helix | 0.66 |
| PF10012 | DUF2255 | 0.66 |
| PF12893 | Lumazine_bd_2 | 0.66 |
| PF02899 | Phage_int_SAM_1 | 0.66 |
| PF01068 | DNA_ligase_A_M | 0.66 |
| PF13490 | zf-HC2 | 0.66 |
| PF00561 | Abhydrolase_1 | 0.66 |
| PF02371 | Transposase_20 | 0.66 |
| PF13466 | STAS_2 | 0.66 |
| PF09844 | DUF2071 | 0.66 |
| PF02607 | B12-binding_2 | 0.66 |
| PF06042 | NTP_transf_6 | 0.66 |
| PF14246 | TetR_C_7 | 0.66 |
| PF00353 | HemolysinCabind | 0.66 |
| PF04675 | DNA_ligase_A_N | 0.66 |
| PF00107 | ADH_zinc_N | 0.66 |
| PF13610 | DDE_Tnp_IS240 | 0.66 |
| PF01569 | PAP2 | 0.66 |
| PF04070 | DUF378 | 0.66 |
| PF01037 | AsnC_trans_reg | 0.66 |
| PF07617 | DUF1579 | 0.66 |
| PF04149 | DUF397 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG4291 | Uncharacterized membrane protein | Function unknown [S] | 6.58 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 2.63 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 2.63 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 1.97 |
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 1.97 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 1.97 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.32 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 1.32 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.32 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 1.32 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.32 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.32 |
| COG2155 | Uncharacterized membrane protein YuzA, DUF378 family | Function unknown [S] | 0.66 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.66 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.66 |
| COG3575 | Uncharacterized conserved protein | Function unknown [S] | 0.66 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.66 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.66 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.26 % |
| Unclassified | root | N/A | 44.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig848790 | Not Available | 554 | Open in IMG/M |
| 3300000550|F24TB_10245626 | Not Available | 1641 | Open in IMG/M |
| 3300004463|Ga0063356_102309754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 821 | Open in IMG/M |
| 3300005347|Ga0070668_100174521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1752 | Open in IMG/M |
| 3300005436|Ga0070713_101562511 | Not Available | 640 | Open in IMG/M |
| 3300005562|Ga0058697_10130268 | Not Available | 1078 | Open in IMG/M |
| 3300005563|Ga0068855_101090463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora veneta | 835 | Open in IMG/M |
| 3300005985|Ga0081539_10281558 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300006049|Ga0075417_10175588 | Not Available | 1006 | Open in IMG/M |
| 3300006844|Ga0075428_100632551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1142 | Open in IMG/M |
| 3300007790|Ga0105679_10696950 | Not Available | 1027 | Open in IMG/M |
| 3300009094|Ga0111539_10581413 | Not Available | 1304 | Open in IMG/M |
| 3300009789|Ga0126307_10345627 | Not Available | 1198 | Open in IMG/M |
| 3300009795|Ga0105059_1062945 | Not Available | 519 | Open in IMG/M |
| 3300009799|Ga0105075_1008070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 921 | Open in IMG/M |
| 3300009802|Ga0105073_1066471 | Not Available | 512 | Open in IMG/M |
| 3300009807|Ga0105061_1001013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2882 | Open in IMG/M |
| 3300009807|Ga0105061_1006062 | Not Available | 1453 | Open in IMG/M |
| 3300009808|Ga0105071_1068126 | Not Available | 602 | Open in IMG/M |
| 3300009810|Ga0105088_1000978 | All Organisms → cellular organisms → Bacteria | 3244 | Open in IMG/M |
| 3300009810|Ga0105088_1033745 | Not Available | 833 | Open in IMG/M |
| 3300009811|Ga0105084_1002599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2284 | Open in IMG/M |
| 3300009812|Ga0105067_1014084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1050 | Open in IMG/M |
| 3300009814|Ga0105082_1040172 | Not Available | 768 | Open in IMG/M |
| 3300009815|Ga0105070_1103695 | Not Available | 562 | Open in IMG/M |
| 3300009816|Ga0105076_1022519 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300009816|Ga0105076_1068298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 660 | Open in IMG/M |
| 3300009818|Ga0105072_1018897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1250 | Open in IMG/M |
| 3300009819|Ga0105087_1006346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1498 | Open in IMG/M |
| 3300009820|Ga0105085_1001481 | All Organisms → cellular organisms → Bacteria | 3502 | Open in IMG/M |
| 3300009836|Ga0105068_1024409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1038 | Open in IMG/M |
| 3300009840|Ga0126313_10049744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2951 | Open in IMG/M |
| 3300009840|Ga0126313_10962382 | Not Available | 698 | Open in IMG/M |
| 3300010029|Ga0105074_1044359 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300010037|Ga0126304_11086476 | Not Available | 547 | Open in IMG/M |
| 3300010039|Ga0126309_10840414 | Not Available | 603 | Open in IMG/M |
| 3300010040|Ga0126308_10090587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. URHD0036 | 1857 | Open in IMG/M |
| 3300010041|Ga0126312_10035044 | All Organisms → cellular organisms → Bacteria | 3353 | Open in IMG/M |
| 3300010044|Ga0126310_11118286 | Not Available | 628 | Open in IMG/M |
| 3300010166|Ga0126306_10021940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4224 | Open in IMG/M |
| 3300012199|Ga0137383_10015586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus → unclassified Actinoallomurus → Actinoallomurus sp. ID145698 | 5178 | Open in IMG/M |
| 3300012204|Ga0137374_10041145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4893 | Open in IMG/M |
| 3300012204|Ga0137374_10130189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2292 | Open in IMG/M |
| 3300012204|Ga0137374_10701316 | Not Available | 760 | Open in IMG/M |
| 3300012206|Ga0137380_10987247 | Not Available | 720 | Open in IMG/M |
| 3300012209|Ga0137379_10121182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2515 | Open in IMG/M |
| 3300012353|Ga0137367_10002889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13889 | Open in IMG/M |
| 3300012355|Ga0137369_10013136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 8053 | Open in IMG/M |
| 3300012355|Ga0137369_10140128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1932 | Open in IMG/M |
| 3300012355|Ga0137369_10614856 | Not Available | 754 | Open in IMG/M |
| 3300012355|Ga0137369_10766245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 660 | Open in IMG/M |
| 3300012355|Ga0137369_10772642 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300012358|Ga0137368_10037436 | Not Available | 4287 | Open in IMG/M |
| 3300012358|Ga0137368_10071010 | All Organisms → cellular organisms → Bacteria | 2821 | Open in IMG/M |
| 3300012358|Ga0137368_10511434 | Not Available | 773 | Open in IMG/M |
| 3300012360|Ga0137375_10257057 | Not Available | 1609 | Open in IMG/M |
| 3300012360|Ga0137375_10912513 | Not Available | 697 | Open in IMG/M |
| 3300012937|Ga0162653_100001794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora veneta | 1888 | Open in IMG/M |
| 3300014965|Ga0120193_10048762 | Not Available | 607 | Open in IMG/M |
| 3300015371|Ga0132258_10484910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3088 | Open in IMG/M |
| 3300018027|Ga0184605_10354578 | Not Available | 662 | Open in IMG/M |
| 3300018028|Ga0184608_10111055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora veneta | 1154 | Open in IMG/M |
| 3300018028|Ga0184608_10446934 | Not Available | 557 | Open in IMG/M |
| 3300018031|Ga0184634_10558836 | Not Available | 506 | Open in IMG/M |
| 3300018051|Ga0184620_10087985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora veneta | 941 | Open in IMG/M |
| 3300018052|Ga0184638_1003424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5021 | Open in IMG/M |
| 3300018052|Ga0184638_1048019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1554 | Open in IMG/M |
| 3300018052|Ga0184638_1205618 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300018053|Ga0184626_10032877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 2145 | Open in IMG/M |
| 3300018072|Ga0184635_10036036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora veneta | 1877 | Open in IMG/M |
| 3300018075|Ga0184632_10001058 | All Organisms → cellular organisms → Bacteria | 11138 | Open in IMG/M |
| 3300018075|Ga0184632_10028246 | Not Available | 2389 | Open in IMG/M |
| 3300018078|Ga0184612_10362515 | Not Available | 734 | Open in IMG/M |
| 3300018081|Ga0184625_10441994 | Not Available | 667 | Open in IMG/M |
| 3300018465|Ga0190269_10659953 | Not Available | 721 | Open in IMG/M |
| 3300018466|Ga0190268_10378688 | Not Available | 898 | Open in IMG/M |
| 3300018476|Ga0190274_10049236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3035 | Open in IMG/M |
| 3300018476|Ga0190274_13145822 | Not Available | 555 | Open in IMG/M |
| 3300019279|Ga0184642_1567045 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300019377|Ga0190264_10065366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1543 | Open in IMG/M |
| 3300019377|Ga0190264_10175022 | Not Available | 1146 | Open in IMG/M |
| 3300019867|Ga0193704_1064421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora veneta | 697 | Open in IMG/M |
| 3300021073|Ga0210378_10013898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3325 | Open in IMG/M |
| 3300022195|Ga0222625_1008959 | Not Available | 508 | Open in IMG/M |
| 3300022195|Ga0222625_1121068 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300022195|Ga0222625_1186957 | Not Available | 533 | Open in IMG/M |
| 3300022694|Ga0222623_10016436 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
| 3300022756|Ga0222622_10201629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1320 | Open in IMG/M |
| 3300022756|Ga0222622_11380672 | Not Available | 518 | Open in IMG/M |
| 3300025933|Ga0207706_10014760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7071 | Open in IMG/M |
| 3300027056|Ga0209879_1014747 | Not Available | 1287 | Open in IMG/M |
| 3300027163|Ga0209878_1007210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1603 | Open in IMG/M |
| 3300027209|Ga0209875_1000343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6540 | Open in IMG/M |
| 3300027209|Ga0209875_1002002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2644 | Open in IMG/M |
| 3300027209|Ga0209875_1028569 | Not Available | 666 | Open in IMG/M |
| 3300027277|Ga0209846_1000872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5165 | Open in IMG/M |
| 3300027277|Ga0209846_1002277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3379 | Open in IMG/M |
| 3300027277|Ga0209846_1024908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 969 | Open in IMG/M |
| 3300027324|Ga0209845_1006994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis alba → Nocardiopsis alba ATCC BAA-2165 | 1929 | Open in IMG/M |
| 3300027332|Ga0209861_1028699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 826 | Open in IMG/M |
| 3300027490|Ga0209899_1002783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3976 | Open in IMG/M |
| 3300027490|Ga0209899_1019360 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300027490|Ga0209899_1057453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 795 | Open in IMG/M |
| 3300027561|Ga0209887_1004914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3793 | Open in IMG/M |
| 3300027577|Ga0209874_1020463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1882 | Open in IMG/M |
| 3300027577|Ga0209874_1032692 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300027577|Ga0209874_1037472 | Not Available | 1304 | Open in IMG/M |
| 3300027750|Ga0209461_10104333 | Not Available | 647 | Open in IMG/M |
| 3300027809|Ga0209574_10232757 | Not Available | 603 | Open in IMG/M |
| 3300027873|Ga0209814_10164990 | Not Available | 952 | Open in IMG/M |
| 3300027907|Ga0207428_10449406 | Not Available | 940 | Open in IMG/M |
| 3300027949|Ga0209860_1049481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
| 3300027952|Ga0209889_1055961 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300028707|Ga0307291_1005953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2606 | Open in IMG/M |
| 3300028708|Ga0307295_10036677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1241 | Open in IMG/M |
| 3300028710|Ga0307322_10046578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1052 | Open in IMG/M |
| 3300028711|Ga0307293_10017258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2089 | Open in IMG/M |
| 3300028713|Ga0307303_10053312 | Not Available | 861 | Open in IMG/M |
| 3300028716|Ga0307311_10183618 | Not Available | 610 | Open in IMG/M |
| 3300028716|Ga0307311_10275371 | Not Available | 503 | Open in IMG/M |
| 3300028718|Ga0307307_10134701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
| 3300028719|Ga0307301_10025995 | Not Available | 1735 | Open in IMG/M |
| 3300028721|Ga0307315_10211692 | Not Available | 602 | Open in IMG/M |
| 3300028744|Ga0307318_10023470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1990 | Open in IMG/M |
| 3300028771|Ga0307320_10099341 | Not Available | 1105 | Open in IMG/M |
| 3300028771|Ga0307320_10465959 | Not Available | 510 | Open in IMG/M |
| 3300028787|Ga0307323_10350861 | Not Available | 529 | Open in IMG/M |
| 3300028791|Ga0307290_10129162 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300028796|Ga0307287_10017500 | Not Available | 2466 | Open in IMG/M |
| 3300028809|Ga0247824_10565145 | Not Available | 679 | Open in IMG/M |
| 3300028814|Ga0307302_10065233 | Not Available | 1708 | Open in IMG/M |
| 3300028875|Ga0307289_10194238 | Not Available | 835 | Open in IMG/M |
| 3300028878|Ga0307278_10001592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11254 | Open in IMG/M |
| 3300028878|Ga0307278_10522077 | Not Available | 518 | Open in IMG/M |
| 3300028881|Ga0307277_10184174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 913 | Open in IMG/M |
| 3300028884|Ga0307308_10267983 | Not Available | 818 | Open in IMG/M |
| 3300030514|Ga0268253_10051082 | Not Available | 1086 | Open in IMG/M |
| 3300031114|Ga0308187_10459663 | Not Available | 515 | Open in IMG/M |
| 3300031114|Ga0308187_10460043 | Not Available | 515 | Open in IMG/M |
| 3300031114|Ga0308187_10489250 | Not Available | 504 | Open in IMG/M |
| 3300031548|Ga0307408_100235433 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300031548|Ga0307408_100631180 | Not Available | 955 | Open in IMG/M |
| 3300031852|Ga0307410_11969110 | Not Available | 521 | Open in IMG/M |
| 3300031901|Ga0307406_10002739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9616 | Open in IMG/M |
| 3300031911|Ga0307412_10146804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1735 | Open in IMG/M |
| 3300031995|Ga0307409_100166247 | All Organisms → cellular organisms → Bacteria | 1936 | Open in IMG/M |
| 3300031995|Ga0307409_100627566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1065 | Open in IMG/M |
| 3300032002|Ga0307416_100086110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. URHD0036 | 2677 | Open in IMG/M |
| 3300032002|Ga0307416_100526222 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300032126|Ga0307415_100011485 | All Organisms → cellular organisms → Bacteria | 5072 | Open in IMG/M |
| 3300034172|Ga0334913_004809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3761 | Open in IMG/M |
| 3300034172|Ga0334913_024917 | Not Available | 1317 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 25.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.05% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.18% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 9.21% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 6.58% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.92% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.29% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.29% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.97% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.97% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.32% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.66% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.66% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027949 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_12698180 | 2124908045 | Soil | MATTLLGYHATMAHLHIDDLLREAAAARKVQAARAARRQRGV |
| F24TB_102456263 | 3300000550 | Soil | MAMTLLGYRAMMAEPRSEDLLGKAAAARKVRAARAARRQKGA* |
| Ga0063356_1023097541 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAMTILGYRAMLAELRRDARLRQAAAARKGRAARAARRQKGV* |
| Ga0070668_1001745213 | 3300005347 | Switchgrass Rhizosphere | MAMTILGYRAMLAELRRDARLRQAAAARKGRAARAARRQKEV* |
| Ga0070713_1015625111 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MATMLLDYSTTLAKLHIEDLRREAEAARKVQAARAARRQRG |
| Ga0058697_101302681 | 3300005562 | Agave | MATTLLDYRALMAEFHIDDLRRQARTARKVRAARAARRQKGV* |
| Ga0068855_1010904631 | 3300005563 | Corn Rhizosphere | MAMTILGYRAMLAELRRDARLRQAAAARKGRAARAARRQK |
| Ga0081539_102815583 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MAMTLLGYRAMMAELRSEALLGKAAAARNVRAARAARRQRGA* |
| Ga0075417_101755882 | 3300006049 | Populus Rhizosphere | MAMTLLGYRATMGELRREDLRREAAAARKVRAARATRRQRGV* |
| Ga0075428_1006325513 | 3300006844 | Populus Rhizosphere | MAMMLLGYRAMLAELRRDALRREAAAARKVRAARAARRQRGV* |
| Ga0105679_106969502 | 3300007790 | Soil | MATTLLDYRALMAELHIEGLRREARTAREVRAARAARRQKGV* |
| Ga0111539_105814132 | 3300009094 | Populus Rhizosphere | MAMTLLGYRATMGELRREDLRREAAAAPKVRAARAARRQRGV* |
| Ga0126307_103456272 | 3300009789 | Serpentine Soil | GSEDTKEDTMAMTLLGYRALMAERRRDALRRAAARKVQAARAARRQRGD* |
| Ga0105059_10629451 | 3300009795 | Groundwater Sand | MATTLLDYRAMMGELHIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0105075_10080701 | 3300009799 | Groundwater Sand | MATTLLDYRPMMAALRIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0105073_10664712 | 3300009802 | Groundwater Sand | VVFRKTTKEDTMTSTLLDYRPMMAELHIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0105061_10010132 | 3300009807 | Groundwater Sand | MTTTFLDYRATMSELHIDDLLRDAAAVRKVQAARAARRQRGV* |
| Ga0105061_10060622 | 3300009807 | Groundwater Sand | VVSVKTTKENTMTTTLLDYSAKMAELHVDDLLREAAAARKVQAARAARRQRGV* |
| Ga0105071_10681263 | 3300009808 | Groundwater Sand | VVSVKITKEATMATTLLYYHAIMAELRIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0105088_10009783 | 3300009810 | Groundwater Sand | VVSVKTTKEDTMTTTLLDYSAKMAELHVDDLLREAAAARKVQAARAARRQRRI* |
| Ga0105088_10337451 | 3300009810 | Groundwater Sand | VVSVKTTKEDTMTSTLLDYRLMMAELHIDDLLCEAAAACKVQAARAARRQRGV* |
| Ga0105084_10025992 | 3300009811 | Groundwater Sand | VVSVKTTKENTMTTTLLDYSAKMAELHVDDLLREAAAARKVQAARAARRQRRI* |
| Ga0105067_10140842 | 3300009812 | Groundwater Sand | MATTLLDYRATMAELHIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0105082_10401722 | 3300009814 | Groundwater Sand | MTSTLLDYRPMMAELHIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0105070_11036951 | 3300009815 | Groundwater Sand | MTTTLLDYHATMAQLHIDDLLREAAAARKVQAARAA |
| Ga0105076_10225192 | 3300009816 | Groundwater Sand | MTTTFLDYRATMSELHIDDLLRDAAAARKVQAARAARRQRGV* |
| Ga0105076_10682983 | 3300009816 | Groundwater Sand | VKTTKEATMATTLLDHHAMMAQLHVDELLREAAAARKVQAARAARRLRGV* |
| Ga0105072_10188973 | 3300009818 | Groundwater Sand | VVSVKTTKEATMATTLLDHHAMMAQLHVDELLREAAAARKVQAARAARRQRGV* |
| Ga0105087_10063462 | 3300009819 | Groundwater Sand | VVFRKTTKEDTMATTLLDYRATMAELHIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0105085_10014811 | 3300009820 | Groundwater Sand | VVSVKTTKEDTMTTTLLDYSAKMAELHVDDLLREAAAARKVQAARAARRQRGV* |
| Ga0105068_10244092 | 3300009836 | Groundwater Sand | VKTTKEATMATTLLDHHAMMAQLHVDELLREAAAARKVQAARAARRQRGV* |
| Ga0126313_100497442 | 3300009840 | Serpentine Soil | MAMTLLGYRALMAERRRDALRRAAARKVQAARAARRQRGD* |
| Ga0126313_109623822 | 3300009840 | Serpentine Soil | MATTLLDYRPMMAELHIDDLLRKAAAARKAQAARAARRQRGV* |
| Ga0105074_10443591 | 3300010029 | Groundwater Sand | RATMAELHIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0126304_110864761 | 3300010037 | Serpentine Soil | TLLDYPAKMAELHIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0126309_108404141 | 3300010039 | Serpentine Soil | VVSVKTTKEDTMATTLLDYPAMMAELHIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0126308_100905873 | 3300010040 | Serpentine Soil | MAMTLLGYRAIMAELRREELLRRAAATRRLRAVRAGRRQRGV* |
| Ga0126312_100350442 | 3300010041 | Serpentine Soil | VVSVKTTKEDTMATTLLDYPAMMAELHIDDLLREATAARKVQAARAARRQRGV* |
| Ga0126310_111182862 | 3300010044 | Serpentine Soil | SDDTKEDTMAMTLLGYRAMMAELRREELLRRAAATRRLRAVRAGRRQRGV* |
| Ga0126306_100219402 | 3300010166 | Serpentine Soil | VVSVKTTKEDTMTTTLLDYPAKMAELHIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0137383_100155867 | 3300012199 | Vadose Zone Soil | MSVKTAKGDTMATMLLDYSTTLAKLHIEDLRREAEAARKVQAARAARRQRGV* |
| Ga0137374_100411454 | 3300012204 | Vadose Zone Soil | MSVKTAKEDTMATMLLGYGTTLAELHIEDLHREAEAARKARAARQAARVARRQRGV* |
| Ga0137374_101301893 | 3300012204 | Vadose Zone Soil | VVSVKTAKEDTMATMLLGYGATMAEAHIADLRRETEAARKLRAVRAARRQKGA* |
| Ga0137374_107013162 | 3300012204 | Vadose Zone Soil | MAATLLGYRATMAQLHIDDLLREAAAARKVRAARAARRQRGV* |
| Ga0137380_109872471 | 3300012206 | Vadose Zone Soil | VVSVKIAKEDTMATMPLGYGAALAELHIEDLRREAEAARKVQAARAARRQRGV* |
| Ga0137379_101211821 | 3300012209 | Vadose Zone Soil | VVSVKIAKEDTMATMPLGYGAALAELHIEDLRRETEAARTVQAARAARRQRGV* |
| Ga0137367_100028893 | 3300012353 | Vadose Zone Soil | VVSVKTAKEDTMATMLLGYGTTLAELHIEDLHREAEAARKARAARQAARVARRQRGV* |
| Ga0137369_100131369 | 3300012355 | Vadose Zone Soil | MATTLLDYPAMMAELHIDDLRREAAAARKVRAARAARRQREV* |
| Ga0137369_101401284 | 3300012355 | Vadose Zone Soil | DYRPMMAELHIDDLLREAAAARKVQAARAARRQRRV* |
| Ga0137369_106148562 | 3300012355 | Vadose Zone Soil | MATTLLGYHATMAQLHIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0137369_107662451 | 3300012355 | Vadose Zone Soil | TMTSTLLDYRPMMAELHIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0137369_107726423 | 3300012355 | Vadose Zone Soil | TLLDYRPMMAELHIDDLLREAAAARKVRAARVARRQRGV* |
| Ga0137368_100374364 | 3300012358 | Vadose Zone Soil | VVPVKTTKEDTMASTLLDYRPMMAELHIDDLLREAAAARKVRAARAARRQREV* |
| Ga0137368_100710105 | 3300012358 | Vadose Zone Soil | MAATLLGYHATMAQLHIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0137368_105114342 | 3300012358 | Vadose Zone Soil | MTSTLLDYRPMMAELHIDDLLREAAAARKVQAARAARRQRRV* |
| Ga0137375_102570574 | 3300012360 | Vadose Zone Soil | TSTLLDYRPMMAELHIDDLLREAAAARKVQAARAARRQRGV* |
| Ga0137375_109125132 | 3300012360 | Vadose Zone Soil | VKTAKEDTMATMLLGYGATMAEAHIADLRREAEAARKLRAVRAARRQKGA* |
| Ga0162653_1000017942 | 3300012937 | Soil | VVSVKTTKEDTMATTLLDYSGKMAELHVDDLLREAAAARKVQAARAARRQRGV* |
| Ga0120193_100487622 | 3300014965 | Terrestrial | VVSVKTTKEDTMTTTLLDYRAKMAELHVDDLLREAAAARKVQAARAARRQRGV* |
| Ga0132258_104849102 | 3300015371 | Arabidopsis Rhizosphere | MAMTILGYRAMLAELRRDARLRQAAAARKGRAARAARRPKEV* |
| Ga0184605_103545781 | 3300018027 | Groundwater Sediment | MAMTLLGYRAMMAELRGADLLHKAAADRKVRAARAARRQRGV |
| Ga0184608_101110551 | 3300018028 | Groundwater Sediment | MAMTILGYRAMLAELRRDARLRQAAAARKVRAARAARRQRGV |
| Ga0184608_104469342 | 3300018028 | Groundwater Sediment | MAMTLLGYRAMMAELRSEDLLRKAAADRKVRAARAARRQRGV |
| Ga0184634_105588361 | 3300018031 | Groundwater Sediment | MATTLLDYHAIMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0184620_100879852 | 3300018051 | Groundwater Sediment | MAMTILGYRAMLAELRRDARLRQAAAARKGRAARAARRQKGV |
| Ga0184638_10034242 | 3300018052 | Groundwater Sediment | MATTLLDYHAIMAELRIDDLLREAAAARKVQAARAARRQRGV |
| Ga0184638_10480191 | 3300018052 | Groundwater Sediment | TAKEDTMTTTLLDFSAVLAEQHIAELRREAAAARKVQAARAARRQKEV |
| Ga0184638_12056182 | 3300018052 | Groundwater Sediment | MATTLLDYRPMMAELHIDDLLREAAAARKVQAARAARRQRG |
| Ga0184626_100328773 | 3300018053 | Groundwater Sediment | MTTTLLDFSAVLAEQHIAELRREAAAARKVQAARAARRQKEV |
| Ga0184635_100360362 | 3300018072 | Groundwater Sediment | MAMTILGYRAMLAELRRDARLRQAAAARKGRAVRAARRQKGV |
| Ga0184632_100010586 | 3300018075 | Groundwater Sediment | MATTLLDYHAIMAELRINDLLREAAAARKVQAARAARRQRGV |
| Ga0184632_100282464 | 3300018075 | Groundwater Sediment | MATTLLDYRPMMAELHIDDLLREAAAARKVQAARAARRQRGG |
| Ga0184612_103625152 | 3300018078 | Groundwater Sediment | MTTTLLDISAVLAEQHIAELRREAAAARKVQAARAARRQKEV |
| Ga0184625_104419941 | 3300018081 | Groundwater Sediment | MAMTLLGYRAMMAELRGEDLLRKAAADRKVRAARAARRQRGV |
| Ga0190269_106599533 | 3300018465 | Soil | MAMTLLGFRALMAERRRDALRREAAAARKVRAAPAARRQRGV |
| Ga0190268_103786882 | 3300018466 | Soil | MAMTLLGYRAMMAELRRDALRREAAAARKVRAARAARRQRGV |
| Ga0190274_100492366 | 3300018476 | Soil | MTTTLLDYPAKMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0190274_131458222 | 3300018476 | Soil | MAMMLLGYRAMMAELRRDALRREAAAARKVWAVRAARRQRGV |
| Ga0184642_15670451 | 3300019279 | Groundwater Sediment | TKEDTMAMTLLGYRAMMAELRGEDLLHKAAADRKVRAARAARRQRGV |
| Ga0190264_100653662 | 3300019377 | Soil | VATTLLDYHAVMAELRIDNLLREAAAARKVQAARAARHQRGV |
| Ga0190264_101750222 | 3300019377 | Soil | MATKLMDYPAMMAELHIDDLLRQAAAARKAQAARAARRQREV |
| Ga0193704_10644212 | 3300019867 | Soil | MAMTILGYRAMLAELRRDARLRQAAAARKGRAARAA |
| Ga0210378_100138982 | 3300021073 | Groundwater Sediment | MARTLLDHHAMMAQLHVDELLREAAAARKVQAARAARRQRGV |
| Ga0222625_10089591 | 3300022195 | Groundwater Sediment | PTVVSVKTTKEDTMTTTLLDYPAKMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0222625_11210683 | 3300022195 | Groundwater Sediment | KEDTMATTLLDYHAIMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0222625_11869571 | 3300022195 | Groundwater Sediment | TYRGVSEDNQEDTMTTKLMDYPAMMAELHIDDLLRQAAAARKAQAARAARRQREV |
| Ga0222623_100164362 | 3300022694 | Groundwater Sediment | MTTKLMDYPAMMAELHIDDLLRQAAAARKAQAARAARRQREV |
| Ga0222622_102016291 | 3300022756 | Groundwater Sediment | MAMTLLGYRAMMAELRGEDLLHKAAADRKVRAARAARRQRGV |
| Ga0222622_113806721 | 3300022756 | Groundwater Sediment | MTILGYRAMLAELRRDARLRQAAAARKGRAARAARRQKGV |
| Ga0207706_100147605 | 3300025933 | Corn Rhizosphere | MAMTILGYRAMLAELRRDARLRQAAAARKGRAARAARRQKEV |
| Ga0209879_10147473 | 3300027056 | Groundwater Sand | MATTLLDYRAMMGELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0209878_10072104 | 3300027163 | Groundwater Sand | MATTLLDHHAMMAQLHVDELLREAAAARKVQAARAARRQRGV |
| Ga0209875_10003437 | 3300027209 | Groundwater Sand | MTTTLLDYSAKMAELHVDDLLREAAAARKVQAARAARRQRGV |
| Ga0209875_10020024 | 3300027209 | Groundwater Sand | MTTTFLDYRATMSELHIDDLLRDAAAVRKVQAARAARRQRGV |
| Ga0209875_10285691 | 3300027209 | Groundwater Sand | MATTLLDYRAMMGELHIDDLLREAAAARKVQAARAARRQR |
| Ga0209846_10008721 | 3300027277 | Groundwater Sand | MTTTLLDYSAKMAELHVDDLLREAAAARKVQAARAARRQRRI |
| Ga0209846_10022772 | 3300027277 | Groundwater Sand | MTTTLLDYRPMMAELHIDDLLREAAAARKVQAARAARRQRGG |
| Ga0209846_10249081 | 3300027277 | Groundwater Sand | MATTLLDHHAMMAQLHVDELLREAAAARKVQAARAVRRQRGV |
| Ga0209845_10069943 | 3300027324 | Groundwater Sand | MTSTLLDYRPMMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0209861_10286993 | 3300027332 | Groundwater Sand | MATTLLYYHAIMAELRIDDLLREAAAARKVQAARAARCQRGV |
| Ga0209899_10027832 | 3300027490 | Groundwater Sand | MTTTLLDYHATMAQLHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0209899_10193604 | 3300027490 | Groundwater Sand | ARLRPTVVPVKTAKEDTMATMLLDYRGMMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0209899_10574531 | 3300027490 | Groundwater Sand | RPTVVSVKTTKEATMATTLLDHHAMMAQLHVDELLREAAAARKVQAARAARRQRGV |
| Ga0209887_10049141 | 3300027561 | Groundwater Sand | RLTPTVVSVKITKEATMATTLLDYHAIMAELRIDDLLREAAAARKVQAARAARRQRGV |
| Ga0209874_10204632 | 3300027577 | Groundwater Sand | MATTLLDHHAMMAQLHVDELLREAAAARKVQAARAARRQPGV |
| Ga0209874_10326923 | 3300027577 | Groundwater Sand | MATTLLDYRPMMAALRIDDLLREAAAARKVQAARAARRQRGV |
| Ga0209874_10374724 | 3300027577 | Groundwater Sand | MATTLLDYRATMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0209461_101043332 | 3300027750 | Agave | MATTLLDYRTVMAELHIDDLRREARTARKVRAARAARRQKGV |
| Ga0209574_102327571 | 3300027809 | Agave | MATTLLDYRALMAEFHIDDLRRQARTARKVRAARAARRQKGV |
| Ga0209814_101649903 | 3300027873 | Populus Rhizosphere | TMAMTLLGYRATMGELRREDLRREAAAARKVRAARATRRQRGV |
| Ga0207428_104494061 | 3300027907 | Populus Rhizosphere | MAMTLLGYRATMGELRREDLRREAAAARKVRAARATRRQRGV |
| Ga0209860_10494811 | 3300027949 | Groundwater Sand | MATTLLYYHAIMAELRIDDLLREAAAARKVQAARAARRQRGV |
| Ga0209889_10559613 | 3300027952 | Groundwater Sand | DNEEDTMATTLLDYRATMAELHIDDLLRDAAAARKVQAARAARRQRGV |
| Ga0307291_10059533 | 3300028707 | Soil | MTLLGYRAMMAELRSEDLLRKAAADRKVRAARAARRQRGV |
| Ga0307295_100366771 | 3300028708 | Soil | MAMTILGYRTMLAELRRDARLRQAAAARKGRAARAARRQKGV |
| Ga0307322_100465783 | 3300028710 | Soil | VMTTQEDTMAMTILGYRAMLAELRRDARLRQAAAARKGRAARAARRQKGV |
| Ga0307293_100172581 | 3300028711 | Soil | VVSVKTTKEDTMTTTLLDYPAKMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0307303_100533123 | 3300028713 | Soil | MATTILGYRAMMAELRRDALLREAAAARKVRAARAARRQRGV |
| Ga0307311_101836181 | 3300028716 | Soil | MAMTLLGYRAIMAELRRDDLLREAAAARKVQAARAAPRQRGV |
| Ga0307311_102753712 | 3300028716 | Soil | AARLRPTVVSVMTTKEDTMAMTLLGYRAMMAELRGEDLLHKAAADRKVRAARAARRQRGV |
| Ga0307307_101347013 | 3300028718 | Soil | TVMSVKTTREDTMATTILGYRAMMAELRRDALLREAAAARKVRAARAARRQRGV |
| Ga0307301_100259953 | 3300028719 | Soil | MTLLGYRAMMAELRGEDLLHKAAADRKVRAARAARRQRGV |
| Ga0307315_102116921 | 3300028721 | Soil | SVMTTKEDTMAMTLLGYRAMMAELRSEDLLRKAAADRKVRAARAARRQRGV |
| Ga0307318_100234703 | 3300028744 | Soil | MAMTLLGYRALMAERRRDALRREAAAARKVQAARAARRQRGV |
| Ga0307320_100993412 | 3300028771 | Soil | MAMTLLGLRAMMAERRRDALRREAAAARKVQAARAARRQRGV |
| Ga0307320_104659591 | 3300028771 | Soil | KTTKEDTMAMTLLGYRAMMAELRRDALRREAAAARKVRTARAARRQRGV |
| Ga0307323_103508611 | 3300028787 | Soil | KEDTMTTTLLDYPAKMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0307290_101291622 | 3300028791 | Soil | MAMTLLGFRVLMAERRRDALRREAAAARKVRAAPAARRQRGV |
| Ga0307287_100175003 | 3300028796 | Soil | MAMMLVGYRAMMAELRRDDLLREAAAARKVRAARATRRQRGV |
| Ga0247824_105651451 | 3300028809 | Soil | TTQEDTMAMTILGYRAMLAELRRDARLRQAAAARKGRAARAARRQKEV |
| Ga0307302_100652331 | 3300028814 | Soil | MATTLLDYRPMMAELHIDDLLREAAAARKVQAARAARRQREV |
| Ga0307289_101942381 | 3300028875 | Soil | REDTMATTILGYRAMMAELRRDALLREAAAARKVRAARAARRQRGV |
| Ga0307278_100015926 | 3300028878 | Soil | MTTTILDYPARMAELHIDDLLREAAAARKVQAARAARRHKGA |
| Ga0307278_105220771 | 3300028878 | Soil | MASTLLDYRPMMAELHIDDLLREAAAARKVQAARTARRQRGV |
| Ga0307277_101841742 | 3300028881 | Soil | MAMTLLGYRAMMAELRREDLRREAATAGKVRAARAARRQRGV |
| Ga0307308_102679831 | 3300028884 | Soil | YRAMMAELRRDALLREAAAARKVRAARAARRQRGV |
| Ga0268253_100510823 | 3300030514 | Agave | MKEDTMATTLLDYRALMAEFHIDDLRRQARTARKVRAARAARRQKGV |
| Ga0308187_104596633 | 3300031114 | Soil | DTMTTTLLDYPAKMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0308187_104600432 | 3300031114 | Soil | AMTILGYRAMLAELRRDARLRQAAAARKGRAARAARRQKGV |
| Ga0308187_104892501 | 3300031114 | Soil | HTMAMTLLGFRALMAERRRDALRREAAAARKVRAAPAARRQRGV |
| Ga0307408_1002354333 | 3300031548 | Rhizosphere | MAMTLLGYRAMMAELRREELLRRAAATRRLRAVRAGRRQRGV |
| Ga0307408_1006311803 | 3300031548 | Rhizosphere | MATTLLDYPAMMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0307410_119691103 | 3300031852 | Rhizosphere | TKEDTMTTTLLDYHAKMAELHVDDLLREAAAARKAAAARAARRQRRV |
| Ga0307406_100027396 | 3300031901 | Rhizosphere | MAMTLLGYRALMAERRRDALRRAAARKVQAARAARRQRGD |
| Ga0307412_101468041 | 3300031911 | Rhizosphere | MATTLLDYRAMMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0307409_1001662473 | 3300031995 | Rhizosphere | MAMMLLGYRAMMAELRREDLLRKAAATRKVRAARAARR |
| Ga0307409_1006275663 | 3300031995 | Rhizosphere | RPTVVSVTTTKEDTMATTLLDYRAMMAELHIDDLLREAAAARKVQAARAARRQRGV |
| Ga0307416_1000861103 | 3300032002 | Rhizosphere | VSDDTKEDTMAMTLLGYRAMMAELRREELLRRAAATRRLRAVRAGRRQRGV |
| Ga0307416_1005262221 | 3300032002 | Rhizosphere | MAMTLLGYRAMMAELRREELLRRAAATRRLRAVRAGRR |
| Ga0307415_1000114856 | 3300032126 | Rhizosphere | MAMMLLGYRAMMAELRREDLLRKAAATRKVRAARAARRQRGV |
| Ga0334913_004809_2570_2713 | 3300034172 | Sub-Biocrust Soil | MKEDTMATTLLDYRALMAELHIDDLRREARTARKVRAARAARRQKGV |
| Ga0334913_024917_388_549 | 3300034172 | Sub-Biocrust Soil | VVSGKTTKEDTMATTLLDYRPMMAELHIDDLLREAAAARKVQAARAARRHRGV |
| ⦗Top⦘ |