Metagenome / Metatranscriptome Family F045399

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F045399
Family Type	Metagenome / Metatranscriptome
Number of Sequences	153
Average Sequence Length	44 residues
Representative Sequence	LFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Number of Associated Samples	125
Number of Associated Scaffolds	153

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	97.39 %
% of genes from short scaffolds (< 2000 bps)	94.12 %
Associated GOLD sequencing projects	112
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (82.353 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.379 % of family members)
Environment Ontology (ENVO)	Unclassified (40.523 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (59.477 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 5.63% β-sheet: 0.00% Coil/Unstructured: 94.37%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.18
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 153 Family Scaffolds
PF07519	Tannase	2.61
PF00756	Esterase	1.96
PF13577	SnoaL_4	1.96
PF00753	Lactamase_B	1.96
PF13360	PQQ_2	1.96
PF01979	Amidohydro_1	1.96
PF05935	Arylsulfotrans	1.96
PF02627	CMD	1.31
PF03544	TonB_C	1.31
PF02687	FtsX	1.31
PF00069	Pkinase	1.31
PF13683	rve_3	0.65
PF05448	AXE1	0.65
PF07470	Glyco_hydro_88	0.65
PF07883	Cupin_2	0.65
PF07730	HisKA_3	0.65
PF01432	Peptidase_M3	0.65
PF03315	SDH_beta	0.65
PF13442	Cytochrome_CBB3	0.65
PF04734	Ceramidase_alk	0.65
PF01170	UPF0020	0.65
PF08282	Hydrolase_3	0.65
PF07586	HXXSHH	0.65
PF13709	DUF4159	0.65
PF00691	OmpA	0.65
PF17158	MASE4	0.65
PF08031	BBE	0.65
PF12706	Lactamase_B_2	0.65
PF08450	SGL	0.65
PF13620	CarboxypepD_reg	0.65
PF00486	Trans_reg_C	0.65
PF12732	YtxH	0.65
PF13847	Methyltransf_31	0.65
PF06224	HTH_42	0.65
PF02604	PhdYeFM_antitox	0.65

COG ID	Name	Functional Category	% Frequency in 153 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	5.23
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	1.31
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	1.31
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	1.31
COG3769	Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily	Carbohydrate transport and metabolism [G]	0.65
COG2264	Ribosomal protein L11 methylase PrmA	Translation, ribosomal structure and biogenesis [J]	0.65
COG2265	tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family	Translation, ribosomal structure and biogenesis [J]	0.65
COG2813	16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG	Translation, ribosomal structure and biogenesis [J]	0.65
COG2890	Methylase of polypeptide chain release factors	Translation, ribosomal structure and biogenesis [J]	0.65
COG3214	DNA glycosylase YcaQ, repair of DNA interstrand crosslinks	Replication, recombination and repair [L]	0.65
COG3386	Sugar lactone lactonase YvrE	Carbohydrate transport and metabolism [G]	0.65
COG3391	DNA-binding beta-propeller fold protein YncE	General function prediction only [R]	0.65
COG3458	Cephalosporin-C deacetylase or related acetyl esterase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.65
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	0.65
COG3850	Signal transduction histidine kinase NarQ, nitrate/nitrite-specific	Signal transduction mechanisms [T]	0.65
COG3851	Signal transduction histidine kinase UhpB, glucose-6-phosphate specific	Signal transduction mechanisms [T]	0.65
COG4118	Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor	Defense mechanisms [V]	0.65
COG4123	tRNA1(Val) A37 N6-methylase TrmN6	Translation, ribosomal structure and biogenesis [J]	0.65
COG4564	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.65
COG4585	Signal transduction histidine kinase ComP	Signal transduction mechanisms [T]	0.65
COG2263	Predicted RNA methylase	General function prediction only [R]	0.65
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.65
COG0116	23S rRNA G2445 N2-methylase RlmL	Translation, ribosomal structure and biogenesis [J]	0.65
COG2161	Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family	Defense mechanisms [V]	0.65
COG1877	Trehalose-6-phosphate phosphatase	Carbohydrate transport and metabolism [G]	0.65
COG1760	L-serine deaminase	Amino acid transport and metabolism [E]	0.65
COG1506	Dipeptidyl aminopeptidase/acylaminoacyl peptidase	Amino acid transport and metabolism [E]	0.65
COG1164	Oligoendopeptidase F	Amino acid transport and metabolism [E]	0.65
COG1092	23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI	Translation, ribosomal structure and biogenesis [J]	0.65
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.65
COG0561	Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases	Coenzyme transport and metabolism [H]	0.65
COG0560	Phosphoserine phosphatase	Amino acid transport and metabolism [E]	0.65
COG0339	Zn-dependent oligopeptidase, M3 family	Posttranslational modification, protein turnover, chaperones [O]	0.65
COG0286	Type I restriction-modification system, DNA methylase subunit	Defense mechanisms [V]	0.65
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.65

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	82.35 %
Unclassified	root	N/A	17.65 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	82.35 %
Unclassified	root	N/A	17.65 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	82.35 %
Unclassified	root	N/A	17.65 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	32.03 %
Unclassified	root	N/A	17.65 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	11.76 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.65 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	23.53 %
Unclassified	root	N/A	17.65 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5.88 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.61 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.61 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.65 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.65 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	22.88 %
Unclassified	root	N/A	17.65 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	3.27 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.61 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	1.96 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.65 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	0.65 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.65 %
Vibrionales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales	0.65 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.65 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.65 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	22.88 %
Unclassified	root	N/A	17.65 %
Erythrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae	3.27 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.61 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1.96 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.65 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.65 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.65 %
Vibrionaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae	0.65 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.65 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.65 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	22.88 %
Unclassified	root	N/A	17.65 %
Erythrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae	3.27 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.61 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1.96 %
Pseudoroseicyclus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %
Vibrio	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio	0.65 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.65 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.65 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.65 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	22.88 %
Unclassified	root	N/A	17.65 %
Erythrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae	3.27 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.61 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1.96 %
Pseudoroseicyclus tamaricis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis	0.65 %
Vibrio metschnikovii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio metschnikovii	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.65 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.65 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.65 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	22.88 %
Unclassified	root	N/A	17.65 %
Erythrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae	3.27 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.61 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1.96 %
Vibrio metschnikovii CIP 69.14	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio metschnikovii → Vibrio metschnikovii CIP 69.14	0.65 %
Pseudoroseicyclus tamaricis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.65 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.65 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.65 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2162886011\|MRS1b_contig_724119	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	921	Open in IMG/M
2199352025\|deepsgr__Contig_149759	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	958	Open in IMG/M
3300000559\|F14TC_100243836	All Organisms → cellular organisms → Bacteria	788	Open in IMG/M
3300000559\|F14TC_101455648	Not Available	1229	Open in IMG/M
3300001661\|JGI12053J15887_10163326	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1160	Open in IMG/M
3300003152\|Ga0052254_1143606	All Organisms → cellular organisms → Bacteria → Acidobacteria	660	Open in IMG/M
3300004463\|Ga0063356_105483072	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	544	Open in IMG/M
3300005331\|Ga0070670_100988456	All Organisms → cellular organisms → Bacteria	765	Open in IMG/M
3300005331\|Ga0070670_101271995	All Organisms → cellular organisms → Bacteria	673	Open in IMG/M
3300005331\|Ga0070670_102067160	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300005345\|Ga0070692_10418616	Not Available	850	Open in IMG/M
3300005354\|Ga0070675_101847965	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300005355\|Ga0070671_101311085	Not Available	639	Open in IMG/M
3300005364\|Ga0070673_101943585	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	558	Open in IMG/M
3300005367\|Ga0070667_102252377	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae	513	Open in IMG/M
3300005438\|Ga0070701_10555466	Not Available	754	Open in IMG/M
3300005444\|Ga0070694_101381175	Not Available	594	Open in IMG/M
3300005456\|Ga0070678_101695788	Not Available	594	Open in IMG/M
3300005457\|Ga0070662_100233914	All Organisms → cellular organisms → Bacteria	1471	Open in IMG/M
3300005458\|Ga0070681_11565365	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	584	Open in IMG/M
3300005459\|Ga0068867_100113143	All Organisms → cellular organisms → Bacteria	2088	Open in IMG/M
3300005543\|Ga0070672_101512291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	601	Open in IMG/M
3300005545\|Ga0070695_101708305	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	527	Open in IMG/M
3300005548\|Ga0070665_100950761	All Organisms → cellular organisms → Bacteria	872	Open in IMG/M
3300005615\|Ga0070702_100580518	Not Available	837	Open in IMG/M
3300005617\|Ga0068859_102069123	Not Available	629	Open in IMG/M
3300005719\|Ga0068861_100775646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	898	Open in IMG/M
3300005719\|Ga0068861_101066767	All Organisms → cellular organisms → Bacteria → Acidobacteria	775	Open in IMG/M
3300005764\|Ga0066903_100671677	All Organisms → cellular organisms → Bacteria	1818	Open in IMG/M
3300005842\|Ga0068858_100972851	All Organisms → cellular organisms → Bacteria	831	Open in IMG/M
3300005844\|Ga0068862_102720230	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300005937\|Ga0081455_10588805	All Organisms → cellular organisms → Bacteria → Proteobacteria	727	Open in IMG/M
3300006163\|Ga0070715_10438304	All Organisms → cellular organisms → Bacteria	735	Open in IMG/M
3300006163\|Ga0070715_10824754	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	565	Open in IMG/M
3300006196\|Ga0075422_10471962	All Organisms → cellular organisms → Bacteria	565	Open in IMG/M
3300006237\|Ga0097621_100276320	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1477	Open in IMG/M
3300006358\|Ga0068871_101301474	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	684	Open in IMG/M
3300006358\|Ga0068871_102164307	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300006845\|Ga0075421_102244746	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	575	Open in IMG/M
3300006852\|Ga0075433_11483308	Not Available	586	Open in IMG/M
3300006876\|Ga0079217_11725326	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	505	Open in IMG/M
3300006880\|Ga0075429_100072592	All Organisms → cellular organisms → Bacteria	2997	Open in IMG/M
3300006881\|Ga0068865_102220705	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	500	Open in IMG/M
3300006894\|Ga0079215_11536123	All Organisms → cellular organisms → Bacteria → Acidobacteria	527	Open in IMG/M
3300006918\|Ga0079216_10044876	All Organisms → cellular organisms → Bacteria	1875	Open in IMG/M
3300009012\|Ga0066710_103813773	Not Available	565	Open in IMG/M
3300009036\|Ga0105244_10602523	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	503	Open in IMG/M
3300009098\|Ga0105245_13246166	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae	504	Open in IMG/M
3300009100\|Ga0075418_10560221	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1229	Open in IMG/M
3300009100\|Ga0075418_11775589	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	671	Open in IMG/M
3300009137\|Ga0066709_101224258	All Organisms → cellular organisms → Bacteria → Acidobacteria	1105	Open in IMG/M
3300009137\|Ga0066709_101281233	All Organisms → cellular organisms → Bacteria	1076	Open in IMG/M
3300009147\|Ga0114129_11933683	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	715	Open in IMG/M
3300009148\|Ga0105243_11075127	All Organisms → cellular organisms → Bacteria	811	Open in IMG/M
3300009148\|Ga0105243_11560194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae	686	Open in IMG/M
3300009148\|Ga0105243_12182715	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300009156\|Ga0111538_13194571	Not Available	571	Open in IMG/M
3300009174\|Ga0105241_11601215	All Organisms → cellular organisms → Bacteria → Acidobacteria	630	Open in IMG/M
3300009551\|Ga0105238_11426234	Not Available	720	Open in IMG/M
3300009553\|Ga0105249_10776804	Not Available	1021	Open in IMG/M
3300010337\|Ga0134062_10694554	Not Available	534	Open in IMG/M
3300010366\|Ga0126379_12130510	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	662	Open in IMG/M
3300010366\|Ga0126379_13177616	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	550	Open in IMG/M
3300010400\|Ga0134122_11006533	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	817	Open in IMG/M
3300010401\|Ga0134121_10684074	All Organisms → cellular organisms → Bacteria	971	Open in IMG/M
3300010403\|Ga0134123_12411599	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300011430\|Ga0137423_1099080	All Organisms → cellular organisms → Bacteria → Acidobacteria	869	Open in IMG/M
3300012212\|Ga0150985_108502528	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300012212\|Ga0150985_112234841	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	534	Open in IMG/M
3300012212\|Ga0150985_118524257	All Organisms → cellular organisms → Bacteria	693	Open in IMG/M
3300012486\|Ga0157331_1031172	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300012903\|Ga0157289_10003705	All Organisms → cellular organisms → Bacteria	2463	Open in IMG/M
3300012907\|Ga0157283_10355624	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	529	Open in IMG/M
3300012955\|Ga0164298_10627076	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	743	Open in IMG/M
3300012988\|Ga0164306_10872315	All Organisms → cellular organisms → Bacteria → Acidobacteria	731	Open in IMG/M
3300013297\|Ga0157378_12753904	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	544	Open in IMG/M
3300014326\|Ga0157380_10103143	All Organisms → cellular organisms → Bacteria	2380	Open in IMG/M
3300014745\|Ga0157377_10170693	All Organisms → cellular organisms → Bacteria	1360	Open in IMG/M
3300015201\|Ga0173478_10012378	All Organisms → cellular organisms → Bacteria	2243	Open in IMG/M
3300015371\|Ga0132258_10013539	All Organisms → cellular organisms → Bacteria	17286	Open in IMG/M
3300015372\|Ga0132256_103313339	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	542	Open in IMG/M
3300015374\|Ga0132255_100837359	Not Available	1373	Open in IMG/M
3300015374\|Ga0132255_103598712	All Organisms → cellular organisms → Bacteria	659	Open in IMG/M
3300016270\|Ga0182036_10323592	All Organisms → cellular organisms → Bacteria	1180	Open in IMG/M
3300017792\|Ga0163161_10403542	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	1096	Open in IMG/M
3300018060\|Ga0187765_10595973	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300018429\|Ga0190272_11871370	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio metschnikovii → Vibrio metschnikovii CIP 69.14	629	Open in IMG/M
3300018466\|Ga0190268_10455313	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	849	Open in IMG/M
3300018466\|Ga0190268_12413081	Not Available	500	Open in IMG/M
3300018469\|Ga0190270_12311879	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	599	Open in IMG/M
3300018476\|Ga0190274_13749175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae	514	Open in IMG/M
3300018476\|Ga0190274_13795090	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	511	Open in IMG/M
3300018481\|Ga0190271_10165058	All Organisms → cellular organisms → Bacteria	2159	Open in IMG/M
3300018481\|Ga0190271_10422754	All Organisms → cellular organisms → Bacteria	1431	Open in IMG/M
3300019228\|Ga0180119_1269399	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	528	Open in IMG/M
3300019356\|Ga0173481_10322625	All Organisms → cellular organisms → Bacteria	727	Open in IMG/M
3300019362\|Ga0173479_10116263	All Organisms → cellular organisms → Bacteria	1018	Open in IMG/M
3300021329\|Ga0210362_1402962	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	505	Open in IMG/M
3300021384\|Ga0213876_10355153	All Organisms → cellular organisms → Bacteria	780	Open in IMG/M
3300022724\|Ga0242665_10233592	All Organisms → cellular organisms → Bacteria	619	Open in IMG/M
3300023168\|Ga0247748_1037281	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae	716	Open in IMG/M
(restricted) 3300023208\|Ga0233424_10334687	Not Available	578	Open in IMG/M
3300024317\|Ga0247660_1081656	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	551	Open in IMG/M
3300025907\|Ga0207645_10093943	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1930	Open in IMG/M
3300025924\|Ga0207694_10823004	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	784	Open in IMG/M
3300025930\|Ga0207701_10150843	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	2060	Open in IMG/M
3300025933\|Ga0207706_10226848	Not Available	1635	Open in IMG/M
3300025937\|Ga0207669_10636106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	871	Open in IMG/M
3300025937\|Ga0207669_11275128	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300025937\|Ga0207669_11935471	Not Available	504	Open in IMG/M
3300025940\|Ga0207691_10789172	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	798	Open in IMG/M
3300025942\|Ga0207689_11035200	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	692	Open in IMG/M
3300025945\|Ga0207679_12155483	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300025960\|Ga0207651_11414174	Not Available	626	Open in IMG/M
3300025960\|Ga0207651_11734019	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	562	Open in IMG/M
3300025961\|Ga0207712_10741111	All Organisms → cellular organisms → Bacteria	860	Open in IMG/M
3300026075\|Ga0207708_11130569	All Organisms → cellular organisms → Bacteria	683	Open in IMG/M
3300026095\|Ga0207676_11196665	All Organisms → cellular organisms → Bacteria	753	Open in IMG/M
3300026118\|Ga0207675_100821557	All Organisms → cellular organisms → Bacteria → Acidobacteria	943	Open in IMG/M
3300026118\|Ga0207675_102714098	Not Available	504	Open in IMG/M
3300026121\|Ga0207683_11426381	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300027682\|Ga0209971_1008304	All Organisms → cellular organisms → Bacteria	2461	Open in IMG/M
3300027691\|Ga0209485_1217931	All Organisms → cellular organisms → Bacteria	602	Open in IMG/M
3300027886\|Ga0209486_10761127	All Organisms → cellular organisms → Bacteria → Acidobacteria	630	Open in IMG/M
3300028379\|Ga0268266_10267528	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1586	Open in IMG/M
3300028380\|Ga0268265_10459384	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1191	Open in IMG/M
3300028380\|Ga0268265_11303402	All Organisms → cellular organisms → Bacteria	726	Open in IMG/M
3300028380\|Ga0268265_12294025	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300028878\|Ga0307278_10271397	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	752	Open in IMG/M
3300031058\|Ga0308189_10117886	All Organisms → cellular organisms → Bacteria → Acidobacteria	867	Open in IMG/M
3300031226\|Ga0307497_10066528	All Organisms → cellular organisms → Bacteria	1315	Open in IMG/M
3300031226\|Ga0307497_10174381	All Organisms → cellular organisms → Bacteria	912	Open in IMG/M
3300031446\|Ga0170820_17348237	Not Available	709	Open in IMG/M
3300031538\|Ga0310888_10135722	All Organisms → cellular organisms → Bacteria	1296	Open in IMG/M
3300031547\|Ga0310887_11106104	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300031768\|Ga0318509_10581473	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis	624	Open in IMG/M
3300031847\|Ga0310907_10493236	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	654	Open in IMG/M
3300031854\|Ga0310904_11279874	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300031858\|Ga0310892_10695548	Not Available	697	Open in IMG/M
3300031908\|Ga0310900_10086245	All Organisms → cellular organisms → Bacteria	1971	Open in IMG/M
3300031908\|Ga0310900_10370672	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1078	Open in IMG/M
3300031908\|Ga0310900_11909427	Not Available	507	Open in IMG/M
3300031911\|Ga0307412_11607450	All Organisms → cellular organisms → Bacteria	594	Open in IMG/M
3300031943\|Ga0310885_10228154	Not Available	933	Open in IMG/M
3300031943\|Ga0310885_10565452	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	627	Open in IMG/M
3300032004\|Ga0307414_11297389	Not Available	675	Open in IMG/M
3300032122\|Ga0310895_10397904	Not Available	674	Open in IMG/M
3300032157\|Ga0315912_10288279	All Organisms → cellular organisms → Bacteria	1293	Open in IMG/M
3300032157\|Ga0315912_11423791	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300032174\|Ga0307470_11814269	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300033433\|Ga0326726_11337512	All Organisms → cellular organisms → Bacteria → Acidobacteria	697	Open in IMG/M
3300034148\|Ga0364927_0174000	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	627	Open in IMG/M
3300034659\|Ga0314780_071549	All Organisms → cellular organisms → Bacteria → Acidobacteria	740	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	50.98%
Host-Associated	Host-Associated	49.02%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	49.02%
Terrestrial	Environmental → Terrestrial	47.71%
Aquatic	Environmental → Aquatic	3.27%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	46.41%
Rhizosphere	Host-Associated → Plants → Rhizosphere	28.76%
Rhizoplane	Host-Associated → Plants → Rhizoplane	17.65%
Roots	Host-Associated → Plants → Roots	2.61%
Freshwater	Environmental → Aquatic → Freshwater	1.96%
Marine	Environmental → Aquatic → Marine	0.65%
Sediment	Environmental → Aquatic → Sediment	0.65%
Peat	Environmental → Terrestrial → Peat	0.65%
Floodplain	Environmental → Terrestrial → Floodplain	0.65%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	37.25%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	15.03%
Soil	Host-Associated → Plants → Rhizosphere → Soil	13.73%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.76%
Loam	Environmental → Terrestrial → Soil → Loam	8.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.58%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.96%
Soil	Host-Associated → Plants → Rhizoplane → Soil	1.31%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.65%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.65%
Lake	Environmental → Aquatic → Freshwater → Lake	0.65%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.65%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.65%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.65%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.65%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.65%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.65%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.95%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	15.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	13.73%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	11.76%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	7.84%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.58%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.92%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.92%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.61%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.96%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.31%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.31%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	1.31%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.65%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.65%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.65%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.65%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.65%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.65%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.65%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.65%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.65%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	14.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	7.84%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	7.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	6.54%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.23%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.23%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	4.58%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.27%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.27%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.96%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.96%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.96%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.96%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.31%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.31%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.31%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	1.31%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.31%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.31%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.31%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.65%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment	0.65%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.65%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.65%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.65%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.65%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.65%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.65%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.65%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.65%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.65%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.65%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.65%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.65%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.65%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.65%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.65%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.65%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2162886011	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300003152	Freshwater sediment microbial communities from Loktak Lake, India	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011430	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012486	Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510	Environmental	Open in IMG/M
3300012903	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1	Environmental	Open in IMG/M
3300012907	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019228	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300021329	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Host-Associated	Open in IMG/M
3300022724	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300023168	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5	Environmental	Open in IMG/M
3300023208 (restricted)	Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG	Environmental	Open in IMG/M
3300024317	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01	Environmental	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027691	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental	Open in IMG/M
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031768	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22	Environmental	Open in IMG/M
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Host-Associated	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300034148	Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17	Environmental	Open in IMG/M
3300034659	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
MRS1b_0177.00002800	2162886011	Miscanthus Rhizosphere	TTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
deepsgr_02458390	2199352025	Soil	VYNLFNSNTPTTYETVYDPATNGAKWMTPTAVLLPRFMRFNVQFDF
F14TC_1002438361	3300000559	Soil	TNVGLDVYNLFNRNTGTTYETVYDPATNGARWMQPTAVLLPRFMRLNVQVDF*
F14TC_1014556482	3300000559	Soil	FNANPGTTFESVYDPATNGARWMQPTAVLNPRAARLNAQFDF*
JGI12053J15887_101633263	3300001661	Forest Soil	NLFNSNTATTYETVYDPATNGAKWMTPTAVLLSRFMRFNVQFDF*
Ga0052254_11436061	3300003152	Sediment	FNSNTPTTYESVYDPATNGARWLQPTAVLLPRFMRFNVQVDF*
Ga0063356_1054830721	3300004463	Arabidopsis Thaliana Rhizosphere	TNANTGTTFEASYDPATNGARWMRPTAVLQPRFVRFNVQFDF*
Ga0070670_1009884562	3300005331	Switchgrass Rhizosphere	VGFDLYNLLNANTPTAYETVYDPATNGARWLQPTSVLNARAARFNVQFDF*
Ga0070670_1012719951	3300005331	Switchgrass Rhizosphere	YNLFNSNTPTAYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0070670_1020671601	3300005331	Switchgrass Rhizosphere	NSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF*
Ga0070692_104186162	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	NTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0070675_1018479651	3300005354	Miscanthus Rhizosphere	LFNANTPTAYETVYDPATNGARWLQPTAVLNARAARFNVQFDF*
Ga0070671_1013110851	3300005355	Switchgrass Rhizosphere	NLFNANPATTYESVYDPASNGARWMQPTAVLNPRAQRLNAQFDF*
Ga0070673_1019435851	3300005364	Switchgrass Rhizosphere	YNLFNSNTATTYENVYDPATNGARWMQPTAVLLPRFMRFNIQVDF*
Ga0070667_1022523771	3300005367	Switchgrass Rhizosphere	LYNLFNANSPTVYETVYDVATNGARWLQPTTVLTGRATRFNAQFEF*
Ga0070701_105554661	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	NPPTTFETVFDVATVGARWLQPTAVLNPRAARLNVQFEF*
Ga0070694_1013811752	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	NLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0070678_1016957881	3300005456	Miscanthus Rhizosphere	IYNLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0070662_1002339141	3300005457	Corn Rhizosphere	RFFGKRTTVGMDGYNLFNANTPTTYESVYDVVTNGAKWMTPTAVLNARAARFNVQFDF*
Ga0070681_115653652	3300005458	Corn Rhizosphere	NSNTATTYENVYDPATNGARWMQPTAVLLPRFMRFNIQVDF*
Ga0068867_1001131431	3300005459	Miscanthus Rhizosphere	NLFNSNAGTAFETVYDPVTNGARWMQPTAVLNPRAARFNAQFEF*
Ga0070672_1015122911	3300005543	Miscanthus Rhizosphere	TATTYETVFDPATVGARWMQPTAVLTARATRFNAQFDF*
Ga0070695_1017083052	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	VYNLLNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0070665_1009507611	3300005548	Switchgrass Rhizosphere	TYESVYDPASNGARWMQPTAVLNPRAQRLNAQFDF*
Ga0070702_1005805181	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	GKYRANVGLDVYNLLNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0068859_1020691231	3300005617	Switchgrass Rhizosphere	NPATTYESVYDPASNGARWMQPTAVLNPRAQRLNAQFDF*
Ga0068861_1007756463	3300005719	Switchgrass Rhizosphere	YNLFNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0068861_1010667671	3300005719	Switchgrass Rhizosphere	YETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0066903_1006716774	3300005764	Tropical Forest Soil	YETVYDPATNGARWMQPTAVLLPRFTRVNVQVDF*
Ga0068858_1009728511	3300005842	Switchgrass Rhizosphere	TTYETVYDPDPTKNKWMNPTAVLLPRFMRFNVQVDF*
Ga0068862_1027202302	3300005844	Switchgrass Rhizosphere	GYNLFNANTPTTYESVYDVVTNGAKWMTPTAVLNARAARFNVQFDF*
Ga0081455_105888051	3300005937	Tabebuia Heterophylla Rhizosphere	YNLFNSNTATTYESVYDPATNGAKWLTPTAVLLPRFMRFNVQVDF*
Ga0070715_104383042	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	DLYNLFNSNTATAYETVFDVATVGARWMQPSAVLTGRALRFNVQFDF*
Ga0070715_108247542	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	LDLYNLFNANTATTYETVFDPATVGARWMQPTAVLTARATRFNAQFDF*
Ga0075422_104719622	3300006196	Populus Rhizosphere	PTTYESVYDVVTNGAKWMTPTAVLNARAARFNVQFDF*
Ga0097621_1002763201	3300006237	Miscanthus Rhizosphere	NSNTATAYETVFDVATVGARWMQPSAVLTGRALRFNVQFDF*
Ga0068871_1013014742	3300006358	Miscanthus Rhizosphere	AYETVFDPATAGARWLQPTAVLTARATRFNAQFEF*
Ga0068871_1021643072	3300006358	Miscanthus Rhizosphere	PTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0075421_1022447461	3300006845	Populus Rhizosphere	TTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0075433_114833082	3300006852	Populus Rhizosphere	GRYKANVGMDVYNVLNSNTPTTYENVYDPDPTKNKWMNPTAVLLPRFMRFNVQVDF*
Ga0079217_117253262	3300006876	Agricultural Soil	VDMRIAKVVRLGKYKANVGLDVYNLANSNTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0075429_1000725921	3300006880	Populus Rhizosphere	DVYNLLNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0068865_1022207052	3300006881	Miscanthus Rhizosphere	TPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0079215_115361231	3300006894	Agricultural Soil	TTVAMDGYNLFNANTPTAYETVYDVTTNGARWMSPTAVLNARAARFNVQFEF*
Ga0079216_100448762	3300006918	Agricultural Soil	ANVGLDLYNMFNANTPTNYESVYDPATNGARWMQPTGVLSPRFLRVNMQLDF*
Ga0066710_1038137731	3300009012	Grasslands Soil	TTYETVYDPATNGAKWMTPTAVLLSRFMRFNVQVDF
Ga0105244_106025232	3300009036	Miscanthus Rhizosphere	AYETVFDFATVGARWMQPTTVLNPRALRFNAQFEF*
Ga0105245_132461662	3300009098	Miscanthus Rhizosphere	YNLFNANTATTYETVFDVATSGARWMQPTAVLTPRATRFNVQFDF*
Ga0075418_105602213	3300009100	Populus Rhizosphere	GRMKANVGMDVYNVLNSNTPTTYETVYDPATNGARWMQPTAVLLPRFARFNVQVDF*
Ga0075418_117755892	3300009100	Populus Rhizosphere	GRMKANVGMDVYNVLNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0066709_1012242581	3300009137	Grasslands Soil	NTATTYETVYEFVTNGAKWMQPTAVLLPRFIRLNVQFDF*
Ga0066709_1012812332	3300009137	Grasslands Soil	YNLFNSNTATTYESVYDPGTNGARWLQPTAVLLPRFMRLNVQVDF*
Ga0114129_119336832	3300009147	Populus Rhizosphere	FNANTPAEYEQVFDPATDGARWMQPTSVLLPRFARLNIQFDF*
Ga0105243_110751271	3300009148	Miscanthus Rhizosphere	VDLYNLFNANPPTAYETVFDVATVGARWLQPTAVLNARAARFNVQFDF*
Ga0105243_115601941	3300009148	Miscanthus Rhizosphere	TYETVYDVATNGARWLQPTAVLTGRATRFNAQFEF*
Ga0105243_121827151	3300009148	Miscanthus Rhizosphere	MDLYNVLNANTPTAYETVYDPATNGAKWMQPTAVLLPRFARFNVQVDF*
Ga0111538_131945711	3300009156	Populus Rhizosphere	YENVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0105241_116012152	3300009174	Corn Rhizosphere	MDVYNLLNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0105238_114262341	3300009551	Corn Rhizosphere	FEATYDPASAGARWLLPTAVVQPRFMRFNVQVDF*
Ga0105249_107768041	3300009553	Switchgrass Rhizosphere	DIYHLMNANTATTYETVYDPATNGARWMKTTAVLLPRFMRFNVQVDF*
Ga0134062_106945542	3300010337	Grasslands Soil	FNANTPTTYETVYDPEKNGAKWMTPTAVLLSRFMRFNVQVDF*
Ga0126379_121305101	3300010366	Tropical Forest Soil	TAFETVYDPATNGSRWMNPTAVLNPRAARFNAQFDF*
Ga0126379_131776161	3300010366	Tropical Forest Soil	LFNSNTATTYESVYDPATNGAKWLTPTAVLLPRFMRFNVQVDF*
Ga0134122_110065332	3300010400	Terrestrial Soil	DVYNLFNSNTATTYENVYDPATNGARWMQPTAVLLPRFMRFNIQVDF*
Ga0134121_106840741	3300010401	Terrestrial Soil	NSNTPTTYESVYDPATNGARWMQPTAVLLPRFIRFNVQVDF*
Ga0134123_124115992	3300010403	Terrestrial Soil	LFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0137423_10990802	3300011430	Soil	PTTYETVYDPATNGARWMQPTAVLPPRFMRVNVQFDF*
Ga0150985_1085025282	3300012212	Avena Fatua Rhizosphere	DLYNLFNANNATTYETVFDPATVGAKWMQPTAVLTARATRFNAQFDF*
Ga0150985_1122348411	3300012212	Avena Fatua Rhizosphere	TYETVYDPATNGARWLQPTAVLLPRFMRFNVQFDF*
Ga0150985_1185242572	3300012212	Avena Fatua Rhizosphere	TPTAYETVYDPATNGARWLQPTAVLNARAARFNVQFDF*
Ga0157331_10311722	3300012486	Soil	LTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF*
Ga0157289_100037054	3300012903	Soil	YNLFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQFDF*
Ga0157283_103556242	3300012907	Soil	TYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0164298_106270761	3300012955	Soil	TPTTYETVYDPATNGAKWMTPTAVLLPRFMRFNVQVDF*
Ga0164306_108723151	3300012988	Soil	PTTYESVYDPATNGAKWLTPTAVLLPRFMRFNVQVDF*
Ga0157378_127539041	3300013297	Miscanthus Rhizosphere	NVGLDVYNLFNSNTPTTYETVYDPATNGAKWMTPTAVLLPRFMRFNVPFDF*
Ga0157380_101031431	3300014326	Switchgrass Rhizosphere	LMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0157377_101706933	3300014745	Miscanthus Rhizosphere	FNANTPTTYETVYDPATNGAKWMQPTAVLLPRFMRFNVQVDF*
Ga0173478_100123781	3300015201	Soil	TPTAYETVFDVATNGARWLQPTAVLAPRATRFNAQFDF*
Ga0132258_100135391	3300015371	Arabidopsis Rhizosphere	TAYETVFDPATAGARWLQPTAVLNPRATRFNVQLDF*
Ga0132256_1033133392	3300015372	Arabidopsis Rhizosphere	LFNSNTPTTYETVYDPATNGAKWLTPTAVLLPRFMRFNVQFDF*
Ga0132255_1008373591	3300015374	Arabidopsis Rhizosphere	GLDIYNLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0132255_1035987121	3300015374	Arabidopsis Rhizosphere	NLFNANPATAYETVFDPATAGARWLQPTAVLNPRATRFNVQLDF*
Ga0182036_103235922	3300016270	Soil	LDLYNLFSSNTATAYETVFDVATVGARWMQPSAVLTGRALRFNVQFDF
Ga0163161_104035421	3300017792	Switchgrass Rhizosphere	LFNSNTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0187765_105959731	3300018060	Tropical Peatland	NLFNANTATTYETVYDPATNGARWMQPTAVLLPRFTRLNVQVDF
Ga0190272_118713702	3300018429	Soil	SKRATAGLDLYNMFNANTPTGYESVYDPATNGARWMQPTGVLSPRFVRVNMQLDF
Ga0190268_104553132	3300018466	Soil	LNVNTPTTYETVYDPATNGARWMQPTAVLLPRFVRVNVQFDF
Ga0190268_124130812	3300018466	Soil	FGKYRTNVGLDVYNLLNSNTPTAYENVYDPNPAVQKWLQPTTVLLPRFMRFNVQVDF
Ga0190270_123118791	3300018469	Soil	GTTFEAAYDPATQGGRWLRPTAVLQPRFVRFNVQFDF
Ga0190274_137491752	3300018476	Soil	YNLFNANPPTAYETVFDVATVGARWLQPTAVLSPRATRFNVQFEF
Ga0190274_137950901	3300018476	Soil	NANAPTTFETVYDPATNGARWMQPTAVLNPRAARFNVQLDF
Ga0190271_101650583	3300018481	Soil	DLYNLLNANTPTTYEAVFDPASNGARWMQPTAVLTPRAARFNVQFEF
Ga0190271_104227543	3300018481	Soil	NTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0180119_12693991	3300019228	Groundwater Sediment	TPTTYETVYDPATNGARWMQPTAVLLPRFMRINVQLDF
Ga0173481_103226251	3300019356	Soil	TYETVYDPATNGAKWMQPTAVLLPRFMRFNIQVDF
Ga0173479_101162632	3300019362	Soil	SNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNIQVDF
Ga0210362_14029621	3300021329	Estuarine	LDVYNLFNRNTPTTYETVYDPATNGARWLQPTAVLLPRFMRVNVQLDF
Ga0213876_103551532	3300021384	Plant Roots	SNAPSLFETVYDVATNGARWLQPSAVISPRALRLNVDLTF
Ga0242665_102335921	3300022724	Soil	SNVPTTYETVYDPATNGAKWLTPTAVLQSRFMRFNVQVDF
Ga0247748_10372811	3300023168	Soil	TAYETVFDVATNGARWLQPTAVLAPRATRFNAQFDF
(restricted) Ga0233424_103346871	3300023208	Freshwater	YNLFNVNTPTTYETVYDPATNGARWLQPTAVLLPRFMRFNIQLDF
Ga0247660_10816561	3300024317	Soil	NSNTPTTYETVYDPATNGAKWLTPTAVLLPRFMRFNVQFDF
Ga0207645_100939433	3300025907	Miscanthus Rhizosphere	NLFNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0207694_108230042	3300025924	Corn Rhizosphere	GKTKTNVGLDVYNLFNSNTPTTYETVYDPATNGAKWMTPTAVLLPRFMRFNVQVDF
Ga0207701_101508433	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	AYETVFDVATNGARWLQPTAVLAPRATRFNAQFDF
Ga0207706_102268482	3300025933	Corn Rhizosphere	AYETVFDVATAGARWLQPTAVLQPRASRFNVQFDF
Ga0207669_106361061	3300025937	Miscanthus Rhizosphere	FNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0207669_112751281	3300025937	Miscanthus Rhizosphere	YNLFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQFDF
Ga0207669_119354711	3300025937	Miscanthus Rhizosphere	LMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0207691_107891721	3300025940	Miscanthus Rhizosphere	NTATTYETVFDPATVGARWMQPTAVLTARATRFNAQFDF
Ga0207689_110352001	3300025942	Miscanthus Rhizosphere	LFNSNTATTYETVYDPATNGAKWLQPTAVLLPRFMRFNVQFDF
Ga0207679_121554832	3300025945	Corn Rhizosphere	VRFGKYRTNVGMDIYNLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0207651_114141742	3300025960	Switchgrass Rhizosphere	LNSNTPTAYENVYDPNPAVQKWLQPTSVLLPRFMRFNVQVDF
Ga0207651_117340192	3300025960	Switchgrass Rhizosphere	DVYNLFNSNTATTYENVYDPATNGARWMQPTAVLLPRFMRFNIQVDF
Ga0207712_107411112	3300025961	Switchgrass Rhizosphere	NSNAGTAFETVYDPATNGARWMQPTAVLNPRAARFNAQFEF
Ga0207708_111305692	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	NPATAYETVFDVATVGARWLQPTAVLNPRAARFNVQFDF
Ga0207676_111966651	3300026095	Switchgrass Rhizosphere	RFGRYRTNVGVDVYNLTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF
Ga0207675_1008215572	3300026118	Switchgrass Rhizosphere	PTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0207675_1027140982	3300026118	Switchgrass Rhizosphere	KYRANVGLDVYNLMNSNTPTAYENVYDPNPAVQKWMQPTTVLLPRFMRFNVQVDF
Ga0207683_114263812	3300026121	Miscanthus Rhizosphere	TFEATYDPASNGERWMRPTAVVQPRFLRFNVQFDF
Ga0209971_10083045	3300027682	Arabidopsis Thaliana Rhizosphere	AYETVYDPATNGARWLQPTAVLLPRFMRFNVQVDF
Ga0209485_12179312	3300027691	Agricultural Soil	VGLDLYNMFNANTPTNYESVYDPATNGARWMQPTSVLSPRFLRVNMQLDF
Ga0209486_107611271	3300027886	Agricultural Soil	MFNANTPTGYESVYDPATNGERWMQPTGVLAPRFVRVNMQLDF
Ga0268266_102675281	3300028379	Switchgrass Rhizosphere	TTYESVYDPASNGARWMQPTAVLNPRAQRLNAQFDF
Ga0268265_104593842	3300028380	Switchgrass Rhizosphere	LYNLFNANTPTAYETVFDVATNGARWLQPTAVLAPRATRFNAQFDF
Ga0268265_113034021	3300028380	Switchgrass Rhizosphere	ANSNTATTYETVYDPATNGARWMQPTAVLLPRFMRLNVQVDF
Ga0268265_122940252	3300028380	Switchgrass Rhizosphere	FFGKRTTVGMDGYNLFNANTPTTYESVYDVVTNGAKWMTPTAVLNARAARFNVQFDF
Ga0307278_102713972	3300028878	Soil	TPTTFESTYDPASRGERWMQPTALLQPRFVRFNVQFDF
Ga0308189_101178862	3300031058	Soil	SNTPTNYESVYDPATSGARWMQPTSVLLPRFARVNVQLDF
Ga0307497_100665281	3300031226	Soil	NPPTAYETVFDVATVGARWLQPTAVLNPRAARFNVQFDF
Ga0307497_101743812	3300031226	Soil	VAAATLFETVYDPATNGARWMNPTAILNPRAARFNVQFDF
Ga0170820_173482372	3300031446	Forest Soil	GLDIYNLFNVNTPTTYESVYDPATNGAKWLTPTAVLASRFMRFNVQVDF
Ga0310888_101357221	3300031538	Soil	VLRFGRYRANVGMDVYNLLNANTPTTYETVYDPATNGARWMQPTAVLLARFMRFNVQVDF
Ga0310887_111061041	3300031547	Soil	NLTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF
Ga0318509_105814731	3300031768	Soil	YNLFNSNTPTTYESVYDPATNGAKWLTPTAVLLPRFMRFNVQVDF
Ga0310907_104932361	3300031847	Soil	NLFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0310904_112798741	3300031854	Soil	NVGVDVYNLTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0310892_106955482	3300031858	Soil	TPTAYENVYDPNPAVQKWMQPTAVLLPRFMRFNVQVDFQLSR
Ga0310900_100862454	3300031908	Soil	NLLNANAPTTFETVYDPATNGARWMQPTAVLNTRAARFNVQLDF
Ga0310900_103706722	3300031908	Soil	VGVDVYNLTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF
Ga0310900_119094272	3300031908	Soil	RTNVGLDVYNLLNSNTPTAYENVYDPNPAVQKWLQPTSVLLPRFMRFNVQVDF
Ga0307412_116074501	3300031911	Rhizosphere	NLLSANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0310885_102281542	3300031943	Soil	GRYRTNVGMDVYNLLNVNTPTTYETVYDPDPTRQKWMQPTAVLLPRFMRFNVQVDF
Ga0310885_105654521	3300031943	Soil	FGRSKVNVGLDIYNLLNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQLDF
Ga0307414_112973891	3300032004	Rhizosphere	NTPTNYETVFDPATSGARWMRPTGVLAPRFARVNMQLDF
Ga0310895_103979042	3300032122	Soil	LRFGKYRTNIGMDVYNLANSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0315912_102882793	3300032157	Soil	TYENVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0315912_114237912	3300032157	Soil	SNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0307470_118142691	3300032174	Hardwood Forest Soil	KTRTNVGLDMYNMFNSNTPTTYETVYDPATNGAKWMTPTAVLLPRFMRINVQVDF
Ga0326726_113375122	3300033433	Peat Soil	NLFNSNTATVYNEVFDVATAGAKWMQPTAVLTARATRFNAQFDF
Ga0364927_0174000_1_120	3300034148	Sediment	NTPTTYEAVFDPATNGARWMQPTAVLTPRAARFNVQFEF
Ga0314780_071549_583_729	3300034659	Soil	MDIYNLFNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters