| Basic Information | |
|---|---|
| Family ID | F045342 |
| Family Type | Metagenome |
| Number of Sequences | 153 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PPLTENIVLTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.65 % |
| % of genes near scaffold ends (potentially truncated) | 98.69 % |
| % of genes from short scaffolds (< 2000 bps) | 88.89 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.693 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.412 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.948 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.405 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 2.86% Coil/Unstructured: 97.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF08309 | LVIVD | 4.58 |
| PF02604 | PhdYeFM_antitox | 1.31 |
| PF07992 | Pyr_redox_2 | 0.65 |
| PF11175 | DUF2961 | 0.65 |
| PF00930 | DPPIV_N | 0.65 |
| PF00296 | Bac_luciferase | 0.65 |
| PF00571 | CBS | 0.65 |
| PF00365 | PFK | 0.65 |
| PF00180 | Iso_dh | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 4.58 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.31 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.31 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.65 |
| COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.65 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.65 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.69 % |
| Unclassified | root | N/A | 1.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104420759 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300000567|JGI12270J11330_10198918 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300001089|JGI12683J13190_1005904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1344 | Open in IMG/M |
| 3300001154|JGI12636J13339_1028250 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300002561|JGI25384J37096_10265115 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300002907|JGI25613J43889_10069396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300002914|JGI25617J43924_10362997 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300004092|Ga0062389_103271739 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005165|Ga0066869_10069697 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005175|Ga0066673_10890852 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005538|Ga0070731_10660309 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300005541|Ga0070733_10792057 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005552|Ga0066701_10865102 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005563|Ga0068855_100217350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 2145 | Open in IMG/M |
| 3300005586|Ga0066691_10002943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7093 | Open in IMG/M |
| 3300005602|Ga0070762_10036811 | All Organisms → cellular organisms → Bacteria | 2648 | Open in IMG/M |
| 3300005610|Ga0070763_10563250 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005617|Ga0068859_100500574 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300005718|Ga0068866_10317083 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300005764|Ga0066903_105222734 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005995|Ga0066790_10256105 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300006050|Ga0075028_100004709 | All Organisms → cellular organisms → Bacteria | 5237 | Open in IMG/M |
| 3300006086|Ga0075019_10975881 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006172|Ga0075018_10236887 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300006354|Ga0075021_10303794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 989 | Open in IMG/M |
| 3300006354|Ga0075021_10692621 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006755|Ga0079222_12154465 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006903|Ga0075426_11257953 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300007255|Ga0099791_10544819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300007258|Ga0099793_10006815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4233 | Open in IMG/M |
| 3300007788|Ga0099795_10294797 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300009038|Ga0099829_10166238 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300009143|Ga0099792_10772705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300009143|Ga0099792_10862760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300010046|Ga0126384_11805374 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010360|Ga0126372_10939353 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300010366|Ga0126379_12218020 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300010376|Ga0126381_104777860 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010379|Ga0136449_101573050 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300010379|Ga0136449_102106346 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300010398|Ga0126383_11423448 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300010398|Ga0126383_11891808 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300010937|Ga0137776_1762909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300011269|Ga0137392_11354581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300011270|Ga0137391_10384350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1202 | Open in IMG/M |
| 3300011270|Ga0137391_10516885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1009 | Open in IMG/M |
| 3300011270|Ga0137391_11402919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300011271|Ga0137393_10748486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300011271|Ga0137393_10852712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300011271|Ga0137393_11693262 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300012189|Ga0137388_10040039 | All Organisms → cellular organisms → Bacteria | 3725 | Open in IMG/M |
| 3300012202|Ga0137363_10172285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1717 | Open in IMG/M |
| 3300012202|Ga0137363_10984221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300012203|Ga0137399_10706738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300012203|Ga0137399_10737679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300012206|Ga0137380_10495185 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300012206|Ga0137380_11648648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300012207|Ga0137381_11235404 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012209|Ga0137379_11294577 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012361|Ga0137360_11137983 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300012362|Ga0137361_10500711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1116 | Open in IMG/M |
| 3300012362|Ga0137361_11791716 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012363|Ga0137390_10323586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1523 | Open in IMG/M |
| 3300012363|Ga0137390_10448185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1267 | Open in IMG/M |
| 3300012582|Ga0137358_10101767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1946 | Open in IMG/M |
| 3300012582|Ga0137358_11089176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300012683|Ga0137398_10809537 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300012917|Ga0137395_10090695 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300012922|Ga0137394_10966642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300012925|Ga0137419_10793594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300012929|Ga0137404_11597349 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012929|Ga0137404_11829698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300012930|Ga0137407_11423314 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300013307|Ga0157372_11829740 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300014156|Ga0181518_10507698 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300014162|Ga0181538_10011573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6764 | Open in IMG/M |
| 3300014165|Ga0181523_10028563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3609 | Open in IMG/M |
| 3300014968|Ga0157379_10585903 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300015052|Ga0137411_1292244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300015053|Ga0137405_1144209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300015241|Ga0137418_10140930 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
| 3300015264|Ga0137403_10335430 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300015356|Ga0134073_10079778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
| 3300016294|Ga0182041_10799920 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300016371|Ga0182034_11828812 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300016404|Ga0182037_10930728 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300017932|Ga0187814_10357296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300017975|Ga0187782_11106875 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300018062|Ga0187784_10109775 | All Organisms → cellular organisms → Bacteria | 2248 | Open in IMG/M |
| 3300018088|Ga0187771_10427702 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300018468|Ga0066662_10675117 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300019789|Ga0137408_1202424 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300020579|Ga0210407_10062341 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
| 3300020580|Ga0210403_11246797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300020581|Ga0210399_10043231 | All Organisms → cellular organisms → Bacteria | 3611 | Open in IMG/M |
| 3300020581|Ga0210399_10549173 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300020582|Ga0210395_10007153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8455 | Open in IMG/M |
| 3300021088|Ga0210404_10644656 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300021168|Ga0210406_10772654 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300021170|Ga0210400_10489994 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300021178|Ga0210408_10201971 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300021181|Ga0210388_11029080 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300021401|Ga0210393_11006840 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300021402|Ga0210385_10727122 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300021420|Ga0210394_11535285 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300021433|Ga0210391_11010626 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300021478|Ga0210402_10762044 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300021559|Ga0210409_11274320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300021560|Ga0126371_12993520 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300024224|Ga0247673_1025609 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300024284|Ga0247671_1042338 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300025910|Ga0207684_11517505 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300025934|Ga0207686_10506572 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300025939|Ga0207665_10700089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300026121|Ga0207683_12064438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 518 | Open in IMG/M |
| 3300026313|Ga0209761_1329550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300026333|Ga0209158_1210538 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300026555|Ga0179593_1171009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3035 | Open in IMG/M |
| 3300027535|Ga0209734_1015836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1375 | Open in IMG/M |
| 3300027546|Ga0208984_1107037 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300027610|Ga0209528_1154992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300027643|Ga0209076_1116557 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300027645|Ga0209117_1128529 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300027645|Ga0209117_1142676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300027680|Ga0207826_1214341 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300027725|Ga0209178_1160774 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300027862|Ga0209701_10574230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300027869|Ga0209579_10040625 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300027884|Ga0209275_10454889 | Not Available | 726 | Open in IMG/M |
| 3300027884|Ga0209275_10880480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300027894|Ga0209068_10109016 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300027894|Ga0209068_10126251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1368 | Open in IMG/M |
| 3300028536|Ga0137415_11178874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300028906|Ga0308309_11022289 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300031231|Ga0170824_127211720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300031235|Ga0265330_10367821 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031236|Ga0302324_103322799 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031754|Ga0307475_11452493 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031890|Ga0306925_10707130 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300031912|Ga0306921_12588303 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031946|Ga0310910_10036503 | Not Available | 3383 | Open in IMG/M |
| 3300031962|Ga0307479_10618717 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300031962|Ga0307479_11952369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300032025|Ga0318507_10242512 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300032094|Ga0318540_10043803 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
| 3300032160|Ga0311301_11369665 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300032180|Ga0307471_100599672 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300032261|Ga0306920_103139546 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300032828|Ga0335080_11535180 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300032892|Ga0335081_10675712 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300032954|Ga0335083_10995377 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300033158|Ga0335077_10283438 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300033158|Ga0335077_11924728 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.73% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.27% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.61% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.65% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1044207592 | 3300000364 | Soil | SENIVLTAGAAMLTPGDGFRDIYGGKTLFSLFGSVKFTF* |
| JGI12270J11330_101989181 | 3300000567 | Peatlands Soil | PPLSENLVLTGGASMLQPGQGFRDIYTGRTQFSLFGLAKFTF* |
| JGI12683J13190_10059042 | 3300001089 | Forest Soil | YRPPLTENIILTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF* |
| JGI12636J13339_10282502 | 3300001154 | Forest Soil | ENIVFTGGASALQPGQGFKDIYTSRTLFSLFGSVKVTF* |
| JGI25384J37096_102651151 | 3300002561 | Grasslands Soil | LAENIVVTGGASVLQPGQGFKDIYTGRTQFSLFGSVKFTF* |
| JGI25613J43889_100693961 | 3300002907 | Grasslands Soil | PLSENIVLTGGASALQPGQGFKDIYTGRTLFSLFGSVKLTF* |
| JGI25617J43924_103629972 | 3300002914 | Grasslands Soil | VEYRPPLTENIVLTGGASALQPGQGFKDIYTRRTLFSLFGSVKFSF* |
| Ga0062389_1032717391 | 3300004092 | Bog Forest Soil | QYRPPLSENISITGGAAALFPGQGFRDIYSGTTQFSLFATVHFQF* |
| Ga0066869_100696971 | 3300005165 | Soil | VIYRPPLSENIVITGGASALAPDNGFRDIYGGHTLFSLFTTVRFTF* |
| Ga0066673_108908521 | 3300005175 | Soil | PPLTENIVLTGGASALQPGQGFKDIYTGRTQFSLFGSVKFTF* |
| Ga0070731_106603092 | 3300005538 | Surface Soil | TENIVLTGGASALQPGRGFKDIYTSRTLFSLFGSVKFTF* |
| Ga0070733_107920572 | 3300005541 | Surface Soil | ITGGAAALFPGQGFRDIFTGTTQFSLFANVRFQF* |
| Ga0066701_108651022 | 3300005552 | Soil | RPPLTENIILTGGASALSPGQGFRDIYTGKTLFSLFGNVRFLF* |
| Ga0068855_1002173502 | 3300005563 | Corn Rhizosphere | LSENIVLTGGAAALQPGQGFKDIYTGRTLFSLFASAKLTF* |
| Ga0066691_100029435 | 3300005586 | Soil | EYRPPLTENIVLTGGASALRPGQGFQDIYTSRILFSLFGSVKFTF* |
| Ga0070762_100368111 | 3300005602 | Soil | PPLSENILLTGGASALRPGEGFKDIYTSRTLFSLFGSVKFTF* |
| Ga0070763_105632501 | 3300005610 | Soil | LGAEYRPPLTENIILTGGVSALTPEQAFRDLYTDRTLFSLFGSAKFTF* |
| Ga0068859_1005005742 | 3300005617 | Switchgrass Rhizosphere | SENIVLTGGAAMLTPGDGFRDIYGGKTLFSLFGSVKLVF* |
| Ga0068866_103170832 | 3300005718 | Miscanthus Rhizosphere | RPPLSENIVLTGGAAALQPGQGFKDIYTGRTLFSLFASAKLTF* |
| Ga0066903_1052227341 | 3300005764 | Tropical Forest Soil | NIVLTGGTAMLTPGGGFRDIYGGKTLFSLFGSAKLVF* |
| Ga0066790_102561052 | 3300005995 | Soil | VLTGGASMLQPGPGFHDIYTGRTQFSIFGVAKFTF* |
| Ga0075028_1000047091 | 3300006050 | Watersheds | SENISITGGAAALFPGQGFRDIFSGTTQFSLFANVRFQF* |
| Ga0075019_109758812 | 3300006086 | Watersheds | VEYRPPLTENIILTGGASMLQPGQGFRDIYTGRTLFSVFGSAKLTF* |
| Ga0075018_102368871 | 3300006172 | Watersheds | FQYRPPLSENISITGGAAALFPGQGFRDIFSGTTQFSLFANVRFQF* |
| Ga0075021_103037942 | 3300006354 | Watersheds | IVLTGGASALQPGQGFKDIYTSRTQFSLFGSVKFTF* |
| Ga0075021_106926211 | 3300006354 | Watersheds | IVITGGASALQPGQGFKDIYTSRTLFSLFGIVKFTF* |
| Ga0079222_121544651 | 3300006755 | Agricultural Soil | TENIVLTGGASALQPGQGFKDIYTGRTQFSLFGSVKFTF* |
| Ga0075426_112579532 | 3300006903 | Populus Rhizosphere | LTENIVLTGGASALQPGQGFKDIYTGRTQFSLFGSVKFTF* |
| Ga0099791_105448191 | 3300007255 | Vadose Zone Soil | LSENIILTGGASALQPGQGFKDIYTGRTLFSLFGSVKFTF* |
| Ga0099793_100068152 | 3300007258 | Vadose Zone Soil | NIVLTGGASALQPGRGFKDIYTSRTLFSLFGSVKFTF* |
| Ga0099795_102947972 | 3300007788 | Vadose Zone Soil | EYRPPLTENIILTGGVSALTPGQAFRDIYTGRTLFSLFGSAKFTF* |
| Ga0099829_101662382 | 3300009038 | Vadose Zone Soil | LGVIYRPPLSENIVLTGGASMLQPGQGFRDIYTGRTQFSIFGIAKFTF* |
| Ga0099792_107727052 | 3300009143 | Vadose Zone Soil | GEDFGVGAEYRPPLTENIVLTGGASAMQPGQGFKDIYTSRTLFSLFGSVKFTF* |
| Ga0099792_108627601 | 3300009143 | Vadose Zone Soil | ENIVLTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF* |
| Ga0126384_118053742 | 3300010046 | Tropical Forest Soil | SENIVLTGGASALTPGDGLRDIYGGHTLFSLFTSVRFTF* |
| Ga0126372_109393532 | 3300010360 | Tropical Forest Soil | VEYRPPLTENIVLTAGASALQPAQGFKDIYTGRTQFSLCGSAKFTF* |
| Ga0126379_122180202 | 3300010366 | Tropical Forest Soil | IVITGGASALTPGDGFRDIFGGHTLISLFTSVRFTF* |
| Ga0126381_1047778601 | 3300010376 | Tropical Forest Soil | GVGVEYRPPLTENIVLTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF* |
| Ga0136449_1015730501 | 3300010379 | Peatlands Soil | GVEYRPPLSENFVLTGGASMLQPGQGFRDIYTGRTQFSVFGVAKLTF* |
| Ga0136449_1021063462 | 3300010379 | Peatlands Soil | YRPPLSENISITGGAAALFPGQGFRDIFSGTTQFSLFANVRFQF* |
| Ga0126383_114234482 | 3300010398 | Tropical Forest Soil | GVEYRPPLTENIVLTGGASALQPGQGFKDIYTCRTQFSLFGSVKFTF* |
| Ga0126383_118918082 | 3300010398 | Tropical Forest Soil | IVITGGASALTPGDGFRDIYGGHTLFSLFTSVRFTF* |
| Ga0137776_17629091 | 3300010937 | Sediment | IGEDLGIGDEYRPPLTENIVLTGGASALQPAQGFKDIYTGRTQFSLFGSVKFTF* |
| Ga0137392_113545811 | 3300011269 | Vadose Zone Soil | TYRPPLTENIVLTGGASALQPGQGFKDIYTPRTLFSLFGPAKFTF* |
| Ga0137391_103843502 | 3300011270 | Vadose Zone Soil | EYRPPLTENIVLTGGASALQPGQGFKDIYTSRTLFSLFGSVKLTF* |
| Ga0137391_105168852 | 3300011270 | Vadose Zone Soil | GIGVEYRPPLTENVVLTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF* |
| Ga0137391_114029191 | 3300011270 | Vadose Zone Soil | GVTYRPPLSENIVLTGGAAMLTPGDGFRDVYGGKTLFSLFGSVKLTF* |
| Ga0137393_107484861 | 3300011271 | Vadose Zone Soil | NIVLTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF* |
| Ga0137393_108527123 | 3300011271 | Vadose Zone Soil | PPLTENIVLTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF* |
| Ga0137393_116932622 | 3300011271 | Vadose Zone Soil | DYGLGAEYRPPLTENIILTGGVSALTPGQAFRDIYTSRTLFSLFGSAKFTF* |
| Ga0137388_100400391 | 3300012189 | Vadose Zone Soil | LGVEYRPPLTENIVLTGGASALQPGQGFKDIYTGRTHFSLFGSVKFTF* |
| Ga0137363_101722851 | 3300012202 | Vadose Zone Soil | SENIILTGGASALQPGQGFKDIYTGRTLFSLFGSVKVTF* |
| Ga0137363_109842212 | 3300012202 | Vadose Zone Soil | VVTGGASALQPGQGFKDIYTGRTHFSLFGAVKFTF* |
| Ga0137399_107067382 | 3300012203 | Vadose Zone Soil | LTGGASVLQPGQGFKDIYTGRTLFSLFGSVKFMF* |
| Ga0137399_107376792 | 3300012203 | Vadose Zone Soil | VEYRPPLTENIVLTGGASALRPGQGFKDTYTSRTLFSLFGSVKFTF* |
| Ga0137380_104951851 | 3300012206 | Vadose Zone Soil | YRPPLTENIVLTGGASALRPGQGFKDIYTSRILFSLFGSVKFTF* |
| Ga0137380_116486482 | 3300012206 | Vadose Zone Soil | SENIVLTGGASALQPSQGFKDIYTNRTLFSLFGSVKFTF* |
| Ga0137381_112354042 | 3300012207 | Vadose Zone Soil | PPLTENMVLTGGASALTPGQGFRDIYTGKTLFSVFGAAKFTF* |
| Ga0137379_112945771 | 3300012209 | Vadose Zone Soil | PLTENMVLTGGASALTPGQGFRDIYTGKTLFSLFGAAKFTF* |
| Ga0137360_111379832 | 3300012361 | Vadose Zone Soil | RPPLSENIVLTGGASALTPGDGFRDIYGGHTLFSLFTSVRFTF* |
| Ga0137361_105007111 | 3300012362 | Vadose Zone Soil | GIGVEYRPPLTENIVLTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF* |
| Ga0137361_117917162 | 3300012362 | Vadose Zone Soil | GIGVEYRPPLTENIVLTGGASALRPGQGLKDIYTSRILFSLFGSVKFTF* |
| Ga0137390_103235861 | 3300012363 | Vadose Zone Soil | YRPPLTENIVLTGGASALQPGQGFKDIYTGRTLFSLFGSVKFTF* |
| Ga0137390_104481851 | 3300012363 | Vadose Zone Soil | NIVLTGGASAMQPGQGFKDIYTSRTLFSLFGSVKFTF* |
| Ga0137358_101017671 | 3300012582 | Vadose Zone Soil | NIVLTGGASALQPGQGFNDIYTSRMLFSLFGCVKFTF* |
| Ga0137358_110891762 | 3300012582 | Vadose Zone Soil | SENIVLTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF* |
| Ga0137398_108095371 | 3300012683 | Vadose Zone Soil | ISITGGASALTPAQGFRDLYSGKTQFSLFANLRFQF* |
| Ga0137395_100906952 | 3300012917 | Vadose Zone Soil | VGAEYRPPLTENIVLTGGVSALQPGQGFKDIYTSRTLFSLFGSVKFTF* |
| Ga0137394_109666422 | 3300012922 | Vadose Zone Soil | SENIILTGGASALQPGQGFKDIYTGRTLFSLFGSVKFTF* |
| Ga0137419_107935941 | 3300012925 | Vadose Zone Soil | PLTENIVLTGGASALQPGQGSKDIYTSRTLFSLFGSVKFTF* |
| Ga0137404_115973492 | 3300012929 | Vadose Zone Soil | LTGGASALTPGDGFRDIYGGHTLFSLFTSVRFTF* |
| Ga0137404_118296981 | 3300012929 | Vadose Zone Soil | NIVLTGGASALQPGQGFKDIYTGRTLFSLFGSVKVMF* |
| Ga0137407_114233141 | 3300012930 | Vadose Zone Soil | LTGGAAMLTPGDGFRDIYGGKTLFSLFGSVKFTF* |
| Ga0157372_118297401 | 3300013307 | Corn Rhizosphere | ALTGGAAALQPGQGFKDIYTGRTLFSLFASAKLTF* |
| Ga0181518_105076982 | 3300014156 | Bog | LSENISITGGVAALDPGQGFRDLYSGKTQFSLFTNVRFLF* |
| Ga0181538_100115736 | 3300014162 | Bog | SENLVLTGGAAMLQPGQGFRDIYTGRTQFSVFGLAKFTF* |
| Ga0181523_100285631 | 3300014165 | Bog | NLILTGGASMLQPGQGFRDIYTGRTQFSVFGLAKFTF* |
| Ga0157379_105859031 | 3300014968 | Switchgrass Rhizosphere | ILTGGAAALQPGQGFKDIYTGRTLFPLFASAKLTF* |
| Ga0137411_12922441 | 3300015052 | Vadose Zone Soil | NIILTGGTSALQPGQGFKDIYTGRTLFSFFGSVKFTF* |
| Ga0137405_11442092 | 3300015053 | Vadose Zone Soil | LSENIVLTGGASALQPGQGFKDIYTGRTLFSLFGSVKLTF* |
| Ga0137418_101409301 | 3300015241 | Vadose Zone Soil | ILTGGASALQPGEGFKDIYTGRTLFSLFGSVKLTF* |
| Ga0137403_103354302 | 3300015264 | Vadose Zone Soil | MYRPPLTENIILTGGASMLQPGQGFRDIYTGRTLFSVFGSAKLTF* |
| Ga0134073_100797782 | 3300015356 | Grasslands Soil | IEYRPPLTENIVLTGGASELQPGQGFKDIYTGRTQFSLFGSVKFTF* |
| Ga0182041_107999201 | 3300016294 | Soil | GIGVEYRPPLTENIVLTGGASALQPAQGFKDIYTGRTQFSLFGSVKFTF |
| Ga0182034_118288121 | 3300016371 | Soil | IILTGGASILQPGQGFRDIYTSRTLFSVFGMAKLTF |
| Ga0182037_109307281 | 3300016404 | Soil | MVLTGGAAMLQPGDGFRDMYGGKTLFSLFGSMRFTF |
| Ga0187814_103572961 | 3300017932 | Freshwater Sediment | IVLTGGASALQPGQGFRDIYTSRTLFSLFGSMKFTF |
| Ga0187782_111068751 | 3300017975 | Tropical Peatland | VQYRPPLSENLVLTGGASMLQPGQGFRDIYTGRTQFSVFGEAKFTF |
| Ga0187784_101097751 | 3300018062 | Tropical Peatland | PLSENLVLTGGASMLQPGQGFRDIYTGRTQFSVFGLAKFTF |
| Ga0187771_104277021 | 3300018088 | Tropical Peatland | LTENIVLTAGASELTPTKGFEDIYTRKTLFSVFANLRFQF |
| Ga0066662_106751172 | 3300018468 | Grasslands Soil | YRPPLTENIILTGGASALSPGQGFRDIYTGKTLFSLFGNVRFLF |
| Ga0137408_12024241 | 3300019789 | Vadose Zone Soil | PRSLPGASALTPGDGLRDVYGGHTLFSLFTSVRFTF |
| Ga0210407_100623412 | 3300020579 | Soil | IILTGGASMLQPGQGFRDIYTGRTLFSVFGSAKLTF |
| Ga0210403_112467972 | 3300020580 | Soil | ENIVLTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF |
| Ga0210399_100432311 | 3300020581 | Soil | EIIVLTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF |
| Ga0210399_105491732 | 3300020581 | Soil | NIILTGGASMLQPGQGFRDIYTGRTLFSVFGSAKLTF |
| Ga0210395_100071531 | 3300020582 | Soil | LSENIVFTGGASALQPGEGFKDIYTSRTLFSLFGSAKFTF |
| Ga0210404_106446561 | 3300021088 | Soil | CKNIVLTGGASALQPGQGFKDIYTSRTIFSLFGIVKFTF |
| Ga0210406_107726542 | 3300021168 | Soil | TENIILTGGASALQPGDGFKDIYTSRTLFSLFGSVKFTF |
| Ga0210400_104899942 | 3300021170 | Soil | PPLSENIILTGGASMLQPGQGFRDIYTGRTLFSVFGSAKLTF |
| Ga0210408_102019711 | 3300021178 | Soil | PPLTENIVLTGGASVLQPGQGFKDIYTSRTLFSLFGIVKFTF |
| Ga0210388_110290801 | 3300021181 | Soil | IILTGGASALQPGDGFKDIYTSRTLFSLFGSLKFTF |
| Ga0210393_110068402 | 3300021401 | Soil | RPPLSENIVLTGGASALQPGEGFKDIYTSRTLFSLFGSAKFTF |
| Ga0210385_107271221 | 3300021402 | Soil | ENIILTGGASVLQPGDGFKDIYTSRTLFSLFGSVKFTF |
| Ga0210394_115352851 | 3300021420 | Soil | LSENIVLTGGAAMLTPGAGFRDIYGGKTLFSLFSSVKLTF |
| Ga0210391_110106262 | 3300021433 | Soil | LTENIILTGGASMLQPGQGFRDIYTGRTLFSVFGSAKLTF |
| Ga0210402_107620442 | 3300021478 | Soil | NIVITGGASALQPGQGFKDIYTGRTLFSLFASAKFTF |
| Ga0210409_112743201 | 3300021559 | Soil | TYRPPLTENIVLTGGASVLQPGDGFKDIYTSRTLFSLFGSVKFTF |
| Ga0126371_129935201 | 3300021560 | Tropical Forest Soil | GIGVEYRPPLTENIVLTGGALALHPGEGFKDIYTGRTQFSLFGSLKFTF |
| Ga0247673_10256092 | 3300024224 | Soil | IGVTYRPALSENIVLTGGASALTPGDGFRDIYGGHTLFSLFTSVRFTF |
| Ga0247671_10423382 | 3300024284 | Soil | SENIVLTGGASALQPGEGFKDIYTSRTLFSLFGSVKFTF |
| Ga0207684_115175051 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EYRPPLTENIVLTGGASALQPGQGFKDIYTGRTQFSLFGSVKFTF |
| Ga0207686_105065721 | 3300025934 | Miscanthus Rhizosphere | RPPLSENIVLTGGTAMLTPGDGFRDIYGGKTLFSLFGSVKLVF |
| Ga0207665_107000891 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RPPLSENIVITGGASALLPGQGFRDVYSGKTQFSLFASVRFQF |
| Ga0207683_120644382 | 3300026121 | Miscanthus Rhizosphere | IVITGGVGTLIPGGGFKDIYTGRTLFSAFVNLRMVF |
| Ga0209761_13295501 | 3300026313 | Grasslands Soil | LAENIVVTGGASVLQPGQGFKDIYTGRTQFSLFGSVKFTF |
| Ga0209158_12105381 | 3300026333 | Soil | PPLTENIVLTGGASALQPGQGFKDIYTSRTLFSLFASVKLTF |
| Ga0179593_11710091 | 3300026555 | Vadose Zone Soil | VEYRPPLTENIVLTGGVSALQPGQGFKDIYTSRTLFSLFGSVKFTF |
| Ga0209734_10158361 | 3300027535 | Forest Soil | IVLTGGASALQPGQGFKDIYTGRTLFSLFGSAKFTF |
| Ga0208984_11070372 | 3300027546 | Forest Soil | IVLTGGAAALQPGQGFKDIYTGRTLFSLFGSVKFTF |
| Ga0209528_11549922 | 3300027610 | Forest Soil | PPLSENVVLTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF |
| Ga0209076_11165572 | 3300027643 | Vadose Zone Soil | ILTGGASALSPGQGFRDIYTGKTLFSLFGNVRFLF |
| Ga0209117_11285291 | 3300027645 | Forest Soil | LSENLILTGGAAMLQPGQGFRDFYTGRTQFSIFGLAKFTF |
| Ga0209117_11426761 | 3300027645 | Forest Soil | ENIILTGGAAALQPGQGFKDIYTSRTLFSLFGSMKFTF |
| Ga0207826_12143411 | 3300027680 | Tropical Forest Soil | PLSENIVLTGGASVLQPGPGFRDIYTGRTQFSVFGSAKFTF |
| Ga0209178_11607741 | 3300027725 | Agricultural Soil | LTENIVLTGGASALQPGQGFRDIYTGRTQFSLFGSARFTF |
| Ga0209701_105742301 | 3300027862 | Vadose Zone Soil | LAENIILTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF |
| Ga0209579_100406251 | 3300027869 | Surface Soil | RPPLTENIVFTFGASGLTPGQGFRDIYGGQTLFSLFADLRFTF |
| Ga0209275_104548892 | 3300027884 | Soil | SENIVLIGGASAFQPGQGFSDIYTSRTLFSLFGSVKFTF |
| Ga0209275_108804801 | 3300027884 | Soil | GVTYRPPLTENIVLTGGASALQPGDGFKDIYTSRTLFSLFGSVKFTF |
| Ga0209068_101090161 | 3300027894 | Watersheds | IVITGGASALQPGQGFKDIYTSRTLFSLFGIVKFTF |
| Ga0209068_101262512 | 3300027894 | Watersheds | LTENIVLTGGASALQPGQGFKDIYTSRTQFSLFGSVKFTF |
| Ga0137415_111788741 | 3300028536 | Vadose Zone Soil | PLTENVVLTGGASALQPGQGFKDIYTSRTLFSLFGSVKFTF |
| Ga0308309_110222892 | 3300028906 | Soil | PPLTENIVLTAGASALQPGAGFKDIYTSRTLFSLFGSMKFTF |
| Ga0170824_1272117201 | 3300031231 | Forest Soil | PPLSENIVLTAGASALQPGQGFRDIYSGRTLFSLFGAVKFTF |
| Ga0265330_103678211 | 3300031235 | Rhizosphere | FQYRPPLSENISITGGASALSPGQGFRDLYSGKTQFSLFANVRFQF |
| Ga0302324_1033227992 | 3300031236 | Palsa | YRPPLSENISITGGAAALLPGQGFRDIYTGKIQFSVFANVRFQF |
| Ga0307475_114524931 | 3300031754 | Hardwood Forest Soil | VLTGGAAMLTPGQGFRDIYGGKTLFSLFGSVKLTF |
| Ga0306925_107071302 | 3300031890 | Soil | PALSENMVLTGGAAMLQPGDGFRDMYGGKTLFSLFGSMRFTF |
| Ga0306921_125883032 | 3300031912 | Soil | VLTGGASVLQPGQGFKDIYTSRTLFSLFGIVKFTF |
| Ga0310910_100365031 | 3300031946 | Soil | VLTGGTAMLTPGDGFRDIYGGKTLFSLFASAKLVF |
| Ga0307479_106187171 | 3300031962 | Hardwood Forest Soil | YRPPLTENIILTGGASMLQPGQGFRDIYTGRTLFSVFGSAKLTF |
| Ga0307479_119523692 | 3300031962 | Hardwood Forest Soil | PPLTENIVLTGGASALQPGQGFKDIYTGRTLFSLFGSVKLTF |
| Ga0318507_102425122 | 3300032025 | Soil | IVLTGGTAMLTPGDGFRDIYGGKTLFSLFASAKLVF |
| Ga0318540_100438032 | 3300032094 | Soil | ENIVLTAGASALQPAQGFKDIYTGRTQFSLCGSAKFTF |
| Ga0311301_113696652 | 3300032160 | Peatlands Soil | QYRPPLSENISITGGAAALFPGQGFRDIFSGTTQFSLFANVRFQF |
| Ga0307471_1005996721 | 3300032180 | Hardwood Forest Soil | LSENIILTGGASMLQPGQGFRDIYTGRTLFSVFGSAKLTF |
| Ga0306920_1031395461 | 3300032261 | Soil | ENIVLTGGVSMLQPGQGFRDIYTSRTLFSVFGSAKLTF |
| Ga0335080_115351802 | 3300032828 | Soil | GAEYRPPLTENIVIRAGAGALSPGQGFRDIYSGKTLLSAFADVRFQF |
| Ga0335081_106757121 | 3300032892 | Soil | RPPLSENISITGGASALSPGQGFRDLYSGKTQFSLFGNVRLQF |
| Ga0335083_109953771 | 3300032954 | Soil | QYRPPLSENISITGGASALSPGQGFRDLYSGKTQFSLFGNVRFQF |
| Ga0335077_102834382 | 3300033158 | Soil | YRPPLSENIVLTGGASMLQPGQGFRDIYTGRTEFSAFGQAKLTF |
| Ga0335077_119247282 | 3300033158 | Soil | SENIVLTAGAAALQPGQGFRDIYTRRTLFSLFGSAKFTF |
| ⦗Top⦘ |