| Basic Information | |
|---|---|
| Family ID | F045332 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 39 residues |
| Representative Sequence | YGTINGIDGDTVILKIADQVKIRIARSAIAQVEASEDAK |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.35 % |
| % of genes from short scaffolds (< 2000 bps) | 89.54 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.346 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.608 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.451 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.673 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 5.97% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF07549 | Sec_GG | 92.16 |
| PF02699 | YajC | 3.92 |
| PF02472 | ExbD | 1.31 |
| PF07626 | PSD3 | 0.65 |
| PF02355 | SecD_SecF | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 92.81 |
| COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 92.81 |
| COG1862 | Protein translocase subunit YajC | Intracellular trafficking, secretion, and vesicular transport [U] | 3.92 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 1.31 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.35 % |
| Unclassified | root | N/A | 0.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003370|JGI26337J50220_1032094 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300004092|Ga0062389_100333590 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300005171|Ga0066677_10034463 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
| 3300005176|Ga0066679_10916927 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005177|Ga0066690_10832852 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005177|Ga0066690_11011447 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005332|Ga0066388_102136337 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300005332|Ga0066388_103841513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300005343|Ga0070687_100632443 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300005921|Ga0070766_11110006 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006050|Ga0075028_100173932 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300006059|Ga0075017_101081134 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006172|Ga0075018_10646112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300006173|Ga0070716_100701510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300006176|Ga0070765_100389647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1299 | Open in IMG/M |
| 3300006755|Ga0079222_10271786 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300006791|Ga0066653_10713077 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006800|Ga0066660_10679818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300006893|Ga0073928_10561640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300006903|Ga0075426_10773898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300007076|Ga0075435_102046351 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300007255|Ga0099791_10048214 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
| 3300007265|Ga0099794_10514391 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300007265|Ga0099794_10691779 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009012|Ga0066710_104333345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300009088|Ga0099830_10634792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300009088|Ga0099830_10945978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300009088|Ga0099830_11682120 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300009089|Ga0099828_10726295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
| 3300009089|Ga0099828_10794377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300009089|Ga0099828_11294139 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300009176|Ga0105242_10289625 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300009683|Ga0116224_10466141 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010047|Ga0126382_10505638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 972 | Open in IMG/M |
| 3300010048|Ga0126373_12933864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300010304|Ga0134088_10031077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2409 | Open in IMG/M |
| 3300010358|Ga0126370_11509854 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300010360|Ga0126372_11201963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300010361|Ga0126378_10981795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 949 | Open in IMG/M |
| 3300010376|Ga0126381_103497477 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300010398|Ga0126383_11010407 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300011120|Ga0150983_12945438 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300011120|Ga0150983_12976803 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300011271|Ga0137393_10308567 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300011271|Ga0137393_10312996 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300012096|Ga0137389_10375991 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300012096|Ga0137389_10432393 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300012198|Ga0137364_10577029 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300012208|Ga0137376_11463430 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300012361|Ga0137360_10212683 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300012377|Ga0134029_1180203 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300012389|Ga0134040_1242450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 535 | Open in IMG/M |
| 3300012917|Ga0137395_11267498 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012922|Ga0137394_10355459 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300012924|Ga0137413_10028711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3028 | Open in IMG/M |
| 3300012927|Ga0137416_10960174 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012931|Ga0153915_12115862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300012971|Ga0126369_10195340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1946 | Open in IMG/M |
| 3300014151|Ga0181539_1112769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1127 | Open in IMG/M |
| 3300015051|Ga0137414_1131231 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300015051|Ga0137414_1149280 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
| 3300015054|Ga0137420_1190117 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300016270|Ga0182036_11232318 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300016319|Ga0182033_11203599 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300016341|Ga0182035_11084726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300016357|Ga0182032_10254157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1367 | Open in IMG/M |
| 3300017942|Ga0187808_10135059 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300018060|Ga0187765_11155673 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300018088|Ga0187771_11286624 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300018433|Ga0066667_12123902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 520 | Open in IMG/M |
| 3300019788|Ga0182028_1381768 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300020140|Ga0179590_1014350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1773 | Open in IMG/M |
| 3300020579|Ga0210407_10295182 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300020581|Ga0210399_10035183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4008 | Open in IMG/M |
| 3300020582|Ga0210395_10513116 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300020582|Ga0210395_10885219 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300021168|Ga0210406_11178103 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300021178|Ga0210408_10093643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2359 | Open in IMG/M |
| 3300021401|Ga0210393_11355177 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300021405|Ga0210387_10288844 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300021406|Ga0210386_10120964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2165 | Open in IMG/M |
| 3300021432|Ga0210384_10573231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1015 | Open in IMG/M |
| 3300021474|Ga0210390_10117262 | All Organisms → cellular organisms → Bacteria | 2229 | Open in IMG/M |
| 3300021474|Ga0210390_11285059 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300021475|Ga0210392_10619126 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300021476|Ga0187846_10269753 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300021477|Ga0210398_10791348 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300021478|Ga0210402_10253975 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300021855|Ga0213854_1014681 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300022530|Ga0242658_1116663 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300022711|Ga0242674_1051144 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300022717|Ga0242661_1111611 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300022726|Ga0242654_10025728 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300024325|Ga0247678_1063730 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300024330|Ga0137417_1280630 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300025899|Ga0207642_10839136 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300025961|Ga0207712_11762897 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300025961|Ga0207712_11792204 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300026285|Ga0209438_1041612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1521 | Open in IMG/M |
| 3300026315|Ga0209686_1085388 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300026319|Ga0209647_1214304 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300026332|Ga0209803_1234772 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300026334|Ga0209377_1100749 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300026376|Ga0257167_1040449 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300026538|Ga0209056_10020432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6471 | Open in IMG/M |
| 3300026540|Ga0209376_1072223 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
| 3300026551|Ga0209648_10083262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2664 | Open in IMG/M |
| 3300026551|Ga0209648_10429854 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300026557|Ga0179587_10573047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300027460|Ga0207506_1004358 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300027562|Ga0209735_1142046 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300027729|Ga0209248_10109581 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300027846|Ga0209180_10272904 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300027862|Ga0209701_10131838 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300027862|Ga0209701_10691057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300027867|Ga0209167_10798777 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300028573|Ga0265334_10116948 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300028906|Ga0308309_11890886 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300030618|Ga0311354_10220789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2011 | Open in IMG/M |
| 3300030707|Ga0310038_10243750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300030738|Ga0265462_12388979 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300030879|Ga0265765_1000905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2595 | Open in IMG/M |
| 3300030940|Ga0265740_1012239 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300031231|Ga0170824_100645526 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300031546|Ga0318538_10149903 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300031590|Ga0307483_1022926 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031590|Ga0307483_1035183 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300031668|Ga0318542_10663217 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031708|Ga0310686_103473405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5054 | Open in IMG/M |
| 3300031718|Ga0307474_10242195 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300031753|Ga0307477_10178445 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300031753|Ga0307477_10281128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1150 | Open in IMG/M |
| 3300031753|Ga0307477_10383922 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300031754|Ga0307475_10072551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2634 | Open in IMG/M |
| 3300031754|Ga0307475_10376902 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300031754|Ga0307475_10607837 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300031795|Ga0318557_10272462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300031820|Ga0307473_10139683 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300031823|Ga0307478_10771290 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300031833|Ga0310917_10593459 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300031879|Ga0306919_10070179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2384 | Open in IMG/M |
| 3300031945|Ga0310913_10380192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1001 | Open in IMG/M |
| 3300031946|Ga0310910_10416734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1064 | Open in IMG/M |
| 3300031962|Ga0307479_10288388 | Not Available | 1622 | Open in IMG/M |
| 3300032044|Ga0318558_10487382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300032059|Ga0318533_10759678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300032180|Ga0307471_100796608 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300032180|Ga0307471_100908749 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300032261|Ga0306920_102332912 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300032782|Ga0335082_11349377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300032954|Ga0335083_11139529 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300033158|Ga0335077_10487518 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300033402|Ga0326728_10181537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2174 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.31% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.65% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.65% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.65% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.65% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.65% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027460 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26337J50220_10320941 | 3300003370 | Bog Forest Soil | GTVSGIDGDSLILKISAEPPVKIRISRTAIAQVEASQDAK* |
| Ga0062389_1003335902 | 3300004092 | Bog Forest Soil | GGIYGTINGIDGETVILKIADTGSAPVKIRIARSAITQVEASEDAK* |
| Ga0066677_100344633 | 3300005171 | Soil | TGSGIYGTISGIDGDAVIMKISSEPQVKIRIARAAIAQVEAPENAK* |
| Ga0066679_109169271 | 3300005176 | Soil | YGTVNGIDGDSVILKISSEPQVKIRIARAAIAQVEASEDAK* |
| Ga0066690_108328521 | 3300005177 | Soil | SGIYGTISGIDGDSVIMKISSEPQVKIRIARAAIAQVETSEDAK* |
| Ga0066690_110114472 | 3300005177 | Soil | GIYGVINGIDGDTVILKIADTGSSPVKIRVARSAITQVEASEDAK* |
| Ga0066388_1021363372 | 3300005332 | Tropical Forest Soil | GIYGTVNGFDGEVVILRIAEQVKIRISRSAIAQVEATEDAK* |
| Ga0066388_1038415132 | 3300005332 | Tropical Forest Soil | GIYGTINGIDGDTIILKIADNVKIRVARAAIGQVEASEDAK* |
| Ga0070687_1006324432 | 3300005343 | Switchgrass Rhizosphere | NGGIYGTINGIDGDTVILKIADTGSSPVKIRIARSAITQVEATEDAK* |
| Ga0070766_111100061 | 3300005921 | Soil | INGIDGDSVILKISAEPQVKIRVARAAIAQVEASEDAK* |
| Ga0075028_1001739321 | 3300006050 | Watersheds | GTINGIDGDTIILKIADQVKIRVARAAIAQVEASEDAKT* |
| Ga0075017_1010811342 | 3300006059 | Watersheds | VINGFDGDTVILKIADSGSSPVKIRIARSAITQVETTEDAK* |
| Ga0075018_106461122 | 3300006172 | Watersheds | SGMDGETVILKIAEQVKIRIARSAIVQVEASQDAS* |
| Ga0070716_1007015102 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DTVILKIADTGSSAVKIRIARSAITQVEAPEDAK* |
| Ga0070765_1003896471 | 3300006176 | Soil | YGTVNGMDGDTVILKIADNVKIRIARAAIAQVEASDDAK* |
| Ga0079222_102717862 | 3300006755 | Agricultural Soil | TGSGIYGTISGIDGEAVILKISSEPQVKIRIARAAIAQVETQEDAK* |
| Ga0066653_107130772 | 3300006791 | Soil | NGIDGDSVILKISAEPQVKIRISRAAIAQVEASQDAK* |
| Ga0066660_106798181 | 3300006800 | Soil | TVNGIDGDSVILKISSEPQVKIRVARAAIAQVEASEDAK* |
| Ga0073928_105616401 | 3300006893 | Iron-Sulfur Acid Spring | NGLDGDSVILKIATDPQVKIRVARSAIAQVETPEDAK* |
| Ga0075426_107738981 | 3300006903 | Populus Rhizosphere | YGTINGMDGDTIILKVADNVKIRVARAAIAQVEASEDAK* |
| Ga0075435_1020463512 | 3300007076 | Populus Rhizosphere | GSGIYGTVSGIDGESVILKISSEPQVKIRIARAAIAQVETQEDAK* |
| Ga0099791_100482142 | 3300007255 | Vadose Zone Soil | IYGTVNGIDGDSVILRISSEPQVKIRIARAAIAQVEASEDAK* |
| Ga0099794_105143912 | 3300007265 | Vadose Zone Soil | GDTVILKIADTGSSPVKIRIARSAITQVEASEDAK* |
| Ga0099794_106917791 | 3300007265 | Vadose Zone Soil | IYGTINRMDGDTVILKVADNVKIRVARAAIAQVEASDDAK* |
| Ga0066710_1043333452 | 3300009012 | Grasslands Soil | SGMDGDTLILKIADTGSAAVKIRVARSAIAQVEASEDAKS |
| Ga0099830_106347922 | 3300009088 | Vadose Zone Soil | IYGTISGIDGETVILRIADQVKIRVARSAITQVEETEDAK* |
| Ga0099830_109459781 | 3300009088 | Vadose Zone Soil | GIYGTINGIDGDSVILKISSEPQVKIRIARAAIAQVEASEDAK* |
| Ga0099830_116821201 | 3300009088 | Vadose Zone Soil | ITNGGIYGVINGIDGDTVILKIADTGSSPVKIRIARSAITQVEASEDAK* |
| Ga0099828_107262951 | 3300009089 | Vadose Zone Soil | IYGTVNGIDGDSVILKISSEPQVKIRIARAAIAQVEAPEDAK* |
| Ga0099828_107943771 | 3300009089 | Vadose Zone Soil | GGIYGTVNGIDGDSVILKISSEPQVKIRIARAAIAQVEAPEDAK* |
| Ga0099828_112941391 | 3300009089 | Vadose Zone Soil | NGMDGDTVILKIADTGSSPVKIRIARSAITQVEASEDAK* |
| Ga0105242_102896251 | 3300009176 | Miscanthus Rhizosphere | YGTVNGIDGDTVILKIADQVKIRIARSAIAQVEATEDAK* |
| Ga0116224_104661411 | 3300009683 | Peatlands Soil | TSGIYGTVNGIDGDTFILKVADNVKIRIARAAIAQVEAPEDAK* |
| Ga0126382_105056381 | 3300010047 | Tropical Forest Soil | GTVSGIDGDCVIMKISSEPQVKIRIARAAIAQVEASEDAK* |
| Ga0126373_129338642 | 3300010048 | Tropical Forest Soil | GIDGETVILKIADQVKIRISRAAIAQVEATEDAK* |
| Ga0134088_100310771 | 3300010304 | Grasslands Soil | GIDGDSVILKISSEPQVKIRIARAAIAQVEASEDAK* |
| Ga0126370_115098541 | 3300010358 | Tropical Forest Soil | VNGIDADIIILKIADQVKIRIARSAIAQVEATEDAK* |
| Ga0126372_112019631 | 3300010360 | Tropical Forest Soil | TSGIYGTINGMDGDTIILKVADNVKIRVARAAIAQVEASEDAK* |
| Ga0126378_109817952 | 3300010361 | Tropical Forest Soil | ISGIDGDAVIMKISSEPQVKIRIARAAIAQVEAQEDAK* |
| Ga0126381_1034974771 | 3300010376 | Tropical Forest Soil | INGIDGDTIILKIADTGSSPVKIRIARAAIAQVEASEDAK* |
| Ga0126383_110104071 | 3300010398 | Tropical Forest Soil | INGIDGDTIILKIADNVKIRVARAAIGQVEASDDAK* |
| Ga0150983_129454382 | 3300011120 | Forest Soil | SGIDGDSAILKISSEPQVKIRISRAAIAQVEASEDAK* |
| Ga0150983_129768032 | 3300011120 | Forest Soil | TINGIDGDTVILKIADQVKIRIARSAIAQVEASEDAK* |
| Ga0137393_103085672 | 3300011271 | Vadose Zone Soil | INGIDGDSVILKISSEPQVKIRIARAAIAQVEASEDAK* |
| Ga0137393_103129961 | 3300011271 | Vadose Zone Soil | IDGDSVILKISSEPQVKIRIARAAIAQVEASEDAK* |
| Ga0137389_103759912 | 3300012096 | Vadose Zone Soil | GGIYGTVNGLDGDSIILKISSEPQVKIRVARAAIAQVEALEDAK* |
| Ga0137389_104323931 | 3300012096 | Vadose Zone Soil | NGIDGDSVILKISSEPQVKIRIARAAIAQVEAPEDAK* |
| Ga0137364_105770291 | 3300012198 | Vadose Zone Soil | TINGIDGDSVILKISAEPQVKIRISRAAIAQVEASEDAK* |
| Ga0137376_114634302 | 3300012208 | Vadose Zone Soil | GIYGTVNGIDGDSVILKISSEPQVKIRIARAAIAQVEASEDAK* |
| Ga0137360_102126832 | 3300012361 | Vadose Zone Soil | NGIDGDSVILKISSEPQVKIRIARAAIAQVEASEDAK* |
| Ga0134029_11802032 | 3300012377 | Grasslands Soil | VNGIDGDSVILKISSEPQVKIRIARAAIAQVEASEDAK* |
| Ga0134040_12424501 | 3300012389 | Grasslands Soil | TISGLDGDSVIMKISSEPQVKIRVARAAIAQVETSQDAK* |
| Ga0137395_112674982 | 3300012917 | Vadose Zone Soil | YGTVSGIDGDTVILKIADQVKIRILRSAIAQVEVEENVS* |
| Ga0137394_103554592 | 3300012922 | Vadose Zone Soil | TINGIDGDSVILKISSEPQVKIRIARAAIAQVEASEDAK* |
| Ga0137413_100287111 | 3300012924 | Vadose Zone Soil | GIDGDSVILKISSEPQVKIRISRAAIAQVEASEDAK* |
| Ga0137416_109601742 | 3300012927 | Vadose Zone Soil | NGIDGDTVILKIADTGSSPVKIRIARSAITQVEASEDAK* |
| Ga0153915_121158621 | 3300012931 | Freshwater Wetlands | TVAGIDGEAVILRIADQVKIRVARSAIAQVEGSENEK* |
| Ga0126369_101953402 | 3300012971 | Tropical Forest Soil | GTINGMDGDTIILKIADNVKIRIARAAIAQVEASDDAK* |
| Ga0181539_11127692 | 3300014151 | Bog | GMDGDTIILKIADNVKIRIARAAIARVEAAEDAAK* |
| Ga0137414_11312312 | 3300015051 | Vadose Zone Soil | IYGTINGMDGDTVILKIADNVKIRIARAAIAQVEASDDAK* |
| Ga0137414_11492804 | 3300015051 | Vadose Zone Soil | WSYQCIDGDTVILKIADTGSSPVKIRIARSAITQVEASEDAK* |
| Ga0137420_11901171 | 3300015054 | Vadose Zone Soil | DSVILRISSEPQVKIRIALAAIAAAIAQVEASEDAK* |
| Ga0182036_112323181 | 3300016270 | Soil | NGLDGDTVILKIADQVKIRVLRSAIAQVEVSEDAK |
| Ga0182033_112035991 | 3300016319 | Soil | NGLDGDTVILKIADQVKIRILRSAIAQVEASEDAK |
| Ga0182035_110847261 | 3300016341 | Soil | IYGTINGMDGDTIILKIADNVKIRIARAAIAQVEASDDAK |
| Ga0182032_102541572 | 3300016357 | Soil | SGIYGTINGMDGDTIILKIADNVKIRIARAAIAQVEASNDAK |
| Ga0187808_101350591 | 3300017942 | Freshwater Sediment | TSGIYGTINGIDGDTFILKVADNVKIRIARAAIAQVETTEDAK |
| Ga0187765_111556732 | 3300018060 | Tropical Peatland | TSGIYGTINGIDGDTIILKIADNVKIRIARAAIGQVEASDDAK |
| Ga0187771_112866241 | 3300018088 | Tropical Peatland | SGIYGTVNGMDGDTIILKIADNVKIRIARAAIAQVEAPEDAAK |
| Ga0066667_121239022 | 3300018433 | Grasslands Soil | YGTISGIDGDSVIMKISSEPQVKIRIARAAIAQVETSEDAK |
| Ga0182028_13817683 | 3300019788 | Fen | MAMDGDTIILKIADNVKIRIARAAIAQVEAPQDAAK |
| Ga0179590_10143501 | 3300020140 | Vadose Zone Soil | INGIDGDTVILKIADTGSSPVKIRIARSAITQVEASEDAK |
| Ga0210407_102951822 | 3300020579 | Soil | SGIYGTINGIDGDTVILKIADQVKIRIARSAIAQVEASEDAK |
| Ga0210399_100351831 | 3300020581 | Soil | GTINGMDGDTVILKVADNVKIRVARAAIAQVEASDDAK |
| Ga0210395_105131161 | 3300020582 | Soil | NGFDGETVILKIAEQVKIRIARSAITQVETTEDAK |
| Ga0210395_108852192 | 3300020582 | Soil | NGIDGDSVILKISTEPQVKIRISRAAIAQVEASEDAK |
| Ga0210406_111781032 | 3300021168 | Soil | GIYGTINGLDGDTVILKIADQVKIRIARSAISQVETTEDAK |
| Ga0210408_100936431 | 3300021178 | Soil | NAGIYGTISGIDGETVILKIADTGSSPVKIRIARSAISQVEASEDAK |
| Ga0210393_113551772 | 3300021401 | Soil | GTINGFDGETVILKIAEQVKIRIARSAITQVETTEDAK |
| Ga0210387_102888441 | 3300021405 | Soil | IDGDSLILKISAEPPVKIRILRSAIAQVEASEDAK |
| Ga0210386_101209641 | 3300021406 | Soil | MTSGGIYGVINGFDGDTVILKIADSGSSPVKIRIARSAITQVETPEDAK |
| Ga0210384_105732312 | 3300021432 | Soil | TNGGIYGVINGIDGDTVILKIADTGSSPVKIRIARSAITQVEASEDAK |
| Ga0210390_101172621 | 3300021474 | Soil | YGTINGIDGDTVILKIADQVKIRIARSAIAQVEASEDAK |
| Ga0210390_112850591 | 3300021474 | Soil | GIYGTINGFDGETVILKIADQVKIRIARSAITQVETTEDAK |
| Ga0210392_106191261 | 3300021475 | Soil | GTINGIDGETVILKIADAGSSPVKIRIARAAIAQVEASEDAK |
| Ga0187846_102697531 | 3300021476 | Biofilm | VSGLDGDSLILKISNEPQVKIRVARVAIAQVEASEDAK |
| Ga0210398_107913481 | 3300021477 | Soil | YGTINGIDGDTVILKIADQVKIRIARSAIAQVEASEDAN |
| Ga0210402_102539751 | 3300021478 | Soil | GIYGTINGLDGDTVILKIADQVKIRIARSAITQVETPEDAK |
| Ga0213854_10146811 | 3300021855 | Watersheds | YGTINGIDGDSVILKISSEPQVKIRISRAAIAQVEASEDAK |
| Ga0242658_11166632 | 3300022530 | Soil | GTINGMDGDTVILKIADNVKIRVARAAIAQVEASDDAK |
| Ga0242674_10511442 | 3300022711 | Soil | NSGIYGTINGIDGETVILKIADQVKIRIARSAIAQVEASEDAK |
| Ga0242661_11116111 | 3300022717 | Soil | GIYGVINGFDGDTVILKIADSGSSPVKIRIARSAITQVETPEDAK |
| Ga0242654_100257281 | 3300022726 | Soil | IYGTINGIDGETVILKIADQVKIRIARSAIAQVEASEDAK |
| Ga0247678_10637302 | 3300024325 | Soil | NGIDGETIILKIADQVKIRIARSAIAQVEASEDAK |
| Ga0137417_12806302 | 3300024330 | Vadose Zone Soil | INGIDGDSVIVKISSEPQVKIRIARAAIAQVEASEDAK |
| Ga0207642_108391362 | 3300025899 | Miscanthus Rhizosphere | IYGTVNGIDGDTVILKIADQVKIRIARSAIAQVEATEDAK |
| Ga0207712_117628971 | 3300025961 | Switchgrass Rhizosphere | VNGIDGDTVILKIADQVKIRIARSAIAQVEATEDAK |
| Ga0207712_117922041 | 3300025961 | Switchgrass Rhizosphere | YGTVNGIDGDTVILKIADQVKIRIARSGIAQVEATEDAK |
| Ga0209438_10416121 | 3300026285 | Grasslands Soil | TVNGIDGDTIILKIADQVKIRIARSAIAQVEASEDAK |
| Ga0209686_10853881 | 3300026315 | Soil | TGSGIYGTISGIDGDAVIMKISSEPQVKIRIARAAIAQVEAPENAK |
| Ga0209647_12143042 | 3300026319 | Grasslands Soil | YGTVNGIDGDTIILKVADQVKIRIARSAIAQVEASEDAK |
| Ga0209803_12347723 | 3300026332 | Soil | GTVNGIDGDTVILKIADQVKIRILRSAIAQVEAEENAS |
| Ga0209377_11007491 | 3300026334 | Soil | IYGTINGIDGDSVILKISSEPQVKIRIARAAIAQVEASEDAK |
| Ga0257167_10404491 | 3300026376 | Soil | GIDGDSVILKISSEPQVKIRIARAAIAQVEASEDAK |
| Ga0209056_100204321 | 3300026538 | Soil | GIDGDSVILKISAEPQVKIRVSRAAIAQVEASEDAK |
| Ga0209376_10722232 | 3300026540 | Soil | SGIDGDSVIMKISSEPQVKIRIARAAIAQVETSEDAK |
| Ga0209648_100832623 | 3300026551 | Grasslands Soil | YGTINGIDGDSVILKISSEPQVKIRVSRAAIAQVEASEDAK |
| Ga0209648_104298541 | 3300026551 | Grasslands Soil | IYGTVNGIDGDSVILKISTEPQVKIRIARAAIAQVEASEDAK |
| Ga0179587_105730472 | 3300026557 | Vadose Zone Soil | YGTINGIDGDSVILKISSEPQVKIRIARAAIAQVEASEDAK |
| Ga0207506_10043581 | 3300027460 | Soil | GETVILKIADTGSTPVKIRIARSAIAQVEASEDAK |
| Ga0209735_11420461 | 3300027562 | Forest Soil | NSGIYGTINGIDGDTVILKIADQVKIRIARSAIAQVEASEDAK |
| Ga0209248_101095811 | 3300027729 | Bog Forest Soil | TINGIDGDTVILKIADTGSAPVKIRIARSAITQVEASEDAK |
| Ga0209180_102729042 | 3300027846 | Vadose Zone Soil | GVINVMDGDTVILKIADTGSSPVKIRIARSAITQVEASEDAK |
| Ga0209701_101318382 | 3300027862 | Vadose Zone Soil | IYGVINGIDGDTVILKIADTGSSPVKIRIARSAITQVEASEDAK |
| Ga0209701_106910571 | 3300027862 | Vadose Zone Soil | YGTISGIDGETVILRIADQVKIRVARSAITQVEETEDAK |
| Ga0209167_107987772 | 3300027867 | Surface Soil | GTINAIDGETVILKIADQVKIRIARSAIAQVEASEDAK |
| Ga0265334_101169481 | 3300028573 | Rhizosphere | NGMDGDTVILKIADQVKIRVARVAIAQVEASEDAK |
| Ga0308309_118908862 | 3300028906 | Soil | GIYGTINGIDGDTVILKIADQVKIRIARSAIAQVEASEDAK |
| Ga0311354_102207892 | 3300030618 | Palsa | AIDGDAVILKISAEPPVKIRVTRSAIAQVEASEDAK |
| Ga0310038_102437501 | 3300030707 | Peatlands Soil | GMDGDTIILKIADNVKIRVARAAIAQVEAPEDAAK |
| Ga0265462_123889792 | 3300030738 | Soil | TINGLDGETVILKIADQVKIRIARSAITQVEASEDAK |
| Ga0265765_10009051 | 3300030879 | Soil | GIYGTINGIDGDTVILKIADQVKIRIARSAIAQVEASEDAN |
| Ga0265740_10122391 | 3300030940 | Soil | INGIDGDTVILKIADQVKIRIARSAIAQVEASEDAK |
| Ga0170824_1006455261 | 3300031231 | Forest Soil | IYGTINGLDGDSVILKIATDPQVKIRVARSAIAQVETPEDAK |
| Ga0318538_101499031 | 3300031546 | Soil | GTVNGFDGEVVILRIAEQVKIRIARSAIAQVEATEDAK |
| Ga0307483_10229262 | 3300031590 | Hardwood Forest Soil | NGIDGDSVILKISSEPQVKIRISRAAIAQVEASEDAK |
| Ga0307483_10351832 | 3300031590 | Hardwood Forest Soil | VINGIDGDTVILKIADTGSSPVKIRIARSAITQVEASEDAK |
| Ga0318542_106632172 | 3300031668 | Soil | SGMDGDTVILKIADNVKIRIARAAIAQVEASEDAK |
| Ga0310686_1034734051 | 3300031708 | Soil | GIDGDSLILKISAEPPVKIRISRAAIAQVEASEDAK |
| Ga0307474_102421951 | 3300031718 | Hardwood Forest Soil | YGTVSGIDGDTVILKIADQVKIRILRSAIAQVEAEENAS |
| Ga0307477_101784452 | 3300031753 | Hardwood Forest Soil | GIYGVINGIDGDTVILKIADTGSSPVKIRIARSAITQVEASEDAK |
| Ga0307477_102811282 | 3300031753 | Hardwood Forest Soil | TNGGIYGVINGIDGDTIILKIADTGSSPVKIRIARSAITQVEASEDAK |
| Ga0307477_103839221 | 3300031753 | Hardwood Forest Soil | NSGIYGTINGIDGETVILKIADQVKIRILRSAIAQVEASEDAK |
| Ga0307475_100725511 | 3300031754 | Hardwood Forest Soil | VSGIDGDTVILKIADQVKIRILRSAIAQIEAEENAS |
| Ga0307475_103769021 | 3300031754 | Hardwood Forest Soil | IDGETVILKIADTGSSPVKIRIARSAISQVEAAEDAK |
| Ga0307475_106078371 | 3300031754 | Hardwood Forest Soil | GTVSGIDGETVILKIADQVKIRILRSAIAQVEAEENAS |
| Ga0318557_102724622 | 3300031795 | Soil | GTINGMDGDTIILKIADNVKIRVARAAIAQVEASDDAK |
| Ga0307473_101396832 | 3300031820 | Hardwood Forest Soil | GTVNGIDGDSVILKISSEPQVKIRIARAAIAQVEASEDAK |
| Ga0307478_107712902 | 3300031823 | Hardwood Forest Soil | IYGTINGIDGDTVILKIADQVKIRIARSAIAQVEASEDAK |
| Ga0310917_105934591 | 3300031833 | Soil | NGLDGDTVILKIADQVKIRILRSAIAQVEATEDAK |
| Ga0306919_100701793 | 3300031879 | Soil | YGTINGMDGDTIILKIADNVKIRIARAAIAQVEASDDGK |
| Ga0310913_103801921 | 3300031945 | Soil | YGTISGIDGESVIMKISSEPQVKIRIARAAIAQVETSQDAK |
| Ga0310910_104167342 | 3300031946 | Soil | TINGMDGDTIILKIADNVKIRIARAAIAQVEASDDGK |
| Ga0307479_102883881 | 3300031962 | Hardwood Forest Soil | GDTVILKIADTGSSPVKIRVARSAITQVEASEDAK |
| Ga0318558_104873822 | 3300032044 | Soil | GIYGTINGMDGDTIILKIADNVKIRVARAAIAQVEASDDAK |
| Ga0318533_107596782 | 3300032059 | Soil | INGMDGDTIILKIADNVKIRIARAAIAQVEASDDGK |
| Ga0307471_1007966081 | 3300032180 | Hardwood Forest Soil | INGIDGDSVILKISAEPQVKIRVARAAIAQVEASEDAK |
| Ga0307471_1009087491 | 3300032180 | Hardwood Forest Soil | TINGIDGDTVILKIADQVKIRIARSAIAQVEASEDAK |
| Ga0306920_1023329121 | 3300032261 | Soil | GTINGMDGDTIILKVADNVKIRVARAAIAQVEASEDAK |
| Ga0335082_113493772 | 3300032782 | Soil | GTINGIDGDTIILKIADNVKIRIARAAIGQVEASDDAK |
| Ga0335083_111395292 | 3300032954 | Soil | GTVNGIDGDTIILKIADNVKIRIARAAIGQVEASDDAK |
| Ga0335077_104875181 | 3300033158 | Soil | YGTINGIDGDTIILKVADNVKIRVARAAIGQVEASEDAK |
| Ga0326728_101815371 | 3300033402 | Peat Soil | SGMDGDTIILKIADNVKIRIARAAIARVEAAEDAAK |
| ⦗Top⦘ |