| Basic Information | |
|---|---|
| Family ID | F045325 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSDAVVK |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.95 % |
| % of genes near scaffold ends (potentially truncated) | 94.12 % |
| % of genes from short scaffolds (< 2000 bps) | 79.74 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.699 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.765 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.451 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.137 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF01208 | URO-D | 21.57 |
| PF00762 | Ferrochelatase | 2.61 |
| PF01593 | Amino_oxidase | 1.96 |
| PF07992 | Pyr_redox_2 | 1.96 |
| PF05192 | MutS_III | 1.96 |
| PF12867 | DinB_2 | 1.31 |
| PF04095 | NAPRTase | 1.31 |
| PF12840 | HTH_20 | 1.31 |
| PF10282 | Lactonase | 1.31 |
| PF07676 | PD40 | 1.31 |
| PF13950 | Obsolete Pfam Family | 0.65 |
| PF03786 | UxuA | 0.65 |
| PF13673 | Acetyltransf_10 | 0.65 |
| PF09723 | Zn-ribbon_8 | 0.65 |
| PF03704 | BTAD | 0.65 |
| PF10012 | DUF2255 | 0.65 |
| PF00834 | Ribul_P_3_epim | 0.65 |
| PF02518 | HATPase_c | 0.65 |
| PF00069 | Pkinase | 0.65 |
| PF08241 | Methyltransf_11 | 0.65 |
| PF00753 | Lactamase_B | 0.65 |
| PF08240 | ADH_N | 0.65 |
| PF13544 | Obsolete Pfam Family | 0.65 |
| PF04014 | MazE_antitoxin | 0.65 |
| PF01797 | Y1_Tnp | 0.65 |
| PF01370 | Epimerase | 0.65 |
| PF06262 | Zincin_1 | 0.65 |
| PF02954 | HTH_8 | 0.65 |
| PF01979 | Amidohydro_1 | 0.65 |
| PF08281 | Sigma70_r4_2 | 0.65 |
| PF10754 | DUF2569 | 0.65 |
| PF14307 | Glyco_tran_WbsX | 0.65 |
| PF01641 | SelR | 0.65 |
| PF00440 | TetR_N | 0.65 |
| PF02652 | Lactate_perm | 0.65 |
| PF02371 | Transposase_20 | 0.65 |
| PF03631 | Virul_fac_BrkB | 0.65 |
| PF01740 | STAS | 0.65 |
| PF08308 | PEGA | 0.65 |
| PF00144 | Beta-lactamase | 0.65 |
| PF09413 | DUF2007 | 0.65 |
| PF00248 | Aldo_ket_red | 0.65 |
| PF13414 | TPR_11 | 0.65 |
| PF13883 | Pyrid_oxidase_2 | 0.65 |
| PF00004 | AAA | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 21.57 |
| COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 2.61 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.61 |
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 1.96 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 1.31 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 0.65 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.65 |
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.65 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.65 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.65 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.65 |
| COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 0.65 |
| COG1312 | D-mannonate dehydratase | Carbohydrate transport and metabolism [G] | 0.65 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.65 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.70 % |
| Unclassified | root | N/A | 18.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_102802099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300001593|JGI12635J15846_10618711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 629 | Open in IMG/M |
| 3300001867|JGI12627J18819_10429536 | Not Available | 539 | Open in IMG/M |
| 3300002908|JGI25382J43887_10219052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300004633|Ga0066395_10559126 | Not Available | 666 | Open in IMG/M |
| 3300005332|Ga0066388_108011472 | Not Available | 528 | Open in IMG/M |
| 3300005436|Ga0070713_101794706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300005451|Ga0066681_10513069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300005534|Ga0070735_10135163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1534 | Open in IMG/M |
| 3300005548|Ga0070665_102296159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300005578|Ga0068854_100009634 | All Organisms → cellular organisms → Bacteria | 6238 | Open in IMG/M |
| 3300005591|Ga0070761_10767307 | Not Available | 606 | Open in IMG/M |
| 3300005843|Ga0068860_102711011 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300006041|Ga0075023_100140801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300006050|Ga0075028_100751034 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300006059|Ga0075017_100884300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300006173|Ga0070716_100032703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2840 | Open in IMG/M |
| 3300006852|Ga0075433_10024731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5072 | Open in IMG/M |
| 3300006914|Ga0075436_100583785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300007982|Ga0102924_1148012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300009012|Ga0066710_100327047 | All Organisms → cellular organisms → Bacteria | 2257 | Open in IMG/M |
| 3300009098|Ga0105245_12491704 | Not Available | 571 | Open in IMG/M |
| 3300009168|Ga0105104_10528746 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 666 | Open in IMG/M |
| 3300009518|Ga0116128_1217903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300009521|Ga0116222_1214432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300009521|Ga0116222_1388736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300009547|Ga0116136_1067108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
| 3300009614|Ga0116104_1069951 | Not Available | 730 | Open in IMG/M |
| 3300009634|Ga0116124_1141095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300009700|Ga0116217_10411314 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300009764|Ga0116134_1094529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1087 | Open in IMG/M |
| 3300009839|Ga0116223_10245546 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300009839|Ga0116223_10291765 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300010048|Ga0126373_13316837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 501 | Open in IMG/M |
| 3300010358|Ga0126370_10620272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
| 3300010376|Ga0126381_100329107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2104 | Open in IMG/M |
| 3300010379|Ga0136449_100344620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2682 | Open in IMG/M |
| 3300011269|Ga0137392_10408648 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300012199|Ga0137383_10368259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300012202|Ga0137363_11721371 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012211|Ga0137377_11415046 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300012356|Ga0137371_10521823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300012362|Ga0137361_10245306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1631 | Open in IMG/M |
| 3300012924|Ga0137413_10110892 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300012930|Ga0137407_10046161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3510 | Open in IMG/M |
| 3300013102|Ga0157371_10990432 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300013296|Ga0157374_11976516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300013307|Ga0157372_11585013 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300014159|Ga0181530_10458153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300014489|Ga0182018_10016004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5104 | Open in IMG/M |
| 3300014489|Ga0182018_10375794 | Not Available | 763 | Open in IMG/M |
| 3300014501|Ga0182024_10122435 | All Organisms → cellular organisms → Bacteria | 3718 | Open in IMG/M |
| 3300015241|Ga0137418_10471144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
| 3300017933|Ga0187801_10464304 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300017935|Ga0187848_10296322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300017940|Ga0187853_10172911 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300017943|Ga0187819_10010701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5193 | Open in IMG/M |
| 3300017943|Ga0187819_10271947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
| 3300017955|Ga0187817_10616291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300017972|Ga0187781_10318154 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300017995|Ga0187816_10016987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2805 | Open in IMG/M |
| 3300017995|Ga0187816_10295083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300018034|Ga0187863_10040226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2713 | Open in IMG/M |
| 3300018037|Ga0187883_10096043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1542 | Open in IMG/M |
| 3300018040|Ga0187862_10013144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6819 | Open in IMG/M |
| 3300018042|Ga0187871_10772280 | Not Available | 536 | Open in IMG/M |
| 3300018088|Ga0187771_11544146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300018482|Ga0066669_12051012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300019881|Ga0193707_1073968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300020015|Ga0193734_1038689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300020579|Ga0210407_10299450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1256 | Open in IMG/M |
| 3300020579|Ga0210407_10869124 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300020580|Ga0210403_10719276 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300020581|Ga0210399_10738804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300020582|Ga0210395_10687254 | Not Available | 766 | Open in IMG/M |
| 3300021178|Ga0210408_10804438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300021181|Ga0210388_11575400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300021401|Ga0210393_10293909 | Not Available | 1319 | Open in IMG/M |
| 3300021405|Ga0210387_10004101 | All Organisms → cellular organisms → Bacteria | 11170 | Open in IMG/M |
| 3300021405|Ga0210387_11343738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300021407|Ga0210383_11581725 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300021420|Ga0210394_10221534 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300021420|Ga0210394_11153478 | Not Available | 667 | Open in IMG/M |
| 3300021477|Ga0210398_10427279 | Not Available | 1080 | Open in IMG/M |
| 3300021479|Ga0210410_10068950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3099 | Open in IMG/M |
| 3300021479|Ga0210410_10630209 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300022557|Ga0212123_10893941 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300025320|Ga0209171_10635319 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300025414|Ga0208935_1042519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300025506|Ga0208937_1037236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1169 | Open in IMG/M |
| 3300025612|Ga0208691_1012492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2106 | Open in IMG/M |
| 3300025898|Ga0207692_10729402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300025905|Ga0207685_10540271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300025911|Ga0207654_10224915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1247 | Open in IMG/M |
| 3300025911|Ga0207654_10902379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300025916|Ga0207663_10780692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300025918|Ga0207662_10548666 | Not Available | 800 | Open in IMG/M |
| 3300025920|Ga0207649_10025475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3448 | Open in IMG/M |
| 3300025927|Ga0207687_10332322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1233 | Open in IMG/M |
| 3300025928|Ga0207700_10961111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300025939|Ga0207665_10830350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300025944|Ga0207661_11195053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300026309|Ga0209055_1042701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1995 | Open in IMG/M |
| 3300026497|Ga0257164_1068256 | Not Available | 589 | Open in IMG/M |
| 3300026538|Ga0209056_10374458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300027546|Ga0208984_1069634 | Not Available | 758 | Open in IMG/M |
| 3300027562|Ga0209735_1079331 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300027568|Ga0208042_1167913 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300027660|Ga0209736_1132128 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300027674|Ga0209118_1194211 | Not Available | 549 | Open in IMG/M |
| 3300027698|Ga0209446_1058964 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300027812|Ga0209656_10431302 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300027846|Ga0209180_10208049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1128 | Open in IMG/M |
| 3300027854|Ga0209517_10108178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1855 | Open in IMG/M |
| 3300027867|Ga0209167_10183660 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300027895|Ga0209624_10307243 | Not Available | 1056 | Open in IMG/M |
| 3300027905|Ga0209415_10147342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2378 | Open in IMG/M |
| 3300027908|Ga0209006_10724894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 812 | Open in IMG/M |
| 3300027986|Ga0209168_10024475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3379 | Open in IMG/M |
| 3300028047|Ga0209526_10135093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1731 | Open in IMG/M |
| 3300028379|Ga0268266_12252090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300028536|Ga0137415_10241037 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300030763|Ga0265763_1028513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300030862|Ga0265753_1044160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300031234|Ga0302325_10976451 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300031446|Ga0170820_14499697 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300031708|Ga0310686_102728950 | Not Available | 1169 | Open in IMG/M |
| 3300031708|Ga0310686_103752102 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300031708|Ga0310686_114808754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1264 | Open in IMG/M |
| 3300031708|Ga0310686_117682949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4697 | Open in IMG/M |
| 3300031715|Ga0307476_10889863 | Not Available | 657 | Open in IMG/M |
| 3300031718|Ga0307474_11040565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300031753|Ga0307477_10025789 | All Organisms → cellular organisms → Bacteria | 4016 | Open in IMG/M |
| 3300031753|Ga0307477_11002511 | Not Available | 548 | Open in IMG/M |
| 3300031754|Ga0307475_10117324 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
| 3300031754|Ga0307475_10450307 | Not Available | 1035 | Open in IMG/M |
| 3300031823|Ga0307478_10109644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2149 | Open in IMG/M |
| 3300031823|Ga0307478_10573544 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300031962|Ga0307479_10359795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1439 | Open in IMG/M |
| 3300031962|Ga0307479_11424679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300032174|Ga0307470_10027014 | All Organisms → cellular organisms → Bacteria | 2679 | Open in IMG/M |
| 3300032180|Ga0307471_102805043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300032180|Ga0307471_104158433 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300032783|Ga0335079_11288411 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300032805|Ga0335078_11229429 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300034817|Ga0373948_0159591 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.19% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.23% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.27% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.31% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.31% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.65% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.65% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009614 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027161 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1028020992 | 3300000955 | Soil | MAANQVVIYFDKQEDALLFTLAASLVMAAEGPVHSHHA |
| JGI12635J15846_106187111 | 3300001593 | Forest Soil | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVRSSKAVAKV |
| JGI12627J18819_104295361 | 3300001867 | Forest Soil | MAASQVVLYFDKQEDALLFTLAASSVMSADGAARTNEVVARVAA |
| JGI25382J43887_102190522 | 3300002908 | Grasslands Soil | MAAYQVVLYFDKQEDALLFTLAASSIMSAEGPLHSGDAGV |
| Ga0066395_105591262 | 3300004633 | Tropical Forest Soil | MASQVVLYFEKQEDAVLFALAASSVISDGVKGPSDAAGKVAEEIRK |
| Ga0066388_1080114721 | 3300005332 | Tropical Forest Soil | VAVNQVVLFFDKQEDALLFTLAASSIMSEHAPHSSDATAKVA |
| Ga0070713_1017947061 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPARRNDAVA |
| Ga0066681_105130692 | 3300005451 | Soil | MAASQVVLYFDKQEDALLFTLAASSVISSEAPVRAKEALV |
| Ga0070735_101351632 | 3300005534 | Surface Soil | MAANQVVLYFEKPEDALLFTLAASSVMSSDGSTHNSKAAVKVAQEISKA |
| Ga0070665_1022961591 | 3300005548 | Switchgrass Rhizosphere | VAAKHVVLYFDKQEDALLFTLAASSVMSAEGPLHS |
| Ga0068854_1000096341 | 3300005578 | Corn Rhizosphere | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPLRGTKA |
| Ga0070761_107673072 | 3300005591 | Soil | MAANQVVLYFDTQQDALLFTLAASSVMSAGSPVHSNQAA |
| Ga0066706_107178161 | 3300005598 | Soil | MAASQVVLYFDKQEDALLFTLAASSVISSEAPVRAKEALVKIADEIRKASR |
| Ga0068860_1027110113 | 3300005843 | Switchgrass Rhizosphere | MAASQVVLYFDKPEDALLFTLAASSMISDDGPGRA |
| Ga0070717_104600981 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAASQVVLYFDKQEDALLFTLAASSIIADGAPLRESALK |
| Ga0075023_1001408011 | 3300006041 | Watersheds | VHIAANQVVLYFDKQADALLFTLAASSVMSAEGPVH |
| Ga0075028_1007510341 | 3300006050 | Watersheds | MAASQVVLYFDKQEDALLFTLAASSMISDEGPAGAGEALV |
| Ga0075017_1008843001 | 3300006059 | Watersheds | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHSRDAVAKVAEEIC |
| Ga0070716_1000327034 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAASQVVLYFDKPEDALLFTLAASSMISDDGPARANEALVK |
| Ga0075433_100247316 | 3300006852 | Populus Rhizosphere | MAASQVVLYFDKQEDALLFTLAASSVMSADEPVRPEEAGAR |
| Ga0075436_1005837851 | 3300006914 | Populus Rhizosphere | MSANQVVLYFDKQEDALLFTAAASSVMSAEGPVYRSDAV |
| Ga0102924_11480123 | 3300007982 | Iron-Sulfur Acid Spring | MAANQVVLYFEKPEDALLFTLAASSVMSAEGAVHS |
| Ga0066710_1003270473 | 3300009012 | Grasslands Soil | MATNQVVLYFDEQEDALLFTLAASSAMSAEGQLHSGDAAV |
| Ga0105245_124917041 | 3300009098 | Miscanthus Rhizosphere | MAASQVVLYFDKQEDALLFTLAASSMISDDGPARADEAL |
| Ga0105104_105287461 | 3300009168 | Freshwater Sediment | VLYFDKQEDALLFTLAASSVMSAEGPLHSSDAIVKVA |
| Ga0116128_12179031 | 3300009518 | Peatland | MAANQVVLYFERPEDALLFTLAASSVMSAEGQVHSN |
| Ga0116222_12144321 | 3300009521 | Peatlands Soil | MHMAANQVVLYFDKQEDAVLFTLAASSVMSAEGPVHSSVAA |
| Ga0116222_13887361 | 3300009521 | Peatlands Soil | MAANQVVLYFDKQEDALLFTLAASSIMSAEGPVHSSDAVVKV |
| Ga0116136_10671082 | 3300009547 | Peatland | MAANQVVLYFDKQEDAVLFTLAASSVMSAEGPVHSSVAAAKVAEEISK |
| Ga0116104_10699511 | 3300009614 | Peatland | MAASQVVLYFDKKEDALLFTLAASSVMSAEGPVHSSDAMVKVAEE |
| Ga0116124_11410951 | 3300009634 | Peatland | MAANQVVLYFERPEDALLFTLAASSVMSAEGQVHSNKAAARVAE |
| Ga0116217_104113142 | 3300009700 | Peatlands Soil | MKMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSDAVVK |
| Ga0116134_10945292 | 3300009764 | Peatland | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHRGDAAVK |
| Ga0116223_102455462 | 3300009839 | Peatlands Soil | MKMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHG |
| Ga0116223_102917651 | 3300009839 | Peatlands Soil | MAANQVVLYFDKKEDALLFTLAASSVMSAEGPVHGSDAVVKVAEE |
| Ga0126373_133168372 | 3300010048 | Tropical Forest Soil | MAANQVVLYFEKPEDALLFTLAASSVMSADGSTHNSKAAVRVA |
| Ga0126370_106202722 | 3300010358 | Tropical Forest Soil | VVLYFDKQEDALLFTLAASSVMSAEGPVHSNDAVVKFAEEICK |
| Ga0126381_1003291073 | 3300010376 | Tropical Forest Soil | MATNQVVLYFEKPENALLFTLAASSVMSAEGPLHSNKAA |
| Ga0136449_1003446201 | 3300010379 | Peatlands Soil | MAANQVVLYFDKQEDAVLFTLAASSVMSAEGPVHSSV |
| Ga0137392_104086482 | 3300011269 | Vadose Zone Soil | MAANQVVLYFDNQQDALLFTLAASSVMSAEGPVHSSKAAV |
| Ga0137383_103682592 | 3300012199 | Vadose Zone Soil | MAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSNK |
| Ga0137363_117213711 | 3300012202 | Vadose Zone Soil | MAASQVVLYFDKPEDALLFTLAASSMISEDAPGRAN |
| Ga0137377_114150461 | 3300012211 | Vadose Zone Soil | MAASQVVLYFDKQEDALLFTLAASSMISDDGPGRASEALVKVA |
| Ga0137371_105218233 | 3300012356 | Vadose Zone Soil | MAASQVVLYFDKQEDALLFTLAASSVISSEAPVRAKEALVKIADEIRKA |
| Ga0137361_102453063 | 3300012362 | Vadose Zone Soil | MAASQVVLYFDKQEDALLFTLAASSMISDDGPARADEALVKVAAEIRKA |
| Ga0137413_101108921 | 3300012924 | Vadose Zone Soil | MAANQVVLYFDKQEDALLFTLAASSVMSADGPVHRGDAAVKVAEEICKVR |
| Ga0137407_100461613 | 3300012930 | Vadose Zone Soil | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHRSVAVVKVAEEICKA |
| Ga0157371_109904322 | 3300013102 | Corn Rhizosphere | MAASQVVLYFDKPEDALLFTLAASSMISDDGPGRADEALVKVAAEIRKAS |
| Ga0157374_119765161 | 3300013296 | Miscanthus Rhizosphere | MAANQVVLYFEKPEDALLFTLAASSVMSAEGSVYS |
| Ga0157372_115850132 | 3300013307 | Corn Rhizosphere | MAASQVVLYFDKQEDALLFTLAASSMISDDGPARA |
| Ga0120132_10514991 | 3300013832 | Permafrost | MAASQVVLYFDRQEDALLFTLAASSVITADEPNRTD |
| Ga0181530_104581531 | 3300014159 | Bog | MAANQVVLYFDKQEDAVLFTLAASSVMSAEGPVHSSVAAAKVAEEIC |
| Ga0182018_100160047 | 3300014489 | Palsa | MAANQVVLYFDKHEDAVLFTLAASSIMSAEGPVQS |
| Ga0182018_103757941 | 3300014489 | Palsa | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVRSSDAVVKV |
| Ga0182024_101224354 | 3300014501 | Permafrost | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVRSS |
| Ga0137418_104711441 | 3300015241 | Vadose Zone Soil | MAANQVVVYFDTQQDALLFTLAASSVMSTEGSVHSSKA |
| Ga0187801_104643042 | 3300017933 | Freshwater Sediment | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSD |
| Ga0187848_102963221 | 3300017935 | Peatland | MAANQVVLYFERPEDALLFTLAASSVMSAEGQVHSNKAAARVAEEI |
| Ga0187853_101729112 | 3300017940 | Peatland | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHRGDAAVKVA |
| Ga0187819_100107011 | 3300017943 | Freshwater Sediment | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSDAVVKV |
| Ga0187819_102719471 | 3300017943 | Freshwater Sediment | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPAHSSDAA |
| Ga0187817_106162911 | 3300017955 | Freshwater Sediment | MAANQVVVYFDKQEDALLFTLAASSVMSAEGPVRSSAAV |
| Ga0187781_103181541 | 3300017972 | Tropical Peatland | MAANQVVLYFDKQEDAVLFTLAASSVMSAEGPTHNRDAAVKVA |
| Ga0187816_100169871 | 3300017995 | Freshwater Sediment | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSDAVVK |
| Ga0187816_102950831 | 3300017995 | Freshwater Sediment | MAVNQVVVYFDKQEDAVLFTLAASSVMSAEGPVRSSAAVVK |
| Ga0187863_100402264 | 3300018034 | Peatland | MAANQVVLYFDKQEDALLFTLAASSVMSADGPVHS |
| Ga0187883_100960431 | 3300018037 | Peatland | MAANQVVLYFDKHEDAVLFTLAASSVMSAEGPVQSSDAANKVAEEI |
| Ga0187862_100131448 | 3300018040 | Peatland | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVPSGDAAVKVAEEISK |
| Ga0187871_107722801 | 3300018042 | Peatland | MAANQVVLYFDKQEDALLFTLAASSVMSADGPVHRSD |
| Ga0187771_115441461 | 3300018088 | Tropical Peatland | MAANQVVLYFDKQEDALLFTLAASTAMSAEEPTRASEAGLRMAKEIC |
| Ga0066669_120510122 | 3300018482 | Grasslands Soil | MAAYQVMLYFDKQEDALLFTLAASSIMSAEGPLHS |
| Ga0193707_10739682 | 3300019881 | Soil | MAASQVVLYFDKQEDALLFTLAASSVISSEAPVRAKEALVKI |
| Ga0193755_10111711 | 3300020004 | Soil | MGEVLQMAASQVVLYFDKQEDALLFTLAASSVISSEAPVRAKEALVKIAD |
| Ga0193734_10386892 | 3300020015 | Soil | MAASQVVLYFDKQEDALLFTLAASSVISSEAPVRA |
| Ga0210407_102994502 | 3300020579 | Soil | MAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSSKAAV |
| Ga0210407_108691242 | 3300020579 | Soil | MAASQVVLYFDKQEDALLFTLAASSMISEDGPARADEALVKVAAEIRKA |
| Ga0210403_107192761 | 3300020580 | Soil | MAASQVVLYFDKQEDALLFTLAASSMISDDGPARADEALV |
| Ga0210399_107388042 | 3300020581 | Soil | MAANQVVLYFEKPEDALLFTVAASSVMSAEGAVHSSK |
| Ga0210395_106872542 | 3300020582 | Soil | MSANQVVLYFDKQEDALLFTLAASSVMSGEGPVHR |
| Ga0210408_108044381 | 3300021178 | Soil | MATNQVVLYFDEQKDALLFTLAASSAMSAEGPLHRGDAAVKVAGA |
| Ga0210388_115754002 | 3300021181 | Soil | MAANQVVLYFEKPEDALLFTVAASSVMSAEGAVHSS |
| Ga0210393_102939091 | 3300021401 | Soil | MAANQVVLYFDKQEDALLFTLAASSVMSADGPVNGSDAVVK |
| Ga0210387_1000410112 | 3300021405 | Soil | MAANQVILYFDNQEDAVLFTLAASSVMSAEEPTESSNAA |
| Ga0210387_113437381 | 3300021405 | Soil | MAANQVVLYFEKPEDALLFTVAASSVMSAEGAVHSSKAAVR |
| Ga0210383_106964491 | 3300021407 | Soil | MAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSSKAAVKVAEEICKD |
| Ga0210383_115817251 | 3300021407 | Soil | MAASQVVLYFDKQEDALLFTLAASSMISDDGPTRANEALVKIAAEIRKA |
| Ga0210394_102215341 | 3300021420 | Soil | MAANQVVLYFEKPEDALLFTLAASSVMSAEGAVHSS |
| Ga0210394_111534781 | 3300021420 | Soil | MSANQVVLYFDKQEDALLFTLAASSVMSAEGSVHR |
| Ga0210398_104272791 | 3300021477 | Soil | MAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSSKAAVKV |
| Ga0210410_100689506 | 3300021479 | Soil | MAANQVVLYFEKPEDALLFTVAASSVMSAEGAVHSSKA |
| Ga0210410_106302092 | 3300021479 | Soil | MAASQVVLYFDKQEDALLFTLAASSVISPDGPGRKD |
| Ga0212123_108939411 | 3300022557 | Iron-Sulfur Acid Spring | VAANQVVLYFDKQEDAVLFTLAASSVMSAEGPMRGSDAMVKVAKEICK |
| Ga0209171_106353191 | 3300025320 | Iron-Sulfur Acid Spring | MAANQGVLYSDKQEDALLFTLAASSVMSTEGPVRSTAAVAKVAE |
| Ga0208935_10425191 | 3300025414 | Peatland | MGTNQVVLYFDKQEDALLFTLAASSVMSAEESVRSSKAAVRV |
| Ga0208937_10372361 | 3300025506 | Peatland | MAANEVVLYFDKHEDAVLFTLAASSVMSAEGPLQSSNAGD |
| Ga0208691_10124923 | 3300025612 | Peatland | MAANQVVLYFDKQEDALLFTLAASSVMSADGPVHSSDAV |
| Ga0207692_107294021 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MAANQVVLYFEKPEDALLFTLAASSVMSAEGSVYSSKAAV |
| Ga0207685_105402711 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MAANQVVLYFEKPEDALLFTLAASSVMSAEGPVHGNKAVVRVAQEI |
| Ga0207654_102249151 | 3300025911 | Corn Rhizosphere | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPLRGTKAADKVADE |
| Ga0207654_109023792 | 3300025911 | Corn Rhizosphere | MSANQVVIYFDKQEDALLFTLAASSVMSAEGSVDQSDAVVK |
| Ga0207663_107806921 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAANQVVLYFDKQEDALLFTLAASSVMSGEGPLHSNDPVINFAE |
| Ga0207662_105486662 | 3300025918 | Switchgrass Rhizosphere | MAASQVVLYFDKQEDALLFTLAASSMISDEGPARADEALVKVAA |
| Ga0207649_100254751 | 3300025920 | Corn Rhizosphere | MAASQVVLYFDKQEDALLFTLAASSMISDDGPARADEALVKVGA |
| Ga0207649_105308932 | 3300025920 | Corn Rhizosphere | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPLRGTKAADKVADEICKA |
| Ga0207687_103323221 | 3300025927 | Miscanthus Rhizosphere | MSANQVVIYFDKQEDALLFTLAASSVMSAEGSVEQS |
| Ga0207700_109611111 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPARRNDAVAK |
| Ga0207665_108303502 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MAASQVVLYFDKQEDALLFTLAASSVISSEAPVRAKEALVKIA |
| Ga0207661_111950531 | 3300025944 | Corn Rhizosphere | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPLRGTK |
| Ga0209055_10427011 | 3300026309 | Soil | MAAYQVVLYFDKQEDALLFTLAASSIMSAEGPLHS |
| Ga0257164_10682561 | 3300026497 | Soil | MAASQVVLYFDKQEDALLFTLAASSMISDEGPAGAGEALVKIAAEIR |
| Ga0209056_103744581 | 3300026538 | Soil | MATKQVVLYFEKPEDALLFTLAASSVMSAEASIHSSKAAVRVAEGLCKA |
| Ga0208368_1008571 | 3300027161 | Forest Soil | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPLHSNDPVINFAEQICKAR |
| Ga0208984_10696341 | 3300027546 | Forest Soil | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHS |
| Ga0209735_10793311 | 3300027562 | Forest Soil | MAANQVVLYFDTQQDALLFALAASSVMSAEGPVHSN |
| Ga0208042_11679131 | 3300027568 | Peatlands Soil | MAASQVVLYFDKQEDALLFTLAASSVMSAEGPARGSEAVAKVA |
| Ga0209736_11321281 | 3300027660 | Forest Soil | MAASQVVLYFDKQEDALLFTLAASSVIGADKSVRGNQSA |
| Ga0209118_11942112 | 3300027674 | Forest Soil | MAVNQVVLYFDKEQDALLFTLAASSLMSGERQGLTSKAADRV |
| Ga0209446_10589641 | 3300027698 | Bog Forest Soil | MAANQVVLYFDKQEDALLFTLAASTVMSEDGPVRGS |
| Ga0209656_104313021 | 3300027812 | Bog Forest Soil | MAANQVVLYFDKQEDALLFTLAASSVMSEEGPVRSS |
| Ga0209180_102080492 | 3300027846 | Vadose Zone Soil | MAANQVVLYFDKQEDALLFALAASSVMSAERPVHSGD |
| Ga0209517_101081781 | 3300027854 | Peatlands Soil | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVRGSDA |
| Ga0209167_101836601 | 3300027867 | Surface Soil | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHG |
| Ga0209624_103072431 | 3300027895 | Forest Soil | MAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSSKAAVKVA |
| Ga0209415_101473424 | 3300027905 | Peatlands Soil | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSDAVVKVAEEIS |
| Ga0209006_107248941 | 3300027908 | Forest Soil | MAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSS |
| Ga0209168_100244753 | 3300027986 | Surface Soil | MAANQVVLYFEKPEDALLFTLAASSVMSAEGPSSKAAV |
| Ga0209526_101350933 | 3300028047 | Forest Soil | MAASQVVLYFDKQEDALLFTLAASSMISDDGPARADEALVKVAAEIRKAN |
| Ga0268266_122520901 | 3300028379 | Switchgrass Rhizosphere | VAAKHVVLYFDKQEDALLFTLAASSVMSAEGPLHSS |
| Ga0137415_102410373 | 3300028536 | Vadose Zone Soil | MATNRVVLYFDEQEDALLFTLAASSAMSAEGPLHSGDAAVK |
| Ga0265763_10285132 | 3300030763 | Soil | MAASQVVLYFDKQEDALLFTLAASSVMSAEGQVHSSDAVVKVA |
| Ga0265753_10441601 | 3300030862 | Soil | MAANQVVLYFDKQEDAMRFTLAASSVMSAEGPVLYSNRAVLKVAEEI |
| Ga0302325_109764511 | 3300031234 | Palsa | MTTNQVILYFDNQEDAVLFTLAASSVMSAEEPTDSSNAAA |
| Ga0170820_144996971 | 3300031446 | Forest Soil | MAASQVVLYFDKPEDALLFTLAASSMISEDAPGRANEALVKVAAEIRK |
| Ga0310686_1027289502 | 3300031708 | Soil | MAANQVVLYFDKQEDALLFTLAASSVMSADGPVHSSDAVV |
| Ga0310686_1037521022 | 3300031708 | Soil | MAANQVVLYFDKEEDALLFTLAASSVMSAEGPMRGSDAVAKVA |
| Ga0310686_1148087542 | 3300031708 | Soil | MAANQVVLYFDKQEDAVLFTLAASSVMSAEGPVHGNAAVVKVAMDRSFR |
| Ga0310686_1176829491 | 3300031708 | Soil | MAANQVVLYFDKQEDAVLFTLAASSVMSAEGPVHGSDA |
| Ga0307476_108898631 | 3300031715 | Hardwood Forest Soil | MAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSSKAA |
| Ga0307474_110405652 | 3300031718 | Hardwood Forest Soil | MAANQVVLYFEKPEDALLFTLAASSVLSAEGAVHSSKAAVRV |
| Ga0307477_100257891 | 3300031753 | Hardwood Forest Soil | MAVNQVVLYFDKEQDALLFTLAASSVMSAEGPGPS |
| Ga0307477_110025111 | 3300031753 | Hardwood Forest Soil | MASNQVVLYFDTQQDALLFTLAASSVMSAEGPAHSNKAAVRVAEEICK |
| Ga0307475_101173245 | 3300031754 | Hardwood Forest Soil | MAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSNKAAF |
| Ga0307475_104503071 | 3300031754 | Hardwood Forest Soil | MAANQVVLYFDTQQDALLFTLAASSVMSAEGPVYSNKAAVR |
| Ga0307478_101096443 | 3300031823 | Hardwood Forest Soil | MAANQVVLYFEKPEDALLFTLAASSVMSAEGSLHSSKAAVRVAQ |
| Ga0307478_105735442 | 3300031823 | Hardwood Forest Soil | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSDAVVKVAEEI |
| Ga0307479_103597953 | 3300031962 | Hardwood Forest Soil | MAASQVVLYFDKQEDALLFTLAASSMISEDGPARADE |
| Ga0307479_114246791 | 3300031962 | Hardwood Forest Soil | MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHSSNAAVKV |
| Ga0307470_100270141 | 3300032174 | Hardwood Forest Soil | MAANQVVLYFEKPEDALLFTLAASSVMSAEGPVHSSK |
| Ga0307471_1028050432 | 3300032180 | Hardwood Forest Soil | MAANQVVLYFEKPEDALLFTLAASSVMSAEGAVHSSKAAFRVAQEIC |
| Ga0307471_1041584332 | 3300032180 | Hardwood Forest Soil | MAASQVVLYFDKQEDALLFTLAASSVISPEGPGRANEALVKIAEEICKA |
| Ga0335079_112884112 | 3300032783 | Soil | MAASQVVVYFEKQEDALLFTLAASSAISAEEPLGAT |
| Ga0335078_112294291 | 3300032805 | Soil | MAASQVVLYFDKQEDALLFTLAASSVMAADGPVHAEEAVMKIATEICKA |
| Ga0373948_0159591_2_133 | 3300034817 | Rhizosphere Soil | MAASQVVLYFDKQEDALLFTLAASSMISDDGPARADEALVKVAA |
| ⦗Top⦘ |