NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045325

Metagenome / Metatranscriptome Family F045325

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045325
Family Type Metagenome / Metatranscriptome
Number of Sequences 153
Average Sequence Length 41 residues
Representative Sequence MAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSDAVVK
Number of Associated Samples 133
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.95 %
% of genes near scaffold ends (potentially truncated) 94.12 %
% of genes from short scaffolds (< 2000 bps) 79.74 %
Associated GOLD sequencing projects 127
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.699 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.765 % of family members)
Environment Ontology (ENVO) Unclassified
(27.451 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.137 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.64%    β-sheet: 0.00%    Coil/Unstructured: 75.36%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF01208URO-D 21.57
PF00762Ferrochelatase 2.61
PF01593Amino_oxidase 1.96
PF07992Pyr_redox_2 1.96
PF05192MutS_III 1.96
PF12867DinB_2 1.31
PF04095NAPRTase 1.31
PF12840HTH_20 1.31
PF10282Lactonase 1.31
PF07676PD40 1.31
PF13950Obsolete Pfam Family 0.65
PF03786UxuA 0.65
PF13673Acetyltransf_10 0.65
PF09723Zn-ribbon_8 0.65
PF03704BTAD 0.65
PF10012DUF2255 0.65
PF00834Ribul_P_3_epim 0.65
PF02518HATPase_c 0.65
PF00069Pkinase 0.65
PF08241Methyltransf_11 0.65
PF00753Lactamase_B 0.65
PF08240ADH_N 0.65
PF13544Obsolete Pfam Family 0.65
PF04014MazE_antitoxin 0.65
PF01797Y1_Tnp 0.65
PF01370Epimerase 0.65
PF06262Zincin_1 0.65
PF02954HTH_8 0.65
PF01979Amidohydro_1 0.65
PF08281Sigma70_r4_2 0.65
PF10754DUF2569 0.65
PF14307Glyco_tran_WbsX 0.65
PF01641SelR 0.65
PF00440TetR_N 0.65
PF02652Lactate_perm 0.65
PF02371Transposase_20 0.65
PF03631Virul_fac_BrkB 0.65
PF01740STAS 0.65
PF08308PEGA 0.65
PF00144Beta-lactamase 0.65
PF09413DUF2007 0.65
PF00248Aldo_ket_red 0.65
PF13414TPR_11 0.65
PF13883Pyrid_oxidase_2 0.65
PF00004AAA 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG0407Uroporphyrinogen-III decarboxylase HemECoenzyme transport and metabolism [H] 21.57
COG0276Protoheme ferro-lyase (ferrochelatase)Coenzyme transport and metabolism [H] 2.61
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.61
COG0249DNA mismatch repair ATPase MutSReplication, recombination and repair [L] 1.96
COG1488Nicotinic acid phosphoribosyltransferaseCoenzyme transport and metabolism [H] 1.31
COG1620L-lactate permeaseEnergy production and conversion [C] 0.65
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.65
COG3824Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domainPosttranslational modification, protein turnover, chaperones [O] 0.65
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.65
COG3547TransposaseMobilome: prophages, transposons [X] 0.65
COG2367Beta-lactamase class ADefense mechanisms [V] 0.65
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.65
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.65
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.65
COG0036Pentose-5-phosphate-3-epimeraseCarbohydrate transport and metabolism [G] 0.65
COG1312D-mannonate dehydrataseCarbohydrate transport and metabolism [G] 0.65
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.65
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.70 %
UnclassifiedrootN/A18.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_102802099All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300001593|JGI12635J15846_10618711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis629Open in IMG/M
3300001867|JGI12627J18819_10429536Not Available539Open in IMG/M
3300002908|JGI25382J43887_10219052All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium900Open in IMG/M
3300004633|Ga0066395_10559126Not Available666Open in IMG/M
3300005332|Ga0066388_108011472Not Available528Open in IMG/M
3300005436|Ga0070713_101794706All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300005451|Ga0066681_10513069All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300005534|Ga0070735_10135163All Organisms → cellular organisms → Bacteria → Acidobacteria1534Open in IMG/M
3300005548|Ga0070665_102296159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300005578|Ga0068854_100009634All Organisms → cellular organisms → Bacteria6238Open in IMG/M
3300005591|Ga0070761_10767307Not Available606Open in IMG/M
3300005843|Ga0068860_102711011All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300006041|Ga0075023_100140801All Organisms → cellular organisms → Bacteria → Acidobacteria879Open in IMG/M
3300006050|Ga0075028_100751034All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300006059|Ga0075017_100884300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium693Open in IMG/M
3300006173|Ga0070716_100032703All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2840Open in IMG/M
3300006852|Ga0075433_10024731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5072Open in IMG/M
3300006914|Ga0075436_100583785All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium822Open in IMG/M
3300007982|Ga0102924_1148012All Organisms → cellular organisms → Bacteria → Acidobacteria1089Open in IMG/M
3300009012|Ga0066710_100327047All Organisms → cellular organisms → Bacteria2257Open in IMG/M
3300009098|Ga0105245_12491704Not Available571Open in IMG/M
3300009168|Ga0105104_10528746All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes666Open in IMG/M
3300009518|Ga0116128_1217903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300009521|Ga0116222_1214432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
3300009521|Ga0116222_1388736All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300009547|Ga0116136_1067108All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium972Open in IMG/M
3300009614|Ga0116104_1069951Not Available730Open in IMG/M
3300009634|Ga0116124_1141095All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300009700|Ga0116217_10411314All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300009764|Ga0116134_1094529All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1087Open in IMG/M
3300009839|Ga0116223_10245546All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300009839|Ga0116223_10291765All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300010048|Ga0126373_13316837All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum501Open in IMG/M
3300010358|Ga0126370_10620272All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium937Open in IMG/M
3300010376|Ga0126381_100329107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2104Open in IMG/M
3300010379|Ga0136449_100344620All Organisms → cellular organisms → Bacteria → Acidobacteria2682Open in IMG/M
3300011269|Ga0137392_10408648All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300012199|Ga0137383_10368259All Organisms → cellular organisms → Bacteria → Acidobacteria1053Open in IMG/M
3300012202|Ga0137363_11721371All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300012211|Ga0137377_11415046All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300012356|Ga0137371_10521823All Organisms → cellular organisms → Bacteria → Acidobacteria916Open in IMG/M
3300012362|Ga0137361_10245306All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1631Open in IMG/M
3300012924|Ga0137413_10110892All Organisms → cellular organisms → Bacteria1730Open in IMG/M
3300012930|Ga0137407_10046161All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3510Open in IMG/M
3300013102|Ga0157371_10990432All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300013296|Ga0157374_11976516All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300013307|Ga0157372_11585013All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300014159|Ga0181530_10458153All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300014489|Ga0182018_10016004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5104Open in IMG/M
3300014489|Ga0182018_10375794Not Available763Open in IMG/M
3300014501|Ga0182024_10122435All Organisms → cellular organisms → Bacteria3718Open in IMG/M
3300015241|Ga0137418_10471144All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1010Open in IMG/M
3300017933|Ga0187801_10464304All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300017935|Ga0187848_10296322All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300017940|Ga0187853_10172911All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300017943|Ga0187819_10010701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5193Open in IMG/M
3300017943|Ga0187819_10271947All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium988Open in IMG/M
3300017955|Ga0187817_10616291All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300017972|Ga0187781_10318154All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300017995|Ga0187816_10016987All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2805Open in IMG/M
3300017995|Ga0187816_10295083All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300018034|Ga0187863_10040226All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2713Open in IMG/M
3300018037|Ga0187883_10096043All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1542Open in IMG/M
3300018040|Ga0187862_10013144All Organisms → cellular organisms → Bacteria → Proteobacteria6819Open in IMG/M
3300018042|Ga0187871_10772280Not Available536Open in IMG/M
3300018088|Ga0187771_11544146All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300018482|Ga0066669_12051012All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300019881|Ga0193707_1073968All Organisms → cellular organisms → Bacteria → Acidobacteria1054Open in IMG/M
3300020015|Ga0193734_1038689All Organisms → cellular organisms → Bacteria → Acidobacteria890Open in IMG/M
3300020579|Ga0210407_10299450All Organisms → cellular organisms → Bacteria → Acidobacteria1256Open in IMG/M
3300020579|Ga0210407_10869124All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300020580|Ga0210403_10719276All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300020581|Ga0210399_10738804All Organisms → cellular organisms → Bacteria → Acidobacteria807Open in IMG/M
3300020582|Ga0210395_10687254Not Available766Open in IMG/M
3300021178|Ga0210408_10804438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium736Open in IMG/M
3300021181|Ga0210388_11575400All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300021401|Ga0210393_10293909Not Available1319Open in IMG/M
3300021405|Ga0210387_10004101All Organisms → cellular organisms → Bacteria11170Open in IMG/M
3300021405|Ga0210387_11343738All Organisms → cellular organisms → Bacteria → Acidobacteria616Open in IMG/M
3300021407|Ga0210383_11581725All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300021420|Ga0210394_10221534All Organisms → cellular organisms → Bacteria1652Open in IMG/M
3300021420|Ga0210394_11153478Not Available667Open in IMG/M
3300021477|Ga0210398_10427279Not Available1080Open in IMG/M
3300021479|Ga0210410_10068950All Organisms → cellular organisms → Bacteria → Acidobacteria3099Open in IMG/M
3300021479|Ga0210410_10630209All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300022557|Ga0212123_10893941All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300025320|Ga0209171_10635319All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300025414|Ga0208935_1042519All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300025506|Ga0208937_1037236All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1169Open in IMG/M
3300025612|Ga0208691_1012492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2106Open in IMG/M
3300025898|Ga0207692_10729402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300025905|Ga0207685_10540271All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300025911|Ga0207654_10224915All Organisms → cellular organisms → Bacteria → Acidobacteria1247Open in IMG/M
3300025911|Ga0207654_10902379All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300025916|Ga0207663_10780692All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300025918|Ga0207662_10548666Not Available800Open in IMG/M
3300025920|Ga0207649_10025475All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3448Open in IMG/M
3300025927|Ga0207687_10332322All Organisms → cellular organisms → Bacteria → Acidobacteria1233Open in IMG/M
3300025928|Ga0207700_10961111All Organisms → cellular organisms → Bacteria → Acidobacteria765Open in IMG/M
3300025939|Ga0207665_10830350All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300025944|Ga0207661_11195053All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300026309|Ga0209055_1042701All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1995Open in IMG/M
3300026497|Ga0257164_1068256Not Available589Open in IMG/M
3300026538|Ga0209056_10374458All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300027546|Ga0208984_1069634Not Available758Open in IMG/M
3300027562|Ga0209735_1079331All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300027568|Ga0208042_1167913All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300027660|Ga0209736_1132128All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300027674|Ga0209118_1194211Not Available549Open in IMG/M
3300027698|Ga0209446_1058964All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300027812|Ga0209656_10431302All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300027846|Ga0209180_10208049All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1128Open in IMG/M
3300027854|Ga0209517_10108178All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1855Open in IMG/M
3300027867|Ga0209167_10183660All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300027895|Ga0209624_10307243Not Available1056Open in IMG/M
3300027905|Ga0209415_10147342All Organisms → cellular organisms → Bacteria → Acidobacteria2378Open in IMG/M
3300027908|Ga0209006_10724894All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis812Open in IMG/M
3300027986|Ga0209168_10024475All Organisms → cellular organisms → Bacteria → Acidobacteria3379Open in IMG/M
3300028047|Ga0209526_10135093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1731Open in IMG/M
3300028379|Ga0268266_12252090All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300028536|Ga0137415_10241037All Organisms → cellular organisms → Bacteria1618Open in IMG/M
3300030763|Ga0265763_1028513All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300030862|Ga0265753_1044160All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium770Open in IMG/M
3300031234|Ga0302325_10976451All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300031446|Ga0170820_14499697All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300031708|Ga0310686_102728950Not Available1169Open in IMG/M
3300031708|Ga0310686_103752102All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300031708|Ga0310686_114808754All Organisms → cellular organisms → Bacteria → Acidobacteria1264Open in IMG/M
3300031708|Ga0310686_117682949All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4697Open in IMG/M
3300031715|Ga0307476_10889863Not Available657Open in IMG/M
3300031718|Ga0307474_11040565All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300031753|Ga0307477_10025789All Organisms → cellular organisms → Bacteria4016Open in IMG/M
3300031753|Ga0307477_11002511Not Available548Open in IMG/M
3300031754|Ga0307475_10117324All Organisms → cellular organisms → Bacteria2092Open in IMG/M
3300031754|Ga0307475_10450307Not Available1035Open in IMG/M
3300031823|Ga0307478_10109644All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2149Open in IMG/M
3300031823|Ga0307478_10573544All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300031962|Ga0307479_10359795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1439Open in IMG/M
3300031962|Ga0307479_11424679All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300032174|Ga0307470_10027014All Organisms → cellular organisms → Bacteria2679Open in IMG/M
3300032180|Ga0307471_102805043All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300032180|Ga0307471_104158433All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300032783|Ga0335079_11288411All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300032805|Ga0335078_11229429All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300034817|Ga0373948_0159591All Organisms → cellular organisms → Bacteria568Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil8.50%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.19%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.23%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.27%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.31%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.31%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.31%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.31%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.31%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.31%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.65%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.65%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.65%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.65%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.65%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009614Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027161Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 (SPAdes)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300030763Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10280209923300000955SoilMAANQVVIYFDKQEDALLFTLAASLVMAAEGPVHSHHA
JGI12635J15846_1061871113300001593Forest SoilMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVRSSKAVAKV
JGI12627J18819_1042953613300001867Forest SoilMAASQVVLYFDKQEDALLFTLAASSVMSADGAARTNEVVARVAA
JGI25382J43887_1021905223300002908Grasslands SoilMAAYQVVLYFDKQEDALLFTLAASSIMSAEGPLHSGDAGV
Ga0066395_1055912623300004633Tropical Forest SoilMASQVVLYFEKQEDAVLFALAASSVISDGVKGPSDAAGKVAEEIRK
Ga0066388_10801147213300005332Tropical Forest SoilVAVNQVVLFFDKQEDALLFTLAASSIMSEHAPHSSDATAKVA
Ga0070713_10179470613300005436Corn, Switchgrass And Miscanthus RhizosphereMAANQVVLYFDKQEDALLFTLAASSVMSAEGPARRNDAVA
Ga0066681_1051306923300005451SoilMAASQVVLYFDKQEDALLFTLAASSVISSEAPVRAKEALV
Ga0070735_1013516323300005534Surface SoilMAANQVVLYFEKPEDALLFTLAASSVMSSDGSTHNSKAAVKVAQEISKA
Ga0070665_10229615913300005548Switchgrass RhizosphereVAAKHVVLYFDKQEDALLFTLAASSVMSAEGPLHS
Ga0068854_10000963413300005578Corn RhizosphereMAANQVVLYFDKQEDALLFTLAASSVMSAEGPLRGTKA
Ga0070761_1076730723300005591SoilMAANQVVLYFDTQQDALLFTLAASSVMSAGSPVHSNQAA
Ga0066706_1071781613300005598SoilMAASQVVLYFDKQEDALLFTLAASSVISSEAPVRAKEALVKIADEIRKASR
Ga0068860_10271101133300005843Switchgrass RhizosphereMAASQVVLYFDKPEDALLFTLAASSMISDDGPGRA
Ga0070717_1046009813300006028Corn, Switchgrass And Miscanthus RhizosphereMAASQVVLYFDKQEDALLFTLAASSIIADGAPLRESALK
Ga0075023_10014080113300006041WatershedsVHIAANQVVLYFDKQADALLFTLAASSVMSAEGPVH
Ga0075028_10075103413300006050WatershedsMAASQVVLYFDKQEDALLFTLAASSMISDEGPAGAGEALV
Ga0075017_10088430013300006059WatershedsMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHSRDAVAKVAEEIC
Ga0070716_10003270343300006173Corn, Switchgrass And Miscanthus RhizosphereMAASQVVLYFDKPEDALLFTLAASSMISDDGPARANEALVK
Ga0075433_1002473163300006852Populus RhizosphereMAASQVVLYFDKQEDALLFTLAASSVMSADEPVRPEEAGAR
Ga0075436_10058378513300006914Populus RhizosphereMSANQVVLYFDKQEDALLFTAAASSVMSAEGPVYRSDAV
Ga0102924_114801233300007982Iron-Sulfur Acid SpringMAANQVVLYFEKPEDALLFTLAASSVMSAEGAVHS
Ga0066710_10032704733300009012Grasslands SoilMATNQVVLYFDEQEDALLFTLAASSAMSAEGQLHSGDAAV
Ga0105245_1249170413300009098Miscanthus RhizosphereMAASQVVLYFDKQEDALLFTLAASSMISDDGPARADEAL
Ga0105104_1052874613300009168Freshwater SedimentVLYFDKQEDALLFTLAASSVMSAEGPLHSSDAIVKVA
Ga0116128_121790313300009518PeatlandMAANQVVLYFERPEDALLFTLAASSVMSAEGQVHSN
Ga0116222_121443213300009521Peatlands SoilMHMAANQVVLYFDKQEDAVLFTLAASSVMSAEGPVHSSVAA
Ga0116222_138873613300009521Peatlands SoilMAANQVVLYFDKQEDALLFTLAASSIMSAEGPVHSSDAVVKV
Ga0116136_106710823300009547PeatlandMAANQVVLYFDKQEDAVLFTLAASSVMSAEGPVHSSVAAAKVAEEISK
Ga0116104_106995113300009614PeatlandMAASQVVLYFDKKEDALLFTLAASSVMSAEGPVHSSDAMVKVAEE
Ga0116124_114109513300009634PeatlandMAANQVVLYFERPEDALLFTLAASSVMSAEGQVHSNKAAARVAE
Ga0116217_1041131423300009700Peatlands SoilMKMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSDAVVK
Ga0116134_109452923300009764PeatlandMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHRGDAAVK
Ga0116223_1024554623300009839Peatlands SoilMKMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHG
Ga0116223_1029176513300009839Peatlands SoilMAANQVVLYFDKKEDALLFTLAASSVMSAEGPVHGSDAVVKVAEE
Ga0126373_1331683723300010048Tropical Forest SoilMAANQVVLYFEKPEDALLFTLAASSVMSADGSTHNSKAAVRVA
Ga0126370_1062027223300010358Tropical Forest SoilVVLYFDKQEDALLFTLAASSVMSAEGPVHSNDAVVKFAEEICK
Ga0126381_10032910733300010376Tropical Forest SoilMATNQVVLYFEKPENALLFTLAASSVMSAEGPLHSNKAA
Ga0136449_10034462013300010379Peatlands SoilMAANQVVLYFDKQEDAVLFTLAASSVMSAEGPVHSSV
Ga0137392_1040864823300011269Vadose Zone SoilMAANQVVLYFDNQQDALLFTLAASSVMSAEGPVHSSKAAV
Ga0137383_1036825923300012199Vadose Zone SoilMAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSNK
Ga0137363_1172137113300012202Vadose Zone SoilMAASQVVLYFDKPEDALLFTLAASSMISEDAPGRAN
Ga0137377_1141504613300012211Vadose Zone SoilMAASQVVLYFDKQEDALLFTLAASSMISDDGPGRASEALVKVA
Ga0137371_1052182333300012356Vadose Zone SoilMAASQVVLYFDKQEDALLFTLAASSVISSEAPVRAKEALVKIADEIRKA
Ga0137361_1024530633300012362Vadose Zone SoilMAASQVVLYFDKQEDALLFTLAASSMISDDGPARADEALVKVAAEIRKA
Ga0137413_1011089213300012924Vadose Zone SoilMAANQVVLYFDKQEDALLFTLAASSVMSADGPVHRGDAAVKVAEEICKVR
Ga0137407_1004616133300012930Vadose Zone SoilMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHRSVAVVKVAEEICKA
Ga0157371_1099043223300013102Corn RhizosphereMAASQVVLYFDKPEDALLFTLAASSMISDDGPGRADEALVKVAAEIRKAS
Ga0157374_1197651613300013296Miscanthus RhizosphereMAANQVVLYFEKPEDALLFTLAASSVMSAEGSVYS
Ga0157372_1158501323300013307Corn RhizosphereMAASQVVLYFDKQEDALLFTLAASSMISDDGPARA
Ga0120132_105149913300013832PermafrostMAASQVVLYFDRQEDALLFTLAASSVITADEPNRTD
Ga0181530_1045815313300014159BogMAANQVVLYFDKQEDAVLFTLAASSVMSAEGPVHSSVAAAKVAEEIC
Ga0182018_1001600473300014489PalsaMAANQVVLYFDKHEDAVLFTLAASSIMSAEGPVQS
Ga0182018_1037579413300014489PalsaMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVRSSDAVVKV
Ga0182024_1012243543300014501PermafrostMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVRSS
Ga0137418_1047114413300015241Vadose Zone SoilMAANQVVVYFDTQQDALLFTLAASSVMSTEGSVHSSKA
Ga0187801_1046430423300017933Freshwater SedimentMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSD
Ga0187848_1029632213300017935PeatlandMAANQVVLYFERPEDALLFTLAASSVMSAEGQVHSNKAAARVAEEI
Ga0187853_1017291123300017940PeatlandMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHRGDAAVKVA
Ga0187819_1001070113300017943Freshwater SedimentMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSDAVVKV
Ga0187819_1027194713300017943Freshwater SedimentMAANQVVLYFDKQEDALLFTLAASSVMSAEGPAHSSDAA
Ga0187817_1061629113300017955Freshwater SedimentMAANQVVVYFDKQEDALLFTLAASSVMSAEGPVRSSAAV
Ga0187781_1031815413300017972Tropical PeatlandMAANQVVLYFDKQEDAVLFTLAASSVMSAEGPTHNRDAAVKVA
Ga0187816_1001698713300017995Freshwater SedimentMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSDAVVK
Ga0187816_1029508313300017995Freshwater SedimentMAVNQVVVYFDKQEDAVLFTLAASSVMSAEGPVRSSAAVVK
Ga0187863_1004022643300018034PeatlandMAANQVVLYFDKQEDALLFTLAASSVMSADGPVHS
Ga0187883_1009604313300018037PeatlandMAANQVVLYFDKHEDAVLFTLAASSVMSAEGPVQSSDAANKVAEEI
Ga0187862_1001314483300018040PeatlandMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVPSGDAAVKVAEEISK
Ga0187871_1077228013300018042PeatlandMAANQVVLYFDKQEDALLFTLAASSVMSADGPVHRSD
Ga0187771_1154414613300018088Tropical PeatlandMAANQVVLYFDKQEDALLFTLAASTAMSAEEPTRASEAGLRMAKEIC
Ga0066669_1205101223300018482Grasslands SoilMAAYQVMLYFDKQEDALLFTLAASSIMSAEGPLHS
Ga0193707_107396823300019881SoilMAASQVVLYFDKQEDALLFTLAASSVISSEAPVRAKEALVKI
Ga0193755_101117113300020004SoilMGEVLQMAASQVVLYFDKQEDALLFTLAASSVISSEAPVRAKEALVKIAD
Ga0193734_103868923300020015SoilMAASQVVLYFDKQEDALLFTLAASSVISSEAPVRA
Ga0210407_1029945023300020579SoilMAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSSKAAV
Ga0210407_1086912423300020579SoilMAASQVVLYFDKQEDALLFTLAASSMISEDGPARADEALVKVAAEIRKA
Ga0210403_1071927613300020580SoilMAASQVVLYFDKQEDALLFTLAASSMISDDGPARADEALV
Ga0210399_1073880423300020581SoilMAANQVVLYFEKPEDALLFTVAASSVMSAEGAVHSSK
Ga0210395_1068725423300020582SoilMSANQVVLYFDKQEDALLFTLAASSVMSGEGPVHR
Ga0210408_1080443813300021178SoilMATNQVVLYFDEQKDALLFTLAASSAMSAEGPLHRGDAAVKVAGA
Ga0210388_1157540023300021181SoilMAANQVVLYFEKPEDALLFTVAASSVMSAEGAVHSS
Ga0210393_1029390913300021401SoilMAANQVVLYFDKQEDALLFTLAASSVMSADGPVNGSDAVVK
Ga0210387_10004101123300021405SoilMAANQVILYFDNQEDAVLFTLAASSVMSAEEPTESSNAA
Ga0210387_1134373813300021405SoilMAANQVVLYFEKPEDALLFTVAASSVMSAEGAVHSSKAAVR
Ga0210383_1069644913300021407SoilMAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSSKAAVKVAEEICKD
Ga0210383_1158172513300021407SoilMAASQVVLYFDKQEDALLFTLAASSMISDDGPTRANEALVKIAAEIRKA
Ga0210394_1022153413300021420SoilMAANQVVLYFEKPEDALLFTLAASSVMSAEGAVHSS
Ga0210394_1115347813300021420SoilMSANQVVLYFDKQEDALLFTLAASSVMSAEGSVHR
Ga0210398_1042727913300021477SoilMAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSSKAAVKV
Ga0210410_1006895063300021479SoilMAANQVVLYFEKPEDALLFTVAASSVMSAEGAVHSSKA
Ga0210410_1063020923300021479SoilMAASQVVLYFDKQEDALLFTLAASSVISPDGPGRKD
Ga0212123_1089394113300022557Iron-Sulfur Acid SpringVAANQVVLYFDKQEDAVLFTLAASSVMSAEGPMRGSDAMVKVAKEICK
Ga0209171_1063531913300025320Iron-Sulfur Acid SpringMAANQGVLYSDKQEDALLFTLAASSVMSTEGPVRSTAAVAKVAE
Ga0208935_104251913300025414PeatlandMGTNQVVLYFDKQEDALLFTLAASSVMSAEESVRSSKAAVRV
Ga0208937_103723613300025506PeatlandMAANEVVLYFDKHEDAVLFTLAASSVMSAEGPLQSSNAGD
Ga0208691_101249233300025612PeatlandMAANQVVLYFDKQEDALLFTLAASSVMSADGPVHSSDAV
Ga0207692_1072940213300025898Corn, Switchgrass And Miscanthus RhizosphereMAANQVVLYFEKPEDALLFTLAASSVMSAEGSVYSSKAAV
Ga0207685_1054027113300025905Corn, Switchgrass And Miscanthus RhizosphereMAANQVVLYFEKPEDALLFTLAASSVMSAEGPVHGNKAVVRVAQEI
Ga0207654_1022491513300025911Corn RhizosphereMAANQVVLYFDKQEDALLFTLAASSVMSAEGPLRGTKAADKVADE
Ga0207654_1090237923300025911Corn RhizosphereMSANQVVIYFDKQEDALLFTLAASSVMSAEGSVDQSDAVVK
Ga0207663_1078069213300025916Corn, Switchgrass And Miscanthus RhizosphereMAANQVVLYFDKQEDALLFTLAASSVMSGEGPLHSNDPVINFAE
Ga0207662_1054866623300025918Switchgrass RhizosphereMAASQVVLYFDKQEDALLFTLAASSMISDEGPARADEALVKVAA
Ga0207649_1002547513300025920Corn RhizosphereMAASQVVLYFDKQEDALLFTLAASSMISDDGPARADEALVKVGA
Ga0207649_1053089323300025920Corn RhizosphereMAANQVVLYFDKQEDALLFTLAASSVMSAEGPLRGTKAADKVADEICKA
Ga0207687_1033232213300025927Miscanthus RhizosphereMSANQVVIYFDKQEDALLFTLAASSVMSAEGSVEQS
Ga0207700_1096111113300025928Corn, Switchgrass And Miscanthus RhizosphereMAANQVVLYFDKQEDALLFTLAASSVMSAEGPARRNDAVAK
Ga0207665_1083035023300025939Corn, Switchgrass And Miscanthus RhizosphereMAASQVVLYFDKQEDALLFTLAASSVISSEAPVRAKEALVKIA
Ga0207661_1119505313300025944Corn RhizosphereMAANQVVLYFDKQEDALLFTLAASSVMSAEGPLRGTK
Ga0209055_104270113300026309SoilMAAYQVVLYFDKQEDALLFTLAASSIMSAEGPLHS
Ga0257164_106825613300026497SoilMAASQVVLYFDKQEDALLFTLAASSMISDEGPAGAGEALVKIAAEIR
Ga0209056_1037445813300026538SoilMATKQVVLYFEKPEDALLFTLAASSVMSAEASIHSSKAAVRVAEGLCKA
Ga0208368_10085713300027161Forest SoilMAANQVVLYFDKQEDALLFTLAASSVMSAEGPLHSNDPVINFAEQICKAR
Ga0208984_106963413300027546Forest SoilMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHS
Ga0209735_107933113300027562Forest SoilMAANQVVLYFDTQQDALLFALAASSVMSAEGPVHSN
Ga0208042_116791313300027568Peatlands SoilMAASQVVLYFDKQEDALLFTLAASSVMSAEGPARGSEAVAKVA
Ga0209736_113212813300027660Forest SoilMAASQVVLYFDKQEDALLFTLAASSVIGADKSVRGNQSA
Ga0209118_119421123300027674Forest SoilMAVNQVVLYFDKEQDALLFTLAASSLMSGERQGLTSKAADRV
Ga0209446_105896413300027698Bog Forest SoilMAANQVVLYFDKQEDALLFTLAASTVMSEDGPVRGS
Ga0209656_1043130213300027812Bog Forest SoilMAANQVVLYFDKQEDALLFTLAASSVMSEEGPVRSS
Ga0209180_1020804923300027846Vadose Zone SoilMAANQVVLYFDKQEDALLFALAASSVMSAERPVHSGD
Ga0209517_1010817813300027854Peatlands SoilMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVRGSDA
Ga0209167_1018366013300027867Surface SoilMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHG
Ga0209624_1030724313300027895Forest SoilMAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSSKAAVKVA
Ga0209415_1014734243300027905Peatlands SoilMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSDAVVKVAEEIS
Ga0209006_1072489413300027908Forest SoilMAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSS
Ga0209168_1002447533300027986Surface SoilMAANQVVLYFEKPEDALLFTLAASSVMSAEGPSSKAAV
Ga0209526_1013509333300028047Forest SoilMAASQVVLYFDKQEDALLFTLAASSMISDDGPARADEALVKVAAEIRKAN
Ga0268266_1225209013300028379Switchgrass RhizosphereVAAKHVVLYFDKQEDALLFTLAASSVMSAEGPLHSS
Ga0137415_1024103733300028536Vadose Zone SoilMATNRVVLYFDEQEDALLFTLAASSAMSAEGPLHSGDAAVK
Ga0265763_102851323300030763SoilMAASQVVLYFDKQEDALLFTLAASSVMSAEGQVHSSDAVVKVA
Ga0265753_104416013300030862SoilMAANQVVLYFDKQEDAMRFTLAASSVMSAEGPVLYSNRAVLKVAEEI
Ga0302325_1097645113300031234PalsaMTTNQVILYFDNQEDAVLFTLAASSVMSAEEPTDSSNAAA
Ga0170820_1449969713300031446Forest SoilMAASQVVLYFDKPEDALLFTLAASSMISEDAPGRANEALVKVAAEIRK
Ga0310686_10272895023300031708SoilMAANQVVLYFDKQEDALLFTLAASSVMSADGPVHSSDAVV
Ga0310686_10375210223300031708SoilMAANQVVLYFDKEEDALLFTLAASSVMSAEGPMRGSDAVAKVA
Ga0310686_11480875423300031708SoilMAANQVVLYFDKQEDAVLFTLAASSVMSAEGPVHGNAAVVKVAMDRSFR
Ga0310686_11768294913300031708SoilMAANQVVLYFDKQEDAVLFTLAASSVMSAEGPVHGSDA
Ga0307476_1088986313300031715Hardwood Forest SoilMAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSSKAA
Ga0307474_1104056523300031718Hardwood Forest SoilMAANQVVLYFEKPEDALLFTLAASSVLSAEGAVHSSKAAVRV
Ga0307477_1002578913300031753Hardwood Forest SoilMAVNQVVLYFDKEQDALLFTLAASSVMSAEGPGPS
Ga0307477_1100251113300031753Hardwood Forest SoilMASNQVVLYFDTQQDALLFTLAASSVMSAEGPAHSNKAAVRVAEEICK
Ga0307475_1011732453300031754Hardwood Forest SoilMAANQVVLYFDTQQDALLFTLAASSVMSAEGPVHSNKAAF
Ga0307475_1045030713300031754Hardwood Forest SoilMAANQVVLYFDTQQDALLFTLAASSVMSAEGPVYSNKAAVR
Ga0307478_1010964433300031823Hardwood Forest SoilMAANQVVLYFEKPEDALLFTLAASSVMSAEGSLHSSKAAVRVAQ
Ga0307478_1057354423300031823Hardwood Forest SoilMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHGSDAVVKVAEEI
Ga0307479_1035979533300031962Hardwood Forest SoilMAASQVVLYFDKQEDALLFTLAASSMISEDGPARADE
Ga0307479_1142467913300031962Hardwood Forest SoilMAANQVVLYFDKQEDALLFTLAASSVMSAEGPVHSSNAAVKV
Ga0307470_1002701413300032174Hardwood Forest SoilMAANQVVLYFEKPEDALLFTLAASSVMSAEGPVHSSK
Ga0307471_10280504323300032180Hardwood Forest SoilMAANQVVLYFEKPEDALLFTLAASSVMSAEGAVHSSKAAFRVAQEIC
Ga0307471_10415843323300032180Hardwood Forest SoilMAASQVVLYFDKQEDALLFTLAASSVISPEGPGRANEALVKIAEEICKA
Ga0335079_1128841123300032783SoilMAASQVVVYFEKQEDALLFTLAASSAISAEEPLGAT
Ga0335078_1122942913300032805SoilMAASQVVLYFDKQEDALLFTLAASSVMAADGPVHAEEAVMKIATEICKA
Ga0373948_0159591_2_1333300034817Rhizosphere SoilMAASQVVLYFDKQEDALLFTLAASSMISDDGPARADEALVKVAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.